F458386

General Info

Members Datasets Scaffolds Average Seq Length
519 241 1038 215

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100047538|Ga0075435_1000475383
Length 244
Sequence MSSEGTIASGSGIRPSAGSGRPEHVEGRYPGSEITSRRGLLFVVSAPSGTGKTTVAERLVQVVPDLALSRSYTSRAIRPGEVDGIDYNFITRARFEQMIAAEAFLEFADVFGNLYGTCAADAEAFLAAGRDLVLVIDVQGARLVRERSTGTVGVFVLPPSFQILEQRLRGRSSDTEEAMQRRLQAARDEVAAFSEYEYVVINDELEACVDRLRSIVLAERAHLRSMRGAAEEIVKTFIRSSQEK

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
162 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
163 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
164 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 6.94
Rhizosphere 85.16
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100047538 3300007076 Bacteria 3445
2 Ga0058861_11816476 3300004800 Bacteria 864
3 Ga0065714_10174506 3300005288 Bacteria 989
4 Ga0065704_10123156 3300005289 Bacteria 1738
5 Ga0065712_10000168 3300005290 Bacteria 34755
6 Ga0065712_10068840 3300005290 Bacteria 8818
7 Ga0065712_10136737 3300005290 Bacteria 1490
8 Ga0065715_10000195 3300005293 Bacteria 41796
9 Ga0065715_10003016 3300005293 Bacteria 4994
10 Ga0065715_10048346 3300005293 Bacteria 931
11 Ga0065715_10176960 3300005293 Bacteria 1504
12 Ga0065707_10198932 3300005295 Bacteria 1320
13 Ga0065707_10448725 3300005295 Bacteria 803
14 Ga0070683_100000919 3300005329 Bacteria 21853
15 Ga0070690_100653511 3300005330 Unclassified 803
16 Ga0070670_100008594 3300005331 Bacteria 8711
17 Ga0070670_100012720 3300005331 Bacteria 7201
18 Ga0070670_100031615 3300005331 Bacteria 4559
19 Ga0070670_100106946 3300005331 Bacteria 2411
20 Ga0070670_100451158 3300005331 Bacteria 1140
21 Ga0068869_100019914 3300005334 Bacteria 4594
22 Ga0070666_10070619 3300005335 Bacteria 2376
23 Ga0070666_10150223 3300005335 Bacteria 1625
24 Ga0070666_10174289 3300005335 Bacteria 1507
25 Ga0068868_100873554 3300005338 Bacteria 816
26 Ga0070689_100085259 3300005340 Bacteria 2484
27 Ga0070687_100078530 3300005343 Bacteria 1794
28 Ga0070661_100126411 3300005344 Bacteria 1918
29 Ga0070661_100277550 3300005344 Bacteria 1299
30 Ga0070669_100003029 3300005353 Bacteria 12086
31 Ga0070675_100128346 3300005354 Bacteria 2159
32 Ga0070675_100215137 3300005354 Bacteria 1672
33 Ga0070675_100581274 3300005354 Bacteria 1015
34 Ga0070675_100982486 3300005354 Bacteria 775
35 Ga0070671_100119049 3300005355 Bacteria 2222
36 Ga0070671_100199374 3300005355 Bacteria 1697
37 Ga0070674_100101942 3300005356 Bacteria 2093
38 Ga0070674_100688299 3300005356 Bacteria 873
39 Ga0070674_101027383 3300005356 Bacteria 724
40 Ga0070688_100333083 3300005365 Bacteria 1106
41 Ga0070659_100103613 3300005366 Bacteria 2292
42 Ga0070667_100132562 3300005367 Bacteria 2176
43 Ga0070667_100520982 3300005367 Bacteria 1091
44 Ga0070701_10291410 3300005438 Bacteria 1000
45 Ga0070705_100456270 3300005440 Bacteria 960
46 Ga0070700_100057347 3300005441 Bacteria 2444
47 Ga0070700_100346444 3300005441 Bacteria 1100
48 Ga0070700_100456233 3300005441 Bacteria 974
49 Ga0070694_100452478 3300005444 Bacteria 1014
50 Ga0070708_100337547 3300005445 Bacteria 1420
51 Ga0070663_100085945 3300005455 Bacteria 2322
52 Ga0070678_100107543 3300005456 Bacteria 2176
53 Ga0070678_100117575 3300005456 Bacteria 2091
54 Ga0070678_100164167 3300005456 Bacteria 1803
55 Ga0070662_100048148 3300005457 Bacteria 3070
56 Ga0070662_100237609 3300005457 Bacteria 1460
57 Ga0070662_100248901 3300005457 Bacteria 1428
58 Ga0070681_10717083 3300005458 Bacteria 916
59 Ga0070681_10795850 3300005458 Bacteria 862
60 Ga0068867_100332581 3300005459 Bacteria 1262
61 Ga0070685_10004758 3300005466 Bacteria 6871
62 Ga0070706_100657068 3300005467 Unclassified 973
63 Ga0070707_100352596 3300005468 Bacteria 1429
64 Ga0070699_100445313 3300005518 Bacteria 1174
65 Ga0070699_100537072 3300005518 Bacteria 1064
66 Ga0070699_100742197 3300005518 Bacteria 898
67 Ga0070684_100000069 3300005535 Bacteria 65354
68 Ga0070684_100122850 3300005535 Bacteria 2337
69 Ga0070684_100375788 3300005535 Bacteria 1308
70 Ga0070684_100474085 3300005535 Unclassified 1158
71 Ga0070672_100088011 3300005543 Bacteria 2500
72 Ga0070672_100092312 3300005543 Bacteria 2444
73 Ga0070672_100295959 3300005543 Bacteria 1371
74 Ga0070686_100241251 3300005544 Bacteria 1316
75 Ga0070696_100517605 3300005546 Bacteria 951
76 Ga0070696_100641218 3300005546 Bacteria 860
77 Ga0070665_100000694 3300005548 Bacteria 44898
78 Ga0070665_100157915 3300005548 Bacteria 2270
79 Ga0070665_100655154 3300005548 Bacteria 1063
80 Ga0068855_100168015 3300005563 Bacteria 2485
81 Ga0070664_100002485 3300005564 Bacteria 14857
82 Ga0070664_100420781 3300005564 Bacteria 1224
83 Ga0068857_100034446 3300005577 Bacteria 4480
84 Ga0068856_100687497 3300005614 Bacteria 1043
85 Ga0070702_100316959 3300005615 Bacteria 1085
86 Ga0070702_100706181 3300005615 Bacteria 769
87 Ga0068852_100695848 3300005616 Bacteria 1026
88 Ga0068859_100213883 3300005617 Bacteria 2015
