F458381

General Info

Members Datasets Scaffolds Average Seq Length
519 233 1038 104

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100567331|Ga0070716_1005673313
Length 112
Sequence VSHNHHHSTDARPEHVMLDLGPGVGALVLHTGANLHGVEIEISPAGRDGERSHKQVHERPVAGRPLYAAVFDSLPAGEYTLWQDGHALRRNVAVADAAVTEISIQEVAECSA

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 9.83
Rhizosphere 89.6
Stem 0
Stem Tuber 0
Unclassified 14.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100567331 3300006173 Bacteria 849
2 Ga0070683_100011157 3300005329 Bacteria 7751
3 Ga0070683_100244292 3300005329 Bacteria 1707
4 Ga0070680_100050349 3300005336 Bacteria 3397
5 Ga0070680_100067398 3300005336 Bacteria 2935
6 Ga0070682_100182866 3300005337 Unclassified 1466
7 Ga0070660_100009930 3300005339 Bacteria 6715
8 Ga0070660_101103409 3300005339 Bacteria 672
9 Ga0070691_10084306 3300005341 Bacteria 1560
10 Ga0070661_100319359 3300005344 Bacteria 1213
11 Ga0070692_10873723 3300005345 Unclassified 620
12 Ga0070671_100115797 3300005355 Bacteria 2254
13 Ga0070671_100386600 3300005355 Bacteria 1196
14 Ga0070659_100041512 3300005366 Bacteria 3597
15 Ga0070709_10019769 3300005434 Bacteria 3899
16 Ga0070709_10543592 3300005434 Bacteria 888
17 Ga0070714_100020941 3300005435 Bacteria 5346
18 Ga0070714_100032469 3300005435 Bacteria 4357
19 Ga0070714_100034555 3300005435 Bacteria 4233
20 Ga0070714_100246291 3300005435 Bacteria 1651
21 Ga0070714_100487067 3300005435 Bacteria 1175
22 Ga0070714_100659787 3300005435 Bacteria 1007
23 Ga0070713_100033627 3300005436 Bacteria 4109
24 Ga0070710_10001978 3300005437 Bacteria 9711
25 Ga0070710_10234769 3300005437 Bacteria 1172
26 Ga0070711_100003044 3300005439 Bacteria 9688
27 Ga0070711_100240088 3300005439 Bacteria 1416
28 Ga0070711_100996314 3300005439 Unclassified 719
29 Ga0070705_100791357 3300005440 Bacteria 754
30 Ga0070694_100517023 3300005444 Unclassified 952
31 Ga0070708_100530085 3300005445 Bacteria 1111
32 Ga0070708_101607271 3300005445 Viruses 605
33 Ga0070663_100999838 3300005455 Unclassified 727
34 Ga0070681_10088697 3300005458 Bacteria 3044
35 Ga0070681_10161317 3300005458 Bacteria 2166
36 Ga0070681_10364893 3300005458 Bacteria 1354
37 Ga0070706_101271844 3300005467 Bacteria 675
38 Ga0070707_100000814 3300005468 Bacteria 30885
39 Ga0070707_100353082 3300005468 Bacteria 1428
40 Ga0070707_102027418 3300005468 Bacteria 543
41 Ga0070698_100253845 3300005471 Bacteria 1691
42 Ga0070699_100518947 3300005518 Unclassified 1083
43 Ga0070679_100024660 3300005530 Bacteria 5895
44 Ga0070679_100102219 3300005530 Bacteria 2852
45 Ga0070679_100412814 3300005530 Unclassified 1295
46 Ga0070684_100011987 3300005535 Bacteria 6927
47 Ga0070684_100311910 3300005535 Bacteria 1444
48 Ga0070686_100356257 3300005544 Bacteria 1101
49 Ga0070695_100000053 3300005545 Bacteria 46304
50 Ga0070696_100194016 3300005546 Bacteria 1513
51 Ga0070696_101493915 3300005546 Bacteria 578
52 Ga0068855_100029412 3300005563 Bacteria 6569
53 Ga0068855_100343308 3300005563 Bacteria 1646
54 Ga0070664_101187254 3300005564 Bacteria 720
55 Ga0068857_100426176 3300005577 Bacteria 1238
56 Ga0068856_100126661 3300005614 Bacteria 2557
57 Ga0068856_100243479 3300005614 Bacteria 1813
58 Ga0068856_100264841 3300005614 Bacteria 1734
59 Ga0068856_101732276 3300005614 Bacteria 637
60 Ga0070702_100122560 3300005615 Unclassified 1629
61 Ga0068852_102246507 3300005616 Unclassified 567
62 Ga0068864_100613019 3300005618 Unclassified 1057
63 Ga0068866_10869408 3300005718 Bacteria 632
64 Ga0068860_102535243 3300005843 Unclassified 532
65 Ga0070717_10018272 3300006028 Bacteria 5471
66 Ga0070717_10029145 3300006028 Bacteria 4425
67 Ga0070717_10041312 3300006028 Bacteria 3760
68 Ga0070717_10089542 3300006028 Bacteria 2596
69 Ga0070717_10133268 3300006028 Bacteria 2138
70 Ga0070717_10189021 3300006028 Bacteria 1799
71 Ga0070715_10012525 3300006163 Bacteria 3090
72 Ga0070716_100015841 3300006173 Bacteria 3883
73 Ga0070716_100899279 3300006173 Bacteria 693
74 Ga0070716_101179984 3300006173 Bacteria 614
75 Ga0070712_100120509 3300006175 Bacteria 1973
76 Ga0070712_100379811 3300006175 Bacteria 1163
77 Ga0070712_100796277 3300006175 Bacteria 811
78 Ga0070712_101407397 3300006175 Bacteria 608
79 Ga0097621_100308620 3300006237 Bacteria 1399
80 Ga0068871_101861526 3300006358 Bacteria 572
81 Ga0075433_10166942 3300006852 Bacteria 1959
82 Ga0075435_100309025 3300007076 Unclassified 1353
83 Ga0105240_10486079 3300009093 Bacteria 1375
84 Ga0105240_10817860 3300009093 Unclassified 1008
85 Ga0111539_10599626 3300009094 Unclassified 1283