89 Ga0068859_101207401 3300005617 Bacteria 833
90 Ga0068864_100001127 3300005618 Bacteria 22319
91 Ga0068864_100047831 3300005618 Bacteria 3676
92 Ga0068866_10025819 3300005718 Bacteria 2767
93 Ga0068866_10084441 3300005718 Bacteria 1713
94 Ga0068861_100434738 3300005719 Bacteria 1172
95 Ga0068863_100237750 3300005841 Bacteria 1758
96 Ga0068858_100037512 3300005842 Bacteria 4495
97 Ga0068858_100052205 3300005842 Bacteria 3782
98 Ga0068858_100242605 3300005842 Bacteria 1710
99 Ga0068860_100172078 3300005843 Bacteria 2092
100 Ga0068860_100574435 3300005843 Bacteria 1131
101 Ga0068862_100015342 3300005844 Bacteria 6363
102 Ga0068862_100715830 3300005844 Bacteria 971
103 Ga0075365_10127115 3300006038 Bacteria 1762
104 Ga0075365_10186288 3300006038 Bacteria 1452
105 Ga0075365_10280435 3300006038 Bacteria 1173
106 Ga0075368_10009295 3300006042 Bacteria 3533
107 Ga0075368_10016894 3300006042 Bacteria 2724
108 Ga0075368_10067496 3300006042 Bacteria 1440
109 Ga0075368_10112092 3300006042 Bacteria 1125
110 Ga0075364_10000220 3300006051 Bacteria 27023
111 Ga0075364_10011391 3300006051 Bacteria 5403
112 Ga0075364_10198204 3300006051 Bacteria 1361
113 Ga0075432_10122753 3300006058 Bacteria 977
114 Ga0075367_10006828 3300006178 Bacteria 5801
115 Ga0075367_10033081 3300006178 Bacteria 2978
116 Ga0075367_10033475 3300006178 Bacteria 2962
117 Ga0075367_10048861 3300006178 Bacteria 2493
118 Ga0075367_10167551 3300006178 Bacteria 1368
119 Ga0075366_10002254 3300006195 Bacteria 9852
120 Ga0075366_10158542 3300006195 Bacteria 1371
121 Ga0075366_10161342 3300006195 Bacteria 1358
122 Ga0075366_10298847 3300006195 Bacteria 985
123 Ga0097621_100034683 3300006237 Bacteria 4026
124 Ga0097621_100113354 3300006237 Bacteria 2293
125 Ga0097621_100604190 3300006237 Bacteria 1003
126 Ga0075370_10046843 3300006353 Bacteria 2448
127 Ga0068871_100008541 3300006358 Bacteria 7361
128 Ga0068871_100229559 3300006358 Bacteria 1611
129 Ga0075428_100006269 3300006844 Bacteria 13223
130 Ga0075428_100039073 3300006844 Bacteria 5223
131 Ga0075428_100163439 3300006844 Bacteria 2415
132 Ga0075430_100000107 3300006846 Bacteria 49582
133 Ga0075430_100002354 3300006846 Bacteria 15705
134 Ga0075430_100027423 3300006846 Bacteria 4839
135 Ga0075430_100064828 3300006846 Bacteria 3070
136 Ga0075430_100108751 3300006846 Unclassified 2313
137 Ga0075431_100009253 3300006847 Bacteria 9888
138 Ga0075431_100018814 3300006847 Bacteria 7037
139 Ga0075431_100061855 3300006847 Bacteria 3863
140 Ga0075431_100143949 3300006847 Unclassified 2456
141 Ga0075433_10011258 3300006852 Bacteria 7201
142 Ga0075433_10036583 3300006852 Bacteria 4229
143 Ga0075433_11072188 3300006852 Bacteria 701
144 Ga0075434_100073853 3300006871 Bacteria 3403
145 Ga0075434_100077413 3300006871 Bacteria 3321
146 Ga0075429_100035133 3300006880 Bacteria 4358
147 Ga0075429_100035890 3300006880 Bacteria 4312
148 Ga0075429_100052324 3300006880 Bacteria 3553
149 Ga0075429_100087257 3300006880 Unclassified 2719
150 Ga0068865_100004693 3300006881 Bacteria 8253
151 Ga0068865_100092567 3300006881 Bacteria 2196
152 Ga0075436_100408884 3300006914 Unclassified 984
153 Ga0097620_100213889 3300006931 Bacteria 2015
154 Ga0097620_101207671 3300006931 Bacteria 833
155 Ga0105240_10065310 3300009093 Bacteria 4518
156 Ga0105240_10357677 3300009093 Bacteria 1655
157 Ga0111539_10000799 3300009094 Bacteria 40975
158 Ga0111539_10001903 3300009094 Bacteria 27805
159 Ga0111539_10097031 3300009094 Bacteria 3462
160 Ga0111539_10136813 3300009094 Bacteria 2869
161 Ga0111539_10286366 3300009094 Bacteria 1917
162 Ga0111539_11074813 3300009094 Bacteria 935
163 Ga0105245_10124236 3300009098 Bacteria 2413
164 Ga0105245_10171710 3300009098 Bacteria 2065
165 Ga0105247_10189623 3300009101 Bacteria 1376
166 Ga0114129_10000076 3300009147 Bacteria 90985
167 Ga0114129_10001945 3300009147 Bacteria 28294
168 Ga0114129_10005999 3300009147 Bacteria 17217
169 Ga0114129_10017182 3300009147 Bacteria 10304
170 Ga0114129_10017611 3300009147 Bacteria 10169
171 Ga0114129_10237998 3300009147 Bacteria 2448
172 Ga0114129_10404163 3300009147 Bacteria 1799
173 Ga0114129_10901748 3300009147 Bacteria 1120
174 Ga0105243_10161631 3300009148 Bacteria 1932
175 Ga0105242_10001668 3300009176 Bacteria 17566
176 Ga0105242_10003588 3300009176 Bacteria 12070
177 Ga0105242_10506951 3300009176 Bacteria 1149
178 Ga0105242_11253094 3300009176 Bacteria 763
179 Ga0105242_11522693 3300009176 Bacteria 700
180 Ga0105248_10032312 3300009177 Bacteria 5851
181 Ga0105248_10176703 3300009177 Bacteria 2406
182 Ga0105248_10641009 3300009177 Bacteria 1199
183 Ga0105249_10004760 3300009553 Bacteria 11709
184 Ga0105249_10137503 3300009553 Bacteria 2340
185 Ga0105249_11657557 3300009553 Bacteria 712
186 Ga0105239_10256243 3300010375 Bacteria 1966
187 Ga0105246_10544734 3300011119 Bacteria 993
188 Ga0105246_10615831 3300011119 Bacteria 940
189 Ga0157369_11328073 3300013105 Bacteria 733
190 Ga0157374_10012904 3300013296 Bacteria 7279
191 Ga0157374_10190813 3300013296 Bacteria 2004
192 Ga0157372_10077647 3300013307 Bacteria 3751
193 Ga0157372_10473913 3300013307 Bacteria 1459
194 Ga0157375_10203398 3300013308 Bacteria 2136
195 Ga0163163_10179792 3300014325 Bacteria 2162
196 Ga0163163_10202696 3300014325 Bacteria 2032
197 Ga0163163_10239407 3300014325 Bacteria 1864
198 Ga0163163_10274645 3300014325 Bacteria 1736
199 Ga0157380_10323372 3300014326 Bacteria 1431
200 Ga0157380_10393832 3300014326 Bacteria 1312
201 Ga0157380_11462783 3300014326 Bacteria 735
202 Ga0157377_10041766 3300014745 Bacteria 2545
203 Ga0157376_10338288 3300014969 Bacteria 1436
204 Ga0163161_10482485 3300017792 Bacteria 1007
205 Ga0207697_10001307 3300025315 Bacteria 13681
206 Ga0207642_10083380 3300025899 Bacteria 1559
207 Ga0207688_10109009 3300025901 Bacteria 1606
208 Ga0207680_10009958 3300025903 Bacteria 4737
209 Ga0207680_10139149 3300025903 Bacteria 1608
210 Ga0207645_10290896 3300025907 Bacteria 1086
211 Ga0207707_10599114 3300025912 Bacteria 933
212 Ga0207707_10754002 3300025912 Bacteria 814
213 Ga0207662_10410613 3300025918 Bacteria 920
214 Ga0207649_10017403 3300025920 Bacteria 4072
215 Ga0207646_10322292 3300025922 Bacteria 1396
216 Ga0207681_10037657 3300025923 Bacteria 3198
217 Ga0207681_10045693 3300025923 Bacteria 2942
218 Ga0207650_10005728 3300025925 Bacteria 8476
219 Ga0207650_10009994 3300025925 Bacteria 6496
220 Ga0207650_10035015 3300025925 Bacteria 3643
221 Ga0207650_10053491 3300025925 Bacteria 2993
222 Ga0207650_10081162 3300025925 Bacteria 2460
223 Ga0207659_10024881 3300025926 Bacteria 4019
224 Ga0207659_10069579 3300025926 Bacteria 2564
225 Ga0207659_10494634 3300025926 Bacteria 1035
226 Ga0207659_10702792 3300025926 Bacteria 866
227 Ga0207687_10258046 3300025927 Bacteria 1388
228 Ga0207644_10150630 3300025931 Bacteria 1800
229 Ga0207644_10164100 3300025931 Bacteria 1729
230 Ga0207690_10121954 3300025932 Bacteria 1895
231 Ga0207690_10197355 3300025932 Bacteria 1526
232 Ga0207690_10284327 3300025932 Bacteria 1289
233 Ga0207690_10350066 3300025932 Bacteria 1168
234 Ga0207690_10409390 3300025932 Bacteria 1083
235 Ga0207706_10043092 3300025933 Bacteria 4000
236 Ga0207706_10075305 3300025933 Bacteria 2968
237 Ga0207706_10535137 3300025933 Bacteria 1009
238 Ga0207686_10010413 3300025934 Bacteria 5063
239 Ga0207669_10081844 3300025937 Bacteria 2070
240 Ga0207669_10100503 3300025937 Bacteria 1911
241 Ga0207669_10230617 3300025937 Bacteria 1366
242 Ga0207669_10477640 3300025937 Bacteria 993
243 Ga0207704_10005186 3300025938 Bacteria 5998
244 Ga0207704_10045994 3300025938 Bacteria 2597
245 Ga0207704_10723808 3300025938 Bacteria 826
246 Ga0207691_10103682 3300025940 Bacteria 2536
247 Ga0207691_10119313 3300025940 Bacteria 2339
248 Ga0207691_10124042 3300025940 Bacteria 2286
249 Ga0207711_10102232 3300025941 Bacteria 2537
250 Ga0207711_10232349 3300025941 Bacteria 1689
251 Ga0207711_10356185 3300025941 Bacteria 1355
252 Ga0207689_10008384 3300025942 Bacteria 9002
253 Ga0207689_10027500 3300025942 Bacteria 4760
254 Ga0207661_10000496 3300025944 Bacteria 25296
255 Ga0207661_10011965 3300025944 Bacteria 6303
256 Ga0207679_10013559 3300025945 Bacteria 5341
257 Ga0207679_10268940 3300025945 Bacteria 1457
258 Ga0207679_10272324 3300025945 Bacteria 1448
259 Ga0207679_10281374 3300025945 Unclassified 1427
260 Ga0207679_10668931 3300025945 Bacteria 940
261 Ga0207667_10117693 3300025949 Bacteria 2739
262 Ga0207651_10170660 3300025960 Bacteria 1715
263 Ga0207712_10021103 3300025961 Bacteria 4272
264 Ga0207668_10121043 3300025972 Bacteria 1982
265 Ga0207658_10107566 3300025986 Bacteria 2198
266 Ga0207677_10248924 3300026023 Bacteria 1442
267 Ga0207677_10499429 3300026023 Bacteria 1051
268 Ga0207703_10154496 3300026035 Bacteria 2004
269 Ga0207703_10219595 3300026035 Bacteria 1699
270 Ga0207678_10178332 3300026067 Bacteria 1814
271 Ga0207708_10340340 3300026075 Bacteria 1228
272 Ga0207708_10495896 3300026075 Bacteria 1023
273 Ga0207708_10689792 3300026075 Bacteria 872
274 Ga0207641_10032241 3300026088 Bacteria 4350
275 Ga0207648_10096490 3300026089 Bacteria 2587
276 Ga0207648_10895515 3300026089 Bacteria 829
277 Ga0207676_10095982 3300026095 Bacteria 2446
278 Ga0207674_10102719 3300026116 Bacteria 2838
279 Ga0207675_100033511 3300026118 Bacteria 4785
280 Ga0207675_100483139 3300026118 Bacteria 1231
281 Ga0207675_100806605 3300026118 Bacteria 952
282 Ga0207683_10061720 3300026121 Bacteria 3299
283 Ga0207683_10174341 3300026121 Bacteria 1948
284 Ga0207683_10180932 3300026121 Bacteria 1911
285 Ga0207683_10557770 3300026121 Bacteria 1059
286 Ga0207698_10594464 3300026142 Bacteria 1090
287 Ga0209813_10106696 3300027866 Bacteria 960
288 Ga0209974_10071081 3300027876 Bacteria 1187
289 Ga0207428_10008697 3300027907 Bacteria 9163
290 Ga0207428_10009494 3300027907 Bacteria 8714
291 Ga0207428_10019485 3300027907 Bacteria 5784
292 Ga0207428_10080884 3300027907 Bacteria 2538
293 Ga0268266_10014412 3300028379 Bacteria 6796