86 Ga0105245_10666909 3300009098 Bacteria 1071
87 Ga0105241_10500662 3300009174 Bacteria 1083
88 Ga0105242_10241933 3300009176 Bacteria 1623
89 Ga0105248_10106217 3300009177 Bacteria 3166
90 Ga0105248_13306779 3300009177 Unclassified 512
91 Ga0105237_10018065 3300009545 Bacteria 7305
92 Ga0105238_10277987 3300009551 Bacteria 1655
93 Ga0105238_11692288 3300009551 Bacteria 664
94 Ga0105238_12771537 3300009551 Unclassified 527
95 Ga0105239_11481468 3300010375 Unclassified 784
96 Ga0105246_10724115 3300011119 Bacteria 874
97 Ga0157373_11102963 3300013100 Unclassified 595
98 Ga0157371_10833456 3300013102 Bacteria 696
99 Ga0157369_10077502 3300013105 Bacteria 3562
100 Ga0157369_10190644 3300013105 Bacteria 2154
101 Ga0157369_10445718 3300013105 Bacteria 1341
102 Ga0157374_10033862 3300013296 Bacteria 4664
103 Ga0157378_10438685 3300013297 Unclassified 1294
104 Ga0163162_10961546 3300013306 Bacteria 965
105 Ga0157372_10080651 3300013307 Bacteria 3683
106 Ga0157372_10157882 3300013307 Bacteria 2620
107 Ga0157372_12451348 3300013307 Bacteria 599
108 Ga0182008_10020990 3300014497 Bacteria 3358
109 Ga0182008_10843537 3300014497 Unclassified 535
110 Ga0157379_10421187 3300014968 Bacteria 1230
111 Ga0157376_11297976 3300014969 Bacteria 758
112 Ga0206356_10436425 3300020070 Unclassified 665
113 Ga0206354_11282038 3300020081 Bacteria 970
114 Ga0206353_11314227 3300020082 Bacteria 981
115 Ga0213871_10039383 3300021441 Bacteria 1265
116 Ga0207692_10006947 3300025898 Bacteria 4615
117 Ga0207692_10239156 3300025898 Unclassified 1084
118 Ga0207710_10063198 3300025900 Bacteria 1684
119 Ga0207685_10072496 3300025905 Bacteria 1400
120 Ga0207699_10246712 3300025906 Bacteria 1229
121 Ga0207699_10278263 3300025906 Bacteria 1162
122 Ga0207699_10317313 3300025906 Bacteria 1092
123 Ga0207705_10164852 3300025909 Unclassified 1666
124 Ga0207707_10063456 3300025912 Bacteria 3215
125 Ga0207707_10105184 3300025912 Bacteria 2467
126 Ga0207707_10613843 3300025912 Bacteria 919
127 Ga0207695_10164839 3300025913 Bacteria 2145
128 Ga0207695_10437356 3300025913 Bacteria 1192
129 Ga0207671_10707316 3300025914 Unclassified 801
130 Ga0207693_10001062 3300025915 Bacteria 24573
131 Ga0207693_10015276 3300025915 Bacteria 6161
132 Ga0207693_10573106 3300025915 Bacteria 880
133 Ga0207663_10052198 3300025916 Bacteria 2549
134 Ga0207663_10128307 3300025916 Bacteria 1748
135 Ga0207663_11512050 3300025916 Bacteria 541
136 Ga0207660_10184556 3300025917 Unclassified 1622
137 Ga0207660_10373004 3300025917 Bacteria 1146
138 Ga0207662_10661195 3300025918 Bacteria 730
139 Ga0207657_10009179 3300025919 Bacteria 9973
140 Ga0207649_10056708 3300025920 Bacteria 2447
141 Ga0207652_10179415 3300025921 Bacteria 1902
142 Ga0207652_10549251 3300025921 Bacteria 1038
143 Ga0207646_10000371 3300025922 Bacteria 59994
144 Ga0207694_10109415 3300025924 Bacteria 2197
145 Ga0207694_10416512 3300025924 Bacteria 1119
146 Ga0207687_10476361 3300025927 Bacteria 1039
147 Ga0207700_10040630 3300025928 Bacteria 3396
148 Ga0207700_10064326 3300025928 Bacteria 2793
149 Ga0207700_10139286 3300025928 Bacteria 1991
150 Ga0207664_10017619 3300025929 Bacteria 5241
151 Ga0207664_10019585 3300025929 Bacteria 5004
152 Ga0207664_10037393 3300025929 Bacteria 3756
153 Ga0207664_10135738 3300025929 Unclassified 2076
154 Ga0207664_10143873 3300025929 Bacteria 2020
155 Ga0207664_10153483 3300025929 Bacteria 1958
156 Ga0207664_10335926 3300025929 Bacteria 1335
157 Ga0207644_10199150 3300025931 Unclassified 1579
158 Ga0207644_10375978 3300025931 Bacteria 1158
159 Ga0207690_10051463 3300025932 Bacteria 2754
160 Ga0207686_10480768 3300025934 Unclassified 960
161 Ga0207665_10006480 3300025939 Bacteria 7765
162 Ga0207711_10152595 3300025941 Bacteria 2085
163 Ga0207711_10934068 3300025941 Unclassified 806
164 Ga0207661_10081657 3300025944 Bacteria 2671
165 Ga0207661_10094253 3300025944 Bacteria 2500
166 Ga0207679_10189620 3300025945 Bacteria 1708
167 Ga0207667_10297680 3300025949 Bacteria 1648
168 Ga0207678_10578912 3300026067 Bacteria 983
169 Ga0207702_10260869 3300026078 Bacteria 1631
170 Ga0207702_10306853 3300026078 Unclassified 1508
171 Ga0207676_10261153 3300026095 Bacteria 1564
172 Ga0207674_10274302 3300026116 Bacteria 1634
173 Ga0207698_11524850 3300026142 Bacteria 684
174 Ga0265319_1186065 3300028563 Bacteria 639
175 Ga0265334_10043888 3300028573 Unclassified 1738
176 Ga0265336_10003097 3300028666 Bacteria 6623
177 Ga0265338_10035199 3300028800 Bacteria 4820
178 Ga0265338_10121205 3300028800 Bacteria 2084