294 Ga0268266_10040720 3300028379 Bacteria 3961
295 Ga0268265_10044067 3300028380 Bacteria 3320
296 Ga0268265_10538209 3300028380 Bacteria 1107
297 Ga0268264_10464128 3300028381 Bacteria 1229
298 Ga0268264_10499159 3300028381 Bacteria 1187
299 Ga0268264_10799768 3300028381 Unclassified 942
300 Ga0307408_100003278 3300031548 Bacteria 11128
301 Ga0307408_100012136 3300031548 Bacteria 5703
302 Ga0307408_100098890 3300031548 Bacteria 2219
303 Ga0307408_100215873 3300031548 Bacteria 1562
304 Ga0307408_100378900 3300031548 Bacteria 1209
305 Ga0307408_100528948 3300031548 Bacteria 1037
306 Ga0307408_100552677 3300031548 Bacteria 1016
307 Ga0307408_100562896 3300031548 Bacteria 1007
308 Ga0307405_10000233 3300031731 Bacteria 20107
309 Ga0307405_10015167 3300031731 Bacteria 4165
310 Ga0307413_10010202 3300031824 Bacteria 4541
311 Ga0307413_10197643 3300031824 Unclassified 1449
312 Ga0307413_10569604 3300031824 Bacteria 922
313 Ga0307413_10721244 3300031824 Bacteria 830
314 Ga0307410_11060819 3300031852 Unclassified 701
315 Ga0307406_10098677 3300031901 Bacteria 1984
316 Ga0307406_10120111 3300031901 Bacteria 1826
317 Ga0307406_10164606 3300031901 Bacteria 1598
318 Ga0307407_10217411 3300031903 Unclassified 1290
319 Ga0307407_10675661 3300031903 Bacteria 776
320 Ga0307412_10007811 3300031911 Bacteria 6087
321 Ga0307412_10056817 3300031911 Bacteria 2610
322 Ga0307412_10316802 3300031911 Bacteria 1239
323 Ga0307412_10520269 3300031911 Bacteria 994
324 Ga0307409_100049260 3300031995 Bacteria 3211
325 Ga0307409_100064969 3300031995 Bacteria 2869
326 Ga0307409_100228080 3300031995 Bacteria 1686
327 Ga0307416_100082994 3300032002 Bacteria 2717
328 Ga0307416_100334921 3300032002 Bacteria 1523
329 Ga0307416_100397529 3300032002 Bacteria 1414
330 Ga0307416_100561852 3300032002 Bacteria 1216
331 Ga0307416_101285250 3300032002 Bacteria 837
332 Ga0307414_10192459 3300032004 Bacteria 1652
333 Ga0307411_10030201 3300032005 Bacteria 3320
334 Ga0307411_10440369 3300032005 Bacteria 1087
335 Ga0307415_100008877 3300032126 Bacteria 5600
336 Ga0307415_100276215 3300032126 Bacteria 1379
337 Ga0307415_100384067 3300032126 Bacteria 1193
338 Ga0373923_0115538 3300035111 Bacteria 1195
339 Ga0373960_0131109 3300035121 Bacteria 841
340 Ga0373937_0006598 3300036401 Bacteria 10022
341 Ga0373925_0145995 3300037068 Bacteria 1855
342 Ga0395905_0211902 3300037471 Bacteria 1815
343 Ga0439436_0066814 3300041404 Bacteria 1004
344 Ga0439449_0197812 3300042007 Bacteria 752
345 Ga0439450_004517 3300042008 Bacteria 2382
346 Ga0450914_008275 3300042118 Bacteria 959
347 Ga0450920_025756 3300042122 Bacteria 1146
348 Ga0450921_003137 3300042123 Bacteria 1146
349 Ga0450895_001640 3300042132 Bacteria 1577
350 Ga0439446_0044550 3300042156 Bacteria 1313
351 Ga0439434_0062519 3300042435 Bacteria 1166
352 Ga0439435_0009860 3300042436 Bacteria 2252
353 Ga0439444_0048711 3300042437 Bacteria 855
354 Ga0439464_0008468 3300042439 Bacteria 2694
355 Ga0451577_0042591 3300042876 Bacteria 4071
356 Ga0495656_0140467 3300046615 Bacteria 1158
357 Ga0495635_0204722 3300046663 Bacteria 1338
358 Ga0495613_0295234 3300046689 Bacteria 1123
359 Ga0495672_0063516 3300047320 Bacteria 2119
360 Ga0496100_0531982 3300048903 Bacteria 908
361 Ga0496101_0061989 3300048904 Bacteria 2718
362 Ga0496101_0490234 3300048904 Bacteria 971
363 Ga0496102_0013426 3300048905 Bacteria 7094
364 Ga0496102_0243156 3300048905 Bacteria 1697
365 Ga0496102_0291892 3300048905 Bacteria 1537
366 Ga0496102_0311917 3300048905 Bacteria 1482
367 Ga0496103_0064468 3300048906 Bacteria 2284
368 Ga0496104_0001061 3300048907 Bacteria 23454
369 Ga0496104_0010804 3300048907 Bacteria 8167
370 Ga0496104_0673180 3300048907 Bacteria 943
371 Ga0496106_0031868 3300048909 Bacteria 3928
372 Ga0496106_0032296 3300048909 Bacteria 3903
373 Ga0496107_0116265 3300048910 Bacteria 1969
374 Ga0496107_0373741 3300048910 Bacteria 1060
375 Ga0496108_0004689 3300048911 Bacteria 11021
376 Ga0496108_0018269 3300048911 Bacteria 5741
377 Ga0496108_0124808 3300048911 Bacteria 2210
378 Ga0496109_0008900 3300048912 Bacteria 8553
379 Ga0496109_0009181 3300048912 Bacteria 8421
380 Ga0496109_0389869 3300048912 Bacteria 1316
381 Ga0496110_0010352 3300048913 Bacteria 7580
382 Ga0496110_0077141 3300048913 Bacteria 2964
383 Ga0496110_0224868 3300048913 Bacteria 1707
384 Ga0496111_0177429 3300048914 Bacteria 1583
385 Ga0496112_0001573 3300048915 Bacteria 17636
386 Ga0496112_0002226 3300048915 Bacteria 15477
387 Ga0496112_0196087 3300048915 Bacteria 1980
388 Ga0496112_0197663 3300048915 Bacteria 1971
389 Ga0496112_0366624 3300048915 Bacteria 1382
390 Ga0496112_0473277 3300048915 Bacteria 1190
391 Ga0496113_0003225 3300048916 Bacteria 9726
392 Ga0496113_0117412 3300048916 Bacteria 2077
393 Ga0496113_0526092 3300048916 Bacteria 949
394 Ga0496114_0189240 3300048917 Bacteria 1800
395 Ga0496114_0207608 3300048917 Bacteria 1717
396 Ga0501031_0494410 3300049568 Bacteria 789
397 Ga0501032_0408283 3300049569 Bacteria 872
398 Ga0501033_0544426 3300049570 Unclassified 800
399 Ga0501034_0027242 3300049571 Bacteria 5814
400 Ga0501034_0054372 3300049571 Bacteria 4031
401 Ga0501034_0060398 3300049571 Bacteria 3807
402 Ga0501034_0180842 3300049571 Bacteria 2073
403 Ga0501036_0325603 3300049572 Bacteria 1284
404 Ga0501039_0179990 3300049575 Unclassified 1663
405 Ga0501040_0052096 3300049576 Bacteria 2801
406 Ga0501040_0175164 3300049576 Bacteria 1520
407 Ga0501040_0364060 3300049576 Bacteria 1036
408 Ga0501040_0600594 3300049576 Bacteria 795
409 Ga0501041_0043978 3300049577 Bacteria 2715
410 Ga0501041_0079992 3300049577 Bacteria 2012
411 Ga0501041_0536446 3300049577 Bacteria 745
412 Ga0501042_0129289 3300049578 Bacteria 1820
413 Ga0501042_0132145 3300049578 Bacteria 1799
414 Ga0501042_0137986 3300049578 Bacteria 1758
415 Ga0501046_0274358 3300049580 Unclassified 1236
416 Ga0501048_0205628 3300049582 Bacteria 1396
417 Ga0501067_0079994 3300049583 Bacteria 1811
418 Ga0501067_0099865 3300049583 Bacteria 1612
419 Ga0501068_0373420 3300049584 Bacteria 918
420 Ga0501069_0248196 3300049585 Bacteria 1038
421 Ga0501069_0249386 3300049585 Bacteria 1035
422 Ga0501071_0008910 3300049587 Bacteria 6656
423 Ga0501071_0115651 3300049587 Bacteria 1985
424 Ga0501071_0225849 3300049587 Bacteria 1410
425 Ga0501071_0442499 3300049587 Bacteria 994
426 Ga0501072_0031404 3300049588 Bacteria 4158
427 Ga0501072_0051022 3300049588 Bacteria 3257
428 Ga0501072_0069410 3300049588 Bacteria 2783
429 Ga0501072_0072288 3300049588 Bacteria 2726
430 Ga0501072_0124811 3300049588 Bacteria 2051
431 Ga0501074_0089152 3300049590 Bacteria 2209
432 Ga0501074_0111231 3300049590 Bacteria 1960
433 Ga0501075_0041379 3300049591 Bacteria 3453
434 Ga0501075_0050319 3300049591 Bacteria 3132
435 Ga0501075_0614197 3300049591 Bacteria 829
436 Ga0501076_0008563 3300049592 Bacteria 7503
437 Ga0501076_0011714 3300049592 Bacteria 6546
438 Ga0501076_0045948 3300049592 Bacteria 3449
439 Ga0501076_0095900 3300049592 Bacteria 2389
440 Ga0501076_0370317 3300049592 Bacteria 1177
441 Ga0501077_0084181 3300049593 Bacteria 2016
442 Ga0501077_0143085 3300049593 Bacteria 1517
443 Ga0501207_023980 3300049654 Bacteria 993
444 Ga0501079_0079208 3300049741 Bacteria 2541
445 Ga0501079_0244955 3300049741 Bacteria 1401
446 Ga0501079_0544235 3300049741 Unclassified 913
447 Ga0501080_0224512 3300049742 Unclassified 1718
448 Ga0501080_0453735 3300049742 Bacteria 1149
449 Ga0501081_0065038 3300049743 Bacteria 2534
450 Ga0501081_0089527 3300049743 Bacteria 2163
451 Ga0501083_0221121 3300049744 Bacteria 1234
452 Ga0501283_009484 3300049779 Bacteria 1420
453 Ga0501044_0661336 3300049823 Unclassified 933
454 Ga0501045_0010908 3300049824 Bacteria 6364
455 Ga0501045_0036295 3300049824 Bacteria 3579
456 Ga0501045_0075712 3300049824 Bacteria 2479
457 Ga0501045_0167071 3300049824 Bacteria 1638
458 nmdc:mga03683_1327_c1 3300050489 Bacteria 7327
459 nmdc:mga00v17_170380_c1 3300050491 Bacteria 1404
460 nmdc:mga00v17_2313_c1 3300050491 Bacteria 3054
461 nmdc:mga00v17_52101_c1 3300050491 Bacteria 2489
462 nmdc:mga00v17_79305_c1 3300050491 Bacteria 2047
463 nmdc:mga0yw44_154637_c1 3300050492 Bacteria 1498
464 nmdc:mga0k408_117054_c1 3300050493 Bacteria 1154
465 nmdc:mga0k408_53604_c1 3300050493 Bacteria 2338
466 nmdc:mga06z11_104885_c1 3300050494 Bacteria 1557
467 nmdc:mga06z11_32874_c1 3300050494 Bacteria 2533
468 nmdc:mga06z11_36263_c1 3300050494 Bacteria 2434
469 nmdc:mga06z11_42710_c1 3300050494 Bacteria 2276
470 nmdc:mga06z11_437619_c1 3300050494 Bacteria 789
471 nmdc:mga04h51_125751_c1 3300050495 Bacteria 959
472 nmdc:mga04h51_30498_c1 3300050495 Bacteria 1697
473 nmdc:mga04h51_37430_c1 3300050495 Bacteria 1566
474 nmdc:mga04h51_42378_c1 3300050495 Bacteria 1492
475 nmdc:mga05p37_10317_c1 3300050507 Bacteria 11093
476 nmdc:mga05p37_1117328_c1 3300050507 Bacteria 823
477 nmdc:mga05p37_163431_c1 3300050507 Bacteria 2718
478 nmdc:mga05p37_269579_c1 3300050507 Bacteria 2035
479 nmdc:mga05p37_295407_c1 3300050507 Bacteria 1927
480 nmdc:mga05p37_8538_c1 3300050507 Bacteria 12107
481 nmdc:mga05p37_91_c1 3300050507 Bacteria 80826
482 nmdc:mga09592_8188_c1 3300050508 Bacteria 8499
483 nmdc:mga09592_85077_c1 3300050508 Bacteria 2698
484 nmdc:mga0qj67_274121_c1 3300050509 Bacteria 1368
485 nmdc:mga0qj67_444518_c1 3300050509 Bacteria 1045
486 nmdc:mga0qj67_6557_c1 3300050509 Bacteria 8549
487 nmdc:mga0qj67_71085_c1 3300050509 Bacteria 2777
488 nmdc:mga0qj67_79389_c1 3300050509 Bacteria 2628
489 nmdc:mga06r32_33898_c1 3300050510 Bacteria 4812
490 nmdc:mga06r32_49392_c1 3300050510 Bacteria 4022
491 nmdc:mga06r32_8031_c1 3300050510 Bacteria 9492
492 nmdc:mga06r32_81641_c1 3300050510 Bacteria 3149
493 nmdc:mga08y16_12398_c1 3300050511 Bacteria 8966
494 nmdc:mga08y16_13130_c1 3300050511 Bacteria 8714
495 nmdc:mga08y16_321557_c1 3300050511 Bacteria 1593
496 nmdc:mga08y16_37325_c1 3300050511 Bacteria 5104
497 nmdc:mga08y16_494095_c1 3300050511 Bacteria 1244
498 nmdc:mga08y16_62702_c1 3300050511 Bacteria 3882