179 Ga0265324_10008979 3300029957 Bacteria 3931
180 Ga0265316_10518702 3300031344 Bacteria 850
181 Ga0265313_10035892 3300031595 Bacteria 2492
182 Ga0373939_0328299 3300035114 Bacteria 617
183 Ga0373941_0056963 3300035115 Bacteria 1261
184 Ga0373941_0291210 3300035115 Bacteria 649
185 Ga0373945_0039153 3300035116 Bacteria 1708
186 Ga0373956_0214137 3300035119 Unclassified 914
187 Ga0373943_0001366 3300035170 Bacteria 11000
188 Ga0373943_0977370 3300035170 Unclassified 507
189 Ga0373946_0010782 3300035171 Bacteria 3394
190 Ga0373955_0728844 3300035172 Bacteria 609
191 Ga0373942_0164995 3300035207 Bacteria 718
192 Ga0373924_0164158 3300035410 Unclassified 975
193 Ga0373935_0117555 3300035692 Bacteria 1772
194 Ga0373935_0209624 3300035692 Bacteria 1350
195 Ga0373927_0037961 3300035695 Bacteria 3129
196 Ga0373947_0003247 3300035725 Bacteria 9646
197 Ga0373947_0353904 3300035725 Unclassified 986
198 Ga0373937_0351920 3300036401 Bacteria 1395
199 Ga0373925_0002205 3300037068 Bacteria 15824
200 Ga0395900_0127840 3300037418 Bacteria 2605
201 Ga0395898_0025984 3300037466 Bacteria 5897
202 Ga0395898_0131649 3300037466 Bacteria 2396
203 Ga0395905_1425803 3300037471 Unclassified 597
204 Ga0395901_0005746 3300038443 Bacteria 12563
205 Ga0436360_0633500 3300039438 Bacteria 1306
206 Ga0451853_1243887 3300041512 Bacteria 634
207 Ga0466969_0013309 3300044656 Bacteria 4332
208 Ga0466972_0009318 3300044658 Bacteria 4936
209 Ga0466965_0013006 3300044683 Bacteria 3921
210 Ga0466965_0035244 3300044683 Bacteria 2451
211 Ga0466965_0221741 3300044683 Bacteria 1008
212 Ga0466965_0400459 3300044683 Bacteria 758
213 Ga0466966_0534620 3300044684 Bacteria 705
214 Ga0466961_0003638 3300044693 Bacteria 9605
215 Ga0466961_0088872 3300044693 Bacteria 1952
216 Ga0466963_0000057 3300044694 Bacteria 37536
217 Ga0466963_0014399 3300044694 Bacteria 4875
218 Ga0466963_0020088 3300044694 Bacteria 4198
219 Ga0466963_0022702 3300044694 Bacteria 3976
220 Ga0466963_0036895 3300044694 Bacteria 3189
221 Ga0466963_0066910 3300044694 Bacteria 2410
222 Ga0466963_0071994 3300044694 Bacteria 2327
223 Ga0466963_0116863 3300044694 Bacteria 1833
224 Ga0466963_0341799 3300044694 Bacteria 1054
225 Ga0466963_0360840 3300044694 Bacteria 1023
226 Ga0466963_0375805 3300044694 Bacteria 1001
227 Ga0466964_0016731 3300044706 Bacteria 2802
228 Ga0466964_0022068 3300044706 Bacteria 2466
229 Ga0466964_0054932 3300044706 Bacteria 1643
230 Ga0466964_0062140 3300044706 Unclassified 1556
231 Ga0466964_0241065 3300044706 Bacteria 887
232 Ga0453684_2029327 3300044712 Unclassified 579
233 Ga0466971_0006771 3300044719 Bacteria 4987
234 Ga0466971_0008269 3300044719 Bacteria 4538
235 Ga0466971_0064613 3300044719 Bacteria 1657
236 Ga0466971_0073116 3300044719 Bacteria 1558
237 Ga0466971_0109968 3300044719 Bacteria 1271
238 Ga0466971_0136018 3300044719 Bacteria 1143
239 Ga0466971_0451742 3300044719 Bacteria 630
240 Ga0466968_0000798 3300044735 Bacteria 10974
241 Ga0466968_0018183 3300044735 Bacteria 2817
242 Ga0466968_0022141 3300044735 Bacteria 2581
243 Ga0466968_0160849 3300044735 Unclassified 1036
244 Ga0466968_0235825 3300044735 Bacteria 865
245 Ga0466968_0475985 3300044735 Bacteria 620
246 Ga0466970_0010408 3300044765 Bacteria 4723
247 Ga0466970_0055477 3300044765 Bacteria 2116
248 Ga0466970_0306470 3300044765 Unclassified 896
249 Ga0466957_0001752 3300044842 Bacteria 11414
250 Ga0466957_0005790 3300044842 Bacteria 6949
251 Ga0466957_0006764 3300044842 Bacteria 6477
252 Ga0466957_0013551 3300044842 Bacteria 4730
253 Ga0466957_0023799 3300044842 Bacteria 3623
254 Ga0466957_0050925 3300044842 Bacteria 2520
255 Ga0466957_0099524 3300044842 Bacteria 1831
256 Ga0466957_0153022 3300044842 Bacteria 1493
257 Ga0466957_0936292 3300044842 Bacteria 620
258 Ga0466960_0039407 3300044901 Bacteria 2228
259 Ga0466960_0060579 3300044901 Bacteria 1855
260 Ga0466959_0026100 3300045049 Bacteria 4332
261 Ga0466959_0035384 3300045049 Bacteria 3694
262 Ga0466959_0035859 3300045049 Bacteria 3664
263 Ga0466959_0571693 3300045049 Bacteria 761
264 Ga0466958_0002752 3300045836 Bacteria 8924
265 Ga0466958_0004119 3300045836 Bacteria 7632
266 Ga0466958_0009460 3300045836 Bacteria 5431
267 Ga0466958_0011733 3300045836 Bacteria 4945
268 Ga0466958_0013523 3300045836 Bacteria 4647
269 Ga0466958_0026135 3300045836 Bacteria 3448
270 Ga0466958_0046738 3300045836 Bacteria 2612
271 Ga0466958_0081090 3300045836 Bacteria 1996
272 Ga0466958_0318283 3300045836 Bacteria 1000
273 Ga0466958_0435921 3300045836 Bacteria 848
274 Ga0466967_0000275 3300045976 Bacteria 22739
275 Ga0466967_0003632 3300045976 Bacteria 10137
276 Ga0466967_0008713 3300045976 Bacteria 7468
277 Ga0466967_0015168 3300045976 Bacteria 6032
278 Ga0466967_0023602 3300045976 Bacteria 5044
279 Ga0466967_0060949 3300045976 Bacteria 3346
280 Ga0466967_0069165 3300045976 Bacteria 3154
281 Ga0466967_0081569 3300045976 Bacteria 2921
282 Ga0466967_0100063 3300045976 Bacteria 2648
283 Ga0466967_0141706 3300045976 Bacteria 2239
284 Ga0466967_0156461 3300045976 Bacteria 2135
285 Ga0466967_0156502 3300045976 Bacteria 2135
286 Ga0466967_0223607 3300045976 Bacteria 1790
287 Ga0466967_0246392 3300045976 Bacteria 1705
288 Ga0466967_0284068 3300045976 Bacteria 1588
289 Ga0466967_2140431 3300045976 Bacteria 555
290 Ga0495592_0009027 3300046454 Bacteria 7492
291 Ga0495592_0087169 3300046454 Bacteria 2246
292 Ga0495592_0177727 3300046454 Bacteria 1452
293 Ga0495592_0252443 3300046454 Bacteria 1165
294 Ga0495592_0334059 3300046454 Bacteria 976
295 Ga0495603_0051589 3300046455 Bacteria 2444
296 Ga0495603_0477088 3300046455 Bacteria 714
297 Ga0495629_0005569 3300046459 Bacteria 9402
298 Ga0495641_0013935 3300046461 Bacteria 4378
299 Ga0495641_0042621 3300046461 Bacteria 2102
300 Ga0495641_0043676 3300046461 Bacteria 2072
301 Ga0495641_0087271 3300046461 Bacteria 1396
302 Ga0495651_0546113 3300046462 Unclassified 737
303 Ga0495653_0033764 3300046463 Bacteria 4051
304 Ga0495653_0055952 3300046463 Bacteria 3009
305 Ga0495653_0244866 3300046463 Bacteria 1193
306 Ga0495653_0394766 3300046463 Unclassified 880
307 Ga0495580_0362694 3300046472 Unclassified 980
308 Ga0495582_0000977 3300046473 Bacteria 15988
309 Ga0495582_0054947 3300046473 Bacteria 2195
310 Ga0495582_0160605 3300046473 Unclassified 1278
311 Ga0495582_0258881 3300046473 Bacteria 998
312 Ga0495605_0374133 3300046474 Bacteria 595
313 Ga0495639_0000843 3300046475 Bacteria 13973
314 Ga0495639_0605612 3300046475 Bacteria 563
315 Ga0495662_0004235 3300046476 Bacteria 7221
316 Ga0495664_0011660 3300046477 Bacteria 4961
317 Ga0495664_0149319 3300046477 Bacteria 1418
318 Ga0495664_0154697 3300046477 Unclassified 1391
319 Ga0495584_0152105 3300046491 Bacteria 1176
320 Ga0495585_0114546 3300046492 Bacteria 1431
321 Ga0495596_0183246 3300046500 Bacteria 814
322 Ga0495607_0113715 3300046501 Unclassified 1431
323 Ga0495608_0016953 3300046511 Bacteria 5041
324 Ga0495608_0153232 3300046511 Unclassified 1468
325 Ga0495608_0794826 3300046511 Unclassified 559
326 Ga0495618_0042954 3300046514 Bacteria 2851
327 Ga0495618_0058852 3300046514 Bacteria 2435
328 Ga0495618_0113390 3300046514 Bacteria 1736
329 Ga0495618_0131894 3300046514 Bacteria 1598
330 Ga0495628_0005239 3300046516 Bacteria 11380
331 Ga0495628_0181400 3300046516 Unclassified 1592
332 Ga0495630_0001489 3300046517 Bacteria 16209
333 Ga0495630_0162462 3300046517 Bacteria 1700
334 Ga0495630_0575440 3300046517 Bacteria 863
335 Ga0495644_0008613 3300046523 Bacteria 3928
336 Ga0495663_0074421 3300046525 Bacteria 1086
337 Ga0495666_0000603 3300046526 Bacteria 16101
338 Ga0495652_0123501 3300046529 Bacteria 2061
339 Ga0495652_0136873 3300046529 Bacteria 1931
340 Ga0495652_0179999 3300046529 Unclassified 1623
341 Ga0495652_0183459 3300046529 Bacteria 1603
342 Ga0495652_0885684 3300046529 Bacteria 590
343 Ga0495665_0000710 3300046531 Bacteria 17159
344 Ga0495640_0058757 3300046533 Bacteria 2621
345 Ga0495640_0073491 3300046533 Bacteria 2289
346 Ga0495586_0000945 3300046535 Bacteria 16490
347 Ga0495586_0186239 3300046535 Unclassified 1175
348 Ga0495587_0073806 3300046536 Bacteria 1982
349 Ga0495587_0084735 3300046536 Bacteria 1835
350 Ga0495587_0121476 3300046536 Bacteria 1496
351 Ga0495587_0281037 3300046536 Bacteria 933
352 Ga0495598_0013427 3300046537 Bacteria 2030
353 Ga0495645_0049544 3300046543 Bacteria 3058
354 Ga0495645_0086600 3300046543 Bacteria 2241
355 Ga0495645_0106579 3300046543 Bacteria 1987
356 Ga0495667_0017810 3300046559 Bacteria 4799
357 Ga0495667_0207324 3300046559 Bacteria 1253
358 Ga0495667_0307164 3300046559 Bacteria 1004
359 Ga0495667_0399115 3300046559 Unclassified 866
360 Ga0495667_0747501 3300046559 Unclassified 605
361 Ga0495656_0746237 3300046615 Bacteria 528
362 Ga0495634_0001811 3300046642 Bacteria 18452
363 Ga0495634_0029387 3300046642 Bacteria 3805
364 Ga0495634_0058726 3300046642 Bacteria 2563
365 Ga0495634_0068239 3300046642 Bacteria 2350
366 Ga0495634_0390204 3300046642 Bacteria 828
367 Ga0495634_0483260 3300046642 Bacteria 727
368 Ga0495634_0725451 3300046642 Bacteria 570
369 Ga0495611_0033968 3300046648 Bacteria 2253
370 Ga0495635_0005512 3300046663 Bacteria 8800