499 nmdc:mga08y16_758041_c1 3300050511 Bacteria 966
500 nmdc:mga0n895_156971_c1 3300050512 Bacteria 2306
501 nmdc:mga0rr50_248642_c1 3300050513 Bacteria 1476
502 nmdc:mga0a205_111078_c1 3300050515 Bacteria 2640
503 nmdc:mga0a205_8523_c1 3300050515 Bacteria 9323
504 nmdc:mga0sz30_49232_c1 3300050516 Bacteria 1785
505 Ga0495601_0136314 3300053077 Bacteria 1600
506 Ga0495601_0346029 3300053077 Bacteria 967
507 Ga0495595_0111829 3300053084 Bacteria 1325
508 Ga0500568_0008725 3300053139 Bacteria 4863
509 Ga0500627_0207242 3300053158 Bacteria 878
510 Ga0501084_0041957 3300054114 Bacteria 3826
511 Ga0501084_0071987 3300054114 Bacteria 2895
512 Ga0501084_0402010 3300054114 Bacteria 1158
513 Ga0501084_0405221 3300054114 Bacteria 1153
514 Ga0590071_000241 3300059421 Bacteria 15993
515 Ga0590075_000084 3300059424 Bacteria 24119
516 Ga0590077_002782 3300059426 Bacteria 3682
517 Ga0501082_0707862 3300060353 Bacteria 881
518 Ga0530510_0018531 3300061734 Bacteria 4935
519 Ga0530510_0486537 3300061734 Unclassified 935
520 Ga0075435_100047538
521 Ga0058861_11816476
522 Ga0065714_10174506
523 Ga0065704_10123156
524 Ga0065712_10000168
525 Ga0065712_10068840
526 Ga0065712_10136737
527 Ga0065715_10000195
528 Ga0065715_10003016
529 Ga0065715_10048346
530 Ga0065715_10176960
531 Ga0065707_10198932
532 Ga0065707_10448725
533 Ga0070683_100000919
534 Ga0070690_100653511
535 Ga0070670_100008594
536 Ga0070670_100012720
537 Ga0070670_100031615
538 Ga0070670_100106946
539 Ga0070670_100451158
540 Ga0068869_100019914
541 Ga0070666_10070619
542 Ga0070666_10150223
543 Ga0070666_10174289
544 Ga0068868_100873554
545 Ga0070689_100085259
546 Ga0070687_100078530
547 Ga0070661_100126411
548 Ga0070661_100277550
549 Ga0070669_100003029
550 Ga0070675_100128346
551 Ga0070675_100215137
552 Ga0070675_100581274
553 Ga0070675_100982486
554 Ga0070671_100119049
555 Ga0070671_100199374
556 Ga0070674_100101942
557 Ga0070674_100688299
558 Ga0070674_101027383
559 Ga0070688_100333083
560 Ga0070659_100103613
561 Ga0070667_100132562
562 Ga0070667_100520982
563 Ga0070701_10291410
564 Ga0070705_100456270
565 Ga0070700_100057347
566 Ga0070700_100346444
567 Ga0070700_100456233
568 Ga0070694_100452478
569 Ga0070708_100337547
570 Ga0070663_100085945
571 Ga0070678_100107543
572 Ga0070678_100117575
573 Ga0070678_100164167
574 Ga0070662_100048148
575 Ga0070662_100237609
576 Ga0070662_100248901
577 Ga0070681_10717083
578 Ga0070681_10795850
579 Ga0068867_100332581
580 Ga0070685_10004758
581 Ga0070706_100657068
582 Ga0070707_100352596
583 Ga0070699_100445313
584 Ga0070699_100537072
585 Ga0070699_100742197
586 Ga0070684_100000069
587 Ga0070684_100122850
588 Ga0070684_100375788
589 Ga0070684_100474085
590 Ga0070672_100088011
591 Ga0070672_100092312
592 Ga0070672_100295959
593 Ga0070686_100241251
594 Ga0070696_100517605
595 Ga0070696_100641218
596 Ga0070665_100000694
597 Ga0070665_100157915
598 Ga0070665_100655154
599 Ga0068855_100168015
600 Ga0070664_100002485
601 Ga0070664_100420781
602 Ga0068857_100034446
603 Ga0068856_100687497
604 Ga0070702_100316959
605 Ga0070702_100706181
606 Ga0068852_100695848
607 Ga0068859_100213883
608 Ga0068859_101207401
609 Ga0068864_100001127
610 Ga0068864_100047831
611 Ga0068866_10025819
612 Ga0068866_10084441
613 Ga0068861_100434738
614 Ga0068863_100237750
615 Ga0068858_100037512
616 Ga0068858_100052205
617 Ga0068858_100242605
618 Ga0068860_100172078
619 Ga0068860_100574435
620 Ga0068862_100015342
621 Ga0068862_100715830
622 Ga0075365_10127115
623 Ga0075365_10186288
624 Ga0075365_10280435
625 Ga0075368_10009295
626 Ga0075368_10016894
627 Ga0075368_10067496
628 Ga0075368_10112092
629 Ga0075364_10000220
630 Ga0075364_10011391
631 Ga0075364_10198204
632 Ga0075432_10122753
633 Ga0075367_10006828
634 Ga0075367_10033081
635 Ga0075367_10033475
636 Ga0075367_10048861
637 Ga0075367_10167551
638 Ga0075366_10002254
639 Ga0075366_10158542
640 Ga0075366_10161342
641 Ga0075366_10298847
642 Ga0097621_100034683
643 Ga0097621_100113354
644 Ga0097621_100604190
645 Ga0075370_10046843
646 Ga0068871_100008541
647 Ga0068871_100229559
648 Ga0075428_100006269
649 Ga0075428_100039073
650 Ga0075428_100163439
651 Ga0075430_100000107
652 Ga0075430_100002354
653 Ga0075430_100027423
654 Ga0075430_100064828
655 Ga0075430_100108751
656 Ga0075431_100009253
657 Ga0075431_100018814
658 Ga0075431_100061855
659 Ga0075431_100143949
660 Ga0075433_10011258
661 Ga0075433_10036583
662 Ga0075433_11072188
663 Ga0075434_100073853
664 Ga0075434_100077413
665 Ga0075429_100035133
666 Ga0075429_100035890
667 Ga0075429_100052324
668 Ga0075429_100087257
669 Ga0068865_100004693
670 Ga0068865_100092567
671 Ga0075436_100408884
672 Ga0097620_100213889
673 Ga0097620_101207671
674 Ga0105240_10065310
675 Ga0105240_10357677
676 Ga0111539_10000799
677 Ga0111539_10001903
678 Ga0111539_10097031
679 Ga0111539_10136813
680 Ga0111539_10286366
681 Ga0111539_11074813
682 Ga0105245_10124236
683 Ga0105245_10171710
684 Ga0105247_10189623