371 Ga0495635_0079669 3300046663 Bacteria 2241
372 Ga0495635_0139175 3300046663 Bacteria 1653
373 Ga0495635_0489069 3300046663 Unclassified 811
374 Ga0495588_0111534 3300046674 Bacteria 1441
375 Ga0495657_0003770 3300046675 Bacteria 12275
376 Ga0495657_0098900 3300046675 Unclassified 1861
377 Ga0495657_0274399 3300046675 Bacteria 1010
378 Ga0495657_0729533 3300046675 Unclassified 569
379 Ga0495599_0024092 3300046678 Bacteria 3806
380 Ga0495599_0123756 3300046678 Unclassified 1607
381 Ga0495599_0422817 3300046678 Unclassified 791
382 Ga0495599_0846031 3300046678 Unclassified 521
383 Ga0495646_0102443 3300046680 Bacteria 1640
384 Ga0495646_0520623 3300046680 Bacteria 609
385 Ga0495647_0000107 3300046681 Bacteria 20741
386 Ga0495647_0037734 3300046681 Bacteria 1825
387 Ga0495658_0000454 3300046683 Bacteria 22724
388 Ga0495658_0610887 3300046683 Bacteria 699
389 Ga0495658_0720968 3300046683 Unclassified 639
390 Ga0495658_0891120 3300046683 Unclassified 569
391 Ga0495613_0006458 3300046689 Bacteria 8767
392 Ga0495613_0032381 3300046689 Bacteria 3883
393 Ga0495613_0107172 3300046689 Bacteria 2016
394 Ga0495613_0305929 3300046689 Bacteria 1100
395 Ga0495613_0538174 3300046689 Bacteria 783
396 Ga0495624_0001246 3300046690 Bacteria 20090
397 Ga0495624_0122691 3300046690 Bacteria 1595
398 Ga0495670_0284941 3300046691 Bacteria 884
399 Ga0495600_0185765 3300046809 Unclassified 1338
400 Ga0495600_0304799 3300046809 Bacteria 1004
401 Ga0495600_0724634 3300046809 Bacteria 597
402 Ga0495600_0743897 3300046809 Bacteria 587
403 Ga0495581_0005469 3300047315 Bacteria 7350
404 Ga0495581_0097820 3300047315 Bacteria 1705
405 Ga0495581_0145303 3300047315 Bacteria 1384
406 Ga0495581_0722967 3300047315 Bacteria 574
407 Ga0495604_0066716 3300047317 Bacteria 2736
408 Ga0495636_0494770 3300047318 Bacteria 591
409 Ga0495674_0126149 3300047319 Bacteria 2159
410 Ga0495674_0126155 3300047319 Bacteria 2159
411 Ga0495674_0130480 3300047319 Bacteria 2118
412 Ga0495674_0407159 3300047319 Bacteria 1097
413 Ga0495674_0415510 3300047319 Bacteria 1084
414 Ga0495676_0006467 3300047321 Bacteria 10798
415 Ga0495676_0300905 3300047321 Bacteria 1082
416 Ga0495676_0301737 3300047321 Unclassified 1080
417 Ga0495676_0405757 3300047321 Bacteria 904
418 Ga0495680_0062329 3300047322 Bacteria 2867
419 Ga0495680_0095165 3300047322 Bacteria 2227
420 Ga0495680_0802231 3300047322 Unclassified 615
421 Ga0495680_0813303 3300047322 Unclassified 609
422 Ga0495675_0460369 3300047444 Bacteria 735
423 Ga0495677_0122577 3300047445 Bacteria 992
424 Ga0495685_050617 3300047447 Bacteria 1410
425 Ga0495684_0009711 3300047471 Bacteria 7423
426 Ga0495684_0073500 3300047471 Bacteria 2597
427 Ga0495684_0203762 3300047471 Bacteria 1457
428 Ga0495684_0597867 3300047471 Bacteria 745
429 Ga0495593_0001393 3300047673 Bacteria 14154
430 Ga0495602_0227018 3300048088 Bacteria 1405
431 Ga0495602_0249876 3300048088 Bacteria 1322
432 Ga0495602_0940750 3300048088 Bacteria 573
433 Ga0495614_0000135 3300048089 Bacteria 26206
434 Ga0496100_0013893 3300048903 Bacteria 4659
435 Ga0496100_1026355 3300048903 Bacteria 649
436 Ga0496101_0030375 3300048904 Bacteria 3788
437 Ga0496101_0075928 3300048904 Bacteria 2474
438 Ga0496102_0018005 3300048905 Bacteria 6200
439 Ga0496102_0046920 3300048905 Bacteria 3924
440 Ga0496102_0220898 3300048905 Bacteria 1786
441 Ga0496103_0147905 3300048906 Bacteria 1504
442 Ga0496103_0724139 3300048906 Bacteria 630
443 Ga0496104_0008398 3300048907 Bacteria 9179
444 Ga0496104_0446284 3300048907 Bacteria 1205
445 Ga0496104_0518110 3300048907 Bacteria 1104
446 Ga0496104_0576151 3300048907 Bacteria 1036
447 Ga0496104_0746776 3300048907 Bacteria 885
448 Ga0496105_0023403 3300048908 Bacteria 5009
449 Ga0496105_0556475 3300048908 Bacteria 894
450 Ga0496105_1057985 3300048908 Unclassified 604
451 Ga0496106_0012985 3300048909 Bacteria 6145
452 Ga0496106_0050874 3300048909 Bacteria 3123
453 Ga0496106_1373827 3300048909 Bacteria 546
454 Ga0496107_0018988 3300048910 Bacteria 4847
455 Ga0496107_0229534 3300048910 Unclassified 1381
456 Ga0496107_0229824 3300048910 Bacteria 1380
457 Ga0496107_1381912 3300048910 Bacteria 502
458 Ga0496108_0031586 3300048911 Bacteria 4394
459 Ga0496108_0065860 3300048911 Bacteria 3054
460 Ga0496108_0100933 3300048911 Bacteria 2461
461 Ga0496109_0003102 3300048912 Bacteria 13860
462 Ga0496109_0004309 3300048912 Bacteria 11882
463 Ga0496109_0017022 3300048912 Bacteria 6362
464 Ga0496109_0214844 3300048912 Bacteria 1808
465 Ga0496110_0006524 3300048913 Bacteria 9256
466 Ga0496111_0006855 3300048914 Bacteria 7434
467 Ga0496111_0152379 3300048914 Unclassified 1715
468 Ga0496111_0383008 3300048914 Bacteria 1040
469 Ga0496112_0024127 3300048915 Bacteria 5820
470 Ga0496112_0058608 3300048915 Bacteria 3792
471 Ga0496113_0048367 3300048916 Bacteria 3163
472 Ga0496113_0678058 3300048916 Bacteria 823
473 Ga0496113_0722884 3300048916 Bacteria 794
474 Ga0496113_1142608 3300048916 Unclassified 610
475 Ga0496114_0021653 3300048917 Bacteria 5231
476 Ga0496114_0026777 3300048917 Bacteria 4723
477 Ga0496114_0035271 3300048917 Bacteria 4130
478 Ga0496114_0398536 3300048917 Bacteria 1219
479 Ga0496114_0469960 3300048917 Unclassified 1113
480 Ga0496115_0019108 3300048918 Bacteria 5269
481 Ga0496115_0073237 3300048918 Bacteria 2780
482 Ga0496115_0091578 3300048918 Bacteria 2485
483 Ga0496115_0229229 3300048918 Bacteria 1532
484 Ga0496115_0321893 3300048918 Bacteria 1264
485 Ga0501067_0041853 3300049583 Bacteria 2544
486 Ga0501069_0062358 3300049585 Bacteria 2082
487 Ga0501070_1125876 3300049586 Unclassified 605
488 nmdc:mga08y16_1287952_c1 3300050511 Bacteria 698
489 nmdc:mga0n895_25021_c1 3300050512 Bacteria 5635
490 nmdc:mga0rr50_42233_c1 3300050513 Bacteria 3328
491 nmdc:mga08x19_326610_c1 3300050514 Bacteria 1068
492 nmdc:mga0a205_151946_c1 3300050515 Bacteria 2214
493 Ga0495601_0037917 3300053077 Bacteria 3012
494 Ga0495601_0089567 3300053077 Bacteria 1978
495 Ga0495601_0134337 3300053077 Bacteria 1612
496 Ga0495601_0167370 3300053077 Bacteria 1436
497 Ga0495601_0192757 3300053077 Bacteria 1332
498 Ga0495601_0530255 3300053077 Bacteria 758
499 Ga0495612_0005661 3300053078 Bacteria 5161
500 Ga0495612_0015116 3300053078 Bacteria 3095
501 Ga0495612_0159235 3300053078 Bacteria 985
502 Ga0495595_0028902 3300053084 Unclassified 2477
503 Ga0495595_0160839 3300053084 Unclassified 1108
504 Ga0495595_0409630 3300053084 Bacteria 687
505 Ga0495595_0447431 3300053084 Unclassified 656
506 Ga0495619_0006212 3300053085 Bacteria 7573
507 Ga0495619_0007124 3300053085 Bacteria 7079
508 Ga0495619_0303089 3300053085 Bacteria 1107
509 Ga0495619_0328170 3300053085 Unclassified 1059
510 Ga0495619_0502237 3300053085 Bacteria 834
511 Ga0500566_0023674 3300053094 Bacteria 3606
512 Ga0500566_0258495 3300053094 Bacteria 842
513 Ga0466962_0000759 3300061719 Bacteria 14449
514 Ga0466962_0001075 3300061719 Bacteria 12548
515 Ga0466962_0017202 3300061719 Bacteria 3483
516 Ga0466962_0036332 3300061719 Bacteria 2358
517 Ga0466962_0050052 3300061719 Bacteria 1997
518 Ga0466962_0165906 3300061719 Bacteria 1074
519 Ga0466962_0435564 3300061719 Bacteria 659
520 Ga0070716_100567331
521 Ga0070683_100011157
522 Ga0070683_100244292
523 Ga0070680_100050349
524 Ga0070680_100067398
525 Ga0070682_100182866
526 Ga0070660_100009930
527 Ga0070660_101103409
528 Ga0070691_10084306
529 Ga0070661_100319359
530 Ga0070692_10873723
531 Ga0070671_100115797
532 Ga0070671_100386600
533 Ga0070659_100041512
534 Ga0070709_10019769
535 Ga0070709_10543592
536 Ga0070714_100020941
537 Ga0070714_100032469
538 Ga0070714_100034555
539 Ga0070714_100246291
540 Ga0070714_100487067
541 Ga0070714_100659787
542 Ga0070713_100033627
543 Ga0070710_10001978
544 Ga0070710_10234769
545 Ga0070711_100003044
546 Ga0070711_100240088
547 Ga0070711_100996314
548 Ga0070705_100791357
549 Ga0070694_100517023
550 Ga0070708_100530085
551 Ga0070708_101607271
552 Ga0070663_100999838
553 Ga0070681_10088697
554 Ga0070681_10161317
555 Ga0070681_10364893
556 Ga0070706_101271844
557 Ga0070707_100000814
558 Ga0070707_100353082
559 Ga0070707_102027418
560 Ga0070698_100253845
561 Ga0070699_100518947
562 Ga0070679_100024660
563 Ga0070679_100102219
564 Ga0070679_100412814
565 Ga0070684_100011987
566 Ga0070684_100311910
567 Ga0070686_100356257
568 Ga0070695_100000053
569 Ga0070696_100194016
570 Ga0070696_101493915
571 Ga0068855_100029412
572 Ga0068855_100343308
573 Ga0070664_101187254
574 Ga0068857_100426176
575 Ga0068856_100126661
576 Ga0068856_100243479
577 Ga0068856_100264841
578 Ga0068856_101732276
579 Ga0070702_100122560
580 Ga0068852_102246507
581 Ga0068864_100613019
582 Ga0068866_10869408
583 Ga0068860_102535243
584 Ga0070717_10018272
585 Ga0070717_10029145
586 Ga0070717_10041312
587 Ga0070717_10089542
588 Ga0070717_10133268
589 Ga0070717_10189021
590 Ga0070715_10012525
591 Ga0070716_100015841
592 Ga0070716_100899279
593 Ga0070716_101179984
594 Ga0070712_100120509
595 Ga0070712_100379811
596 Ga0070712_100796277
597 Ga0070712_101407397
598 Ga0097621_100308620
599 Ga0068871_101861526
600 Ga0075433_10166942
601 Ga0075435_100309025