685 Ga0114129_10000076
686 Ga0114129_10001945
687 Ga0114129_10005999
688 Ga0114129_10017182
689 Ga0114129_10017611
690 Ga0114129_10237998
691 Ga0114129_10404163
692 Ga0114129_10901748
693 Ga0105243_10161631
694 Ga0105242_10001668
695 Ga0105242_10003588
696 Ga0105242_10506951
697 Ga0105242_11253094
698 Ga0105242_11522693
699 Ga0105248_10032312
700 Ga0105248_10176703
701 Ga0105248_10641009
702 Ga0105249_10004760
703 Ga0105249_10137503
704 Ga0105249_11657557
705 Ga0105239_10256243
706 Ga0105246_10544734
707 Ga0105246_10615831
708 Ga0157369_11328073
709 Ga0157374_10012904
710 Ga0157374_10190813
711 Ga0157372_10077647
712 Ga0157372_10473913
713 Ga0157375_10203398
714 Ga0163163_10179792
715 Ga0163163_10202696
716 Ga0163163_10239407
717 Ga0163163_10274645
718 Ga0157380_10323372
719 Ga0157380_10393832
720 Ga0157380_11462783
721 Ga0157377_10041766
722 Ga0157376_10338288
723 Ga0163161_10482485
724 Ga0207697_10001307
725 Ga0207642_10083380
726 Ga0207688_10109009
727 Ga0207680_10009958
728 Ga0207680_10139149
729 Ga0207645_10290896
730 Ga0207707_10599114
731 Ga0207707_10754002
732 Ga0207662_10410613
733 Ga0207649_10017403
734 Ga0207646_10322292
735 Ga0207681_10037657
736 Ga0207681_10045693
737 Ga0207650_10005728
738 Ga0207650_10009994
739 Ga0207650_10035015
740 Ga0207650_10053491
741 Ga0207650_10081162
742 Ga0207659_10024881
743 Ga0207659_10069579
744 Ga0207659_10494634
745 Ga0207659_10702792
746 Ga0207687_10258046
747 Ga0207644_10150630
748 Ga0207644_10164100
749 Ga0207690_10121954
750 Ga0207690_10197355
751 Ga0207690_10284327
752 Ga0207690_10350066
753 Ga0207690_10409390
754 Ga0207706_10043092
755 Ga0207706_10075305
756 Ga0207706_10535137
757 Ga0207686_10010413
758 Ga0207669_10081844
759 Ga0207669_10100503
760 Ga0207669_10230617
761 Ga0207669_10477640
762 Ga0207704_10005186
763 Ga0207704_10045994
764 Ga0207704_10723808
765 Ga0207691_10103682
766 Ga0207691_10119313
767 Ga0207691_10124042
768 Ga0207711_10102232
769 Ga0207711_10232349
770 Ga0207711_10356185
771 Ga0207689_10008384
772 Ga0207689_10027500
773 Ga0207661_10000496
774 Ga0207661_10011965
775 Ga0207679_10013559
776 Ga0207679_10268940
777 Ga0207679_10272324
778 Ga0207679_10281374
779 Ga0207679_10668931
780 Ga0207667_10117693
781 Ga0207651_10170660
782 Ga0207712_10021103
783 Ga0207668_10121043
784 Ga0207658_10107566
785 Ga0207677_10248924
786 Ga0207677_10499429
787 Ga0207703_10154496
788 Ga0207703_10219595
789 Ga0207678_10178332
790 Ga0207708_10340340
791 Ga0207708_10495896
792 Ga0207708_10689792
793 Ga0207641_10032241
794 Ga0207648_10096490
795 Ga0207648_10895515
796 Ga0207676_10095982
797 Ga0207674_10102719
798 Ga0207675_100033511
799 Ga0207675_100483139
800 Ga0207675_100806605
801 Ga0207683_10061720
802 Ga0207683_10174341
803 Ga0207683_10180932
804 Ga0207683_10557770
805 Ga0207698_10594464
806 Ga0209813_10106696
807 Ga0209974_10071081
808 Ga0207428_10008697
809 Ga0207428_10009494
810 Ga0207428_10019485
811 Ga0207428_10080884
812 Ga0268266_10014412
813 Ga0268266_10040720
814 Ga0268265_10044067
815 Ga0268265_10538209
816 Ga0268264_10464128
817 Ga0268264_10499159
818 Ga0268264_10799768
819 Ga0307408_100003278
820 Ga0307408_100012136
821 Ga0307408_100098890
822 Ga0307408_100215873
823 Ga0307408_100378900
824 Ga0307408_100528948
825 Ga0307408_100552677
826 Ga0307408_100562896
827 Ga0307405_10000233
828 Ga0307405_10015167
829 Ga0307413_10010202
830 Ga0307413_10197643
831 Ga0307413_10569604
832 Ga0307413_10721244
833 Ga0307410_11060819
834 Ga0307406_10098677
835 Ga0307406_10120111
836 Ga0307406_10164606
837 Ga0307407_10217411
838 Ga0307407_10675661
839 Ga0307412_10007811
840 Ga0307412_10056817
841 Ga0307412_10316802
842 Ga0307412_10520269
843 Ga0307409_100049260
844 Ga0307409_100064969
845 Ga0307409_100228080
846 Ga0307416_100082994
847 Ga0307416_100334921
848 Ga0307416_100397529
849 Ga0307416_100561852
850 Ga0307416_101285250
851 Ga0307414_10192459
852 Ga0307411_10030201
853 Ga0307411_10440369
854 Ga0307415_100008877
855 Ga0307415_100276215
856 Ga0307415_100384067
857 Ga0373923_0115538
858 Ga0373960_0131109
859 Ga0373937_0006598
860 Ga0373925_0145995
861 Ga0395905_0211902
862 Ga0439436_0066814
863 Ga0439449_0197812
864 Ga0439450_004517
865 Ga0450914_008275
866 Ga0450920_025756
867 Ga0450921_003137
868 Ga0450895_001640
869 Ga0439446_0044550
870 Ga0439434_0062519
871 Ga0439435_0009860
872 Ga0439444_0048711
873 Ga0439464_0008468
874 Ga0451577_0042591
875 Ga0495656_0140467
876 Ga0495635_0204722
877 Ga0495613_0295234
878 Ga0495672_0063516
879 Ga0496100_0531982
880 Ga0496101_0061989
881 Ga0496101_0490234
882 Ga0496102_0013426
883 Ga0496102_0243156
884 Ga0496102_0291892
885 Ga0496102_0311917
886 Ga0496103_0064468
887 Ga0496104_0001061
888 Ga0496104_0010804
889 Ga0496104_0673180
890 Ga0496106_0031868
891 Ga0496106_0032296
892 Ga0496107_0116265
893 Ga0496107_0373741
894 Ga0496108_0004689
895 Ga0496108_0018269
896 Ga0496108_0124808
897 Ga0496109_0008900
898 Ga0496109_0009181
899 Ga0496109_0389869
900 Ga0496110_0010352