602 Ga0105240_10486079
603 Ga0105240_10817860
604 Ga0111539_10599626
605 Ga0105245_10666909
606 Ga0105241_10500662
607 Ga0105242_10241933
608 Ga0105248_10106217
609 Ga0105248_13306779
610 Ga0105237_10018065
611 Ga0105238_10277987
612 Ga0105238_11692288
613 Ga0105238_12771537
614 Ga0105239_11481468
615 Ga0105246_10724115
616 Ga0157373_11102963
617 Ga0157371_10833456
618 Ga0157369_10077502
619 Ga0157369_10190644
620 Ga0157369_10445718
621 Ga0157374_10033862
622 Ga0157378_10438685
623 Ga0163162_10961546
624 Ga0157372_10080651
625 Ga0157372_10157882
626 Ga0157372_12451348
627 Ga0182008_10020990
628 Ga0182008_10843537
629 Ga0157379_10421187
630 Ga0157376_11297976
631 Ga0206356_10436425
632 Ga0206354_11282038
633 Ga0206353_11314227
634 Ga0213871_10039383
635 Ga0207692_10006947
636 Ga0207692_10239156
637 Ga0207710_10063198
638 Ga0207685_10072496
639 Ga0207699_10246712
640 Ga0207699_10278263
641 Ga0207699_10317313
642 Ga0207705_10164852
643 Ga0207707_10063456
644 Ga0207707_10105184
645 Ga0207707_10613843
646 Ga0207695_10164839
647 Ga0207695_10437356
648 Ga0207671_10707316
649 Ga0207693_10001062
650 Ga0207693_10015276
651 Ga0207693_10573106
652 Ga0207663_10052198
653 Ga0207663_10128307
654 Ga0207663_11512050
655 Ga0207660_10184556
656 Ga0207660_10373004
657 Ga0207662_10661195
658 Ga0207657_10009179
659 Ga0207649_10056708
660 Ga0207652_10179415
661 Ga0207652_10549251
662 Ga0207646_10000371
663 Ga0207694_10109415
664 Ga0207694_10416512
665 Ga0207687_10476361
666 Ga0207700_10040630
667 Ga0207700_10064326
668 Ga0207700_10139286
669 Ga0207664_10017619
670 Ga0207664_10019585
671 Ga0207664_10037393
672 Ga0207664_10135738
673 Ga0207664_10143873
674 Ga0207664_10153483
675 Ga0207664_10335926
676 Ga0207644_10199150
677 Ga0207644_10375978
678 Ga0207690_10051463
679 Ga0207686_10480768
680 Ga0207665_10006480
681 Ga0207711_10152595
682 Ga0207711_10934068
683 Ga0207661_10081657
684 Ga0207661_10094253
685 Ga0207679_10189620
686 Ga0207667_10297680
687 Ga0207678_10578912
688 Ga0207702_10260869
689 Ga0207702_10306853
690 Ga0207676_10261153
691 Ga0207674_10274302
692 Ga0207698_11524850
693 Ga0265319_1186065
694 Ga0265334_10043888
695 Ga0265336_10003097
696 Ga0265338_10035199
697 Ga0265338_10121205
698 Ga0265324_10008979
699 Ga0265316_10518702
700 Ga0265313_10035892
701 Ga0373939_0328299
702 Ga0373941_0056963
703 Ga0373941_0291210
704 Ga0373945_0039153
705 Ga0373956_0214137
706 Ga0373943_0001366
707 Ga0373943_0977370
708 Ga0373946_0010782
709 Ga0373955_0728844
710 Ga0373942_0164995
711 Ga0373924_0164158
712 Ga0373935_0117555
713 Ga0373935_0209624
714 Ga0373927_0037961
715 Ga0373947_0003247
716 Ga0373947_0353904
717 Ga0373937_0351920
718 Ga0373925_0002205
719 Ga0395900_0127840
720 Ga0395898_0025984
721 Ga0395898_0131649
722 Ga0395905_1425803
723 Ga0395901_0005746
724 Ga0436360_0633500
725 Ga0451853_1243887
726 Ga0466969_0013309
727 Ga0466972_0009318
728 Ga0466965_0013006
729 Ga0466965_0035244
730 Ga0466965_0221741
731 Ga0466965_0400459
732 Ga0466966_0534620
733 Ga0466961_0003638
734 Ga0466961_0088872
735 Ga0466963_0000057
736 Ga0466963_0014399
737 Ga0466963_0020088
738 Ga0466963_0022702
739 Ga0466963_0036895
740 Ga0466963_0066910
741 Ga0466963_0071994
742 Ga0466963_0116863
743 Ga0466963_0341799
744 Ga0466963_0360840
745 Ga0466963_0375805
746 Ga0466964_0016731
747 Ga0466964_0022068
748 Ga0466964_0054932
749 Ga0466964_0062140
750 Ga0466964_0241065
751 Ga0453684_2029327
752 Ga0466971_0006771
753 Ga0466971_0008269
754 Ga0466971_0064613
755 Ga0466971_0073116
756 Ga0466971_0109968
757 Ga0466971_0136018
758 Ga0466971_0451742
759 Ga0466968_0000798
760 Ga0466968_0018183
761 Ga0466968_0022141
762 Ga0466968_0160849
763 Ga0466968_0235825
764 Ga0466968_0475985
765 Ga0466970_0010408
766 Ga0466970_0055477
767 Ga0466970_0306470
768 Ga0466957_0001752
769 Ga0466957_0005790
770 Ga0466957_0006764
771 Ga0466957_0013551
772 Ga0466957_0023799
773 Ga0466957_0050925
774 Ga0466957_0099524
775 Ga0466957_0153022
776 Ga0466957_0936292
777 Ga0466960_0039407
778 Ga0466960_0060579
779 Ga0466959_0026100
780 Ga0466959_0035384
781 Ga0466959_0035859
782 Ga0466959_0571693
783 Ga0466958_0002752
784 Ga0466958_0004119
785 Ga0466958_0009460
786 Ga0466958_0011733
787 Ga0466958_0013523
788 Ga0466958_0026135
789 Ga0466958_0046738
790 Ga0466958_0081090
791 Ga0466958_0318283
792 Ga0466958_0435921
793 Ga0466967_0000275
794 Ga0466967_0003632
795 Ga0466967_0008713
796 Ga0466967_0015168
797 Ga0466967_0023602
798 Ga0466967_0060949
799 Ga0466967_0069165
800 Ga0466967_0081569
801 Ga0466967_0100063
802 Ga0466967_0141706