901 Ga0496110_0077141
902 Ga0496110_0224868
903 Ga0496111_0177429
904 Ga0496112_0001573
905 Ga0496112_0002226
906 Ga0496112_0196087
907 Ga0496112_0197663
908 Ga0496112_0366624
909 Ga0496112_0473277
910 Ga0496113_0003225
911 Ga0496113_0117412
912 Ga0496113_0526092
913 Ga0496114_0189240
914 Ga0496114_0207608
915 Ga0501031_0494410
916 Ga0501032_0408283
917 Ga0501033_0544426
918 Ga0501034_0027242
919 Ga0501034_0054372
920 Ga0501034_0060398
921 Ga0501034_0180842
922 Ga0501036_0325603
923 Ga0501039_0179990
924 Ga0501040_0052096
925 Ga0501040_0175164
926 Ga0501040_0364060
927 Ga0501040_0600594
928 Ga0501041_0043978
929 Ga0501041_0079992
930 Ga0501041_0536446
931 Ga0501042_0129289
932 Ga0501042_0132145
933 Ga0501042_0137986
934 Ga0501046_0274358
935 Ga0501048_0205628
936 Ga0501067_0079994
937 Ga0501067_0099865
938 Ga0501068_0373420
939 Ga0501069_0248196
940 Ga0501069_0249386
941 Ga0501071_0008910
942 Ga0501071_0115651
943 Ga0501071_0225849
944 Ga0501071_0442499
945 Ga0501072_0031404
946 Ga0501072_0051022
947 Ga0501072_0069410
948 Ga0501072_0072288
949 Ga0501072_0124811
950 Ga0501074_0089152
951 Ga0501074_0111231
952 Ga0501075_0041379
953 Ga0501075_0050319
954 Ga0501075_0614197
955 Ga0501076_0008563
956 Ga0501076_0011714
957 Ga0501076_0045948
958 Ga0501076_0095900
959 Ga0501076_0370317
960 Ga0501077_0084181
961 Ga0501077_0143085
962 Ga0501207_023980
963 Ga0501079_0079208
964 Ga0501079_0244955
965 Ga0501079_0544235
966 Ga0501080_0224512
967 Ga0501080_0453735
968 Ga0501081_0065038
969 Ga0501081_0089527
970 Ga0501083_0221121
971 Ga0501283_009484
972 Ga0501044_0661336
973 Ga0501045_0010908
974 Ga0501045_0036295
975 Ga0501045_0075712
976 Ga0501045_0167071
977 nmdc:mga03683_1327_c1
978 nmdc:mga00v17_170380_c1
979 nmdc:mga00v17_2313_c1
980 nmdc:mga00v17_52101_c1
981 nmdc:mga00v17_79305_c1
982 nmdc:mga0yw44_154637_c1
983 nmdc:mga0k408_117054_c1
984 nmdc:mga0k408_53604_c1
985 nmdc:mga06z11_104885_c1
986 nmdc:mga06z11_32874_c1
987 nmdc:mga06z11_36263_c1
988 nmdc:mga06z11_42710_c1
989 nmdc:mga06z11_437619_c1
990 nmdc:mga04h51_125751_c1
991 nmdc:mga04h51_30498_c1
992 nmdc:mga04h51_37430_c1
993 nmdc:mga04h51_42378_c1
994 nmdc:mga05p37_10317_c1
995 nmdc:mga05p37_1117328_c1
996 nmdc:mga05p37_163431_c1
997 nmdc:mga05p37_269579_c1
998 nmdc:mga05p37_295407_c1
999 nmdc:mga05p37_8538_c1
1000 nmdc:mga05p37_91_c1
1001 nmdc:mga09592_8188_c1
1002 nmdc:mga09592_85077_c1
1003 nmdc:mga0qj67_274121_c1
1004 nmdc:mga0qj67_444518_c1
1005 nmdc:mga0qj67_6557_c1
1006 nmdc:mga0qj67_71085_c1
1007 nmdc:mga0qj67_79389_c1
1008 nmdc:mga06r32_33898_c1
1009 nmdc:mga06r32_49392_c1
1010 nmdc:mga06r32_8031_c1
1011 nmdc:mga06r32_81641_c1
1012 nmdc:mga08y16_12398_c1
1013 nmdc:mga08y16_13130_c1
1014 nmdc:mga08y16_321557_c1
1015 nmdc:mga08y16_37325_c1
1016 nmdc:mga08y16_494095_c1
1017 nmdc:mga08y16_62702_c1
1018 nmdc:mga08y16_758041_c1
1019 nmdc:mga0n895_156971_c1
1020 nmdc:mga0rr50_248642_c1
1021 nmdc:mga0a205_111078_c1
1022 nmdc:mga0a205_8523_c1
1023 nmdc:mga0sz30_49232_c1
1024 Ga0495601_0136314
1025 Ga0495601_0346029
1026 Ga0495595_0111829
1027 Ga0500568_0008725
1028 Ga0500627_0207242
1029 Ga0501084_0041957
1030 Ga0501084_0071987
1031 Ga0501084_0402010
1032 Ga0501084_0405221
1033 Ga0590071_000241
1034 Ga0590075_000084
1035 Ga0590077_002782
1036 Ga0501082_0707862
1037 Ga0530510_0018531
1038 Ga0530510_0486537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

38

219

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ex7-assembly1.cif.gz_A crystal structure of yeast guanylate kinase in complex with guanosine-5'-monophosphate 0.9233 4 184
7u5f-assembly1.cif.gz_C crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp 0.9153 4 204
2j41-assembly1.cif.gz_B crystal structure of staphylococcus aureus guanylate monophosphate kinase 0.9119 4 201
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.911 34 83
2j41-assembly2.cif.gz_D crystal structure of staphylococcus aureus guanylate monophosphate kinase 0.9068 4 201
ID Description Score Start End Superfamily
3neyE02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9649 34 95 3.30.63.10
3tauB02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9647 36 94 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9557 36 82 3.30.63.10
1s4qA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9461 36 94 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9445 36 84 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A0F0CSZ5-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9768 2 185 GO:0004385
GO:0005524
GO:0005829
AF-A0A7Y4SMR3-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9765 1 203 GO:0004385
GO:0005524
GO:0005829
AF-A0A7X7XJW3-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9701 4 181 GO:0004385
GO:0005524
GO:0005829
AF-A0A3D2UY50-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9651 40 190 GO:0004385
GO:0005524
GO:0005829
AF-A0A7C6UB39-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9647 1 190 GO:0004385
GO:0005524
GO:0005829

Map