803 Ga0466967_0156461
804 Ga0466967_0156502
805 Ga0466967_0223607
806 Ga0466967_0246392
807 Ga0466967_0284068
808 Ga0466967_2140431
809 Ga0495592_0009027
810 Ga0495592_0087169
811 Ga0495592_0177727
812 Ga0495592_0252443
813 Ga0495592_0334059
814 Ga0495603_0051589
815 Ga0495603_0477088
816 Ga0495629_0005569
817 Ga0495641_0013935
818 Ga0495641_0042621
819 Ga0495641_0043676
820 Ga0495641_0087271
821 Ga0495651_0546113
822 Ga0495653_0033764
823 Ga0495653_0055952
824 Ga0495653_0244866
825 Ga0495653_0394766
826 Ga0495580_0362694
827 Ga0495582_0000977
828 Ga0495582_0054947
829 Ga0495582_0160605
830 Ga0495582_0258881
831 Ga0495605_0374133
832 Ga0495639_0000843
833 Ga0495639_0605612
834 Ga0495662_0004235
835 Ga0495664_0011660
836 Ga0495664_0149319
837 Ga0495664_0154697
838 Ga0495584_0152105
839 Ga0495585_0114546
840 Ga0495596_0183246
841 Ga0495607_0113715
842 Ga0495608_0016953
843 Ga0495608_0153232
844 Ga0495608_0794826
845 Ga0495618_0042954
846 Ga0495618_0058852
847 Ga0495618_0113390
848 Ga0495618_0131894
849 Ga0495628_0005239
850 Ga0495628_0181400
851 Ga0495630_0001489
852 Ga0495630_0162462
853 Ga0495630_0575440
854 Ga0495644_0008613
855 Ga0495663_0074421
856 Ga0495666_0000603
857 Ga0495652_0123501
858 Ga0495652_0136873
859 Ga0495652_0179999
860 Ga0495652_0183459
861 Ga0495652_0885684
862 Ga0495665_0000710
863 Ga0495640_0058757
864 Ga0495640_0073491
865 Ga0495586_0000945
866 Ga0495586_0186239
867 Ga0495587_0073806
868 Ga0495587_0084735
869 Ga0495587_0121476
870 Ga0495587_0281037
871 Ga0495598_0013427
872 Ga0495645_0049544
873 Ga0495645_0086600
874 Ga0495645_0106579
875 Ga0495667_0017810
876 Ga0495667_0207324
877 Ga0495667_0307164
878 Ga0495667_0399115
879 Ga0495667_0747501
880 Ga0495656_0746237
881 Ga0495634_0001811
882 Ga0495634_0029387
883 Ga0495634_0058726
884 Ga0495634_0068239
885 Ga0495634_0390204
886 Ga0495634_0483260
887 Ga0495634_0725451
888 Ga0495611_0033968
889 Ga0495635_0005512
890 Ga0495635_0079669
891 Ga0495635_0139175
892 Ga0495635_0489069
893 Ga0495588_0111534
894 Ga0495657_0003770
895 Ga0495657_0098900
896 Ga0495657_0274399
897 Ga0495657_0729533
898 Ga0495599_0024092
899 Ga0495599_0123756
900 Ga0495599_0422817
901 Ga0495599_0846031
902 Ga0495646_0102443
903 Ga0495646_0520623
904 Ga0495647_0000107
905 Ga0495647_0037734
906 Ga0495658_0000454
907 Ga0495658_0610887
908 Ga0495658_0720968
909 Ga0495658_0891120
910 Ga0495613_0006458
911 Ga0495613_0032381
912 Ga0495613_0107172
913 Ga0495613_0305929
914 Ga0495613_0538174
915 Ga0495624_0001246
916 Ga0495624_0122691
917 Ga0495670_0284941
918 Ga0495600_0185765
919 Ga0495600_0304799
920 Ga0495600_0724634
921 Ga0495600_0743897
922 Ga0495581_0005469
923 Ga0495581_0097820
924 Ga0495581_0145303
925 Ga0495581_0722967
926 Ga0495604_0066716
927 Ga0495636_0494770
928 Ga0495674_0126149
929 Ga0495674_0126155
930 Ga0495674_0130480
931 Ga0495674_0407159
932 Ga0495674_0415510
933 Ga0495676_0006467
934 Ga0495676_0300905
935 Ga0495676_0301737
936 Ga0495676_0405757
937 Ga0495680_0062329
938 Ga0495680_0095165
939 Ga0495680_0802231
940 Ga0495680_0813303
941 Ga0495675_0460369
942 Ga0495677_0122577
943 Ga0495685_050617
944 Ga0495684_0009711
945 Ga0495684_0073500
946 Ga0495684_0203762
947 Ga0495684_0597867
948 Ga0495593_0001393
949 Ga0495602_0227018
950 Ga0495602_0249876
951 Ga0495602_0940750
952 Ga0495614_0000135
953 Ga0496100_0013893
954 Ga0496100_1026355
955 Ga0496101_0030375
956 Ga0496101_0075928
957 Ga0496102_0018005
958 Ga0496102_0046920
959 Ga0496102_0220898
960 Ga0496103_0147905
961 Ga0496103_0724139
962 Ga0496104_0008398
963 Ga0496104_0446284
964 Ga0496104_0518110
965 Ga0496104_0576151
966 Ga0496104_0746776
967 Ga0496105_0023403
968 Ga0496105_0556475
969 Ga0496105_1057985
970 Ga0496106_0012985
971 Ga0496106_0050874
972 Ga0496106_1373827
973 Ga0496107_0018988
974 Ga0496107_0229534
975 Ga0496107_0229824
976 Ga0496107_1381912
977 Ga0496108_0031586
978 Ga0496108_0065860
979 Ga0496108_0100933
980 Ga0496109_0003102
981 Ga0496109_0004309
982 Ga0496109_0017022
983 Ga0496109_0214844
984 Ga0496110_0006524
985 Ga0496111_0006855
986 Ga0496111_0152379
987 Ga0496111_0383008
988 Ga0496112_0024127
989 Ga0496112_0058608
990 Ga0496113_0048367
991 Ga0496113_0678058
992 Ga0496113_0722884
993 Ga0496113_1142608
994 Ga0496114_0021653
995 Ga0496114_0026777
996 Ga0496114_0035271
997 Ga0496114_0398536
998 Ga0496114_0469960
999 Ga0496115_0019108
1000 Ga0496115_0073237
1001 Ga0496115_0091578
1002 Ga0496115_0229229
1003 Ga0496115_0321893
1004 Ga0501067_0041853
1005 Ga0501069_0062358
1006 Ga0501070_1125876
1007 nmdc:mga08y16_1287952_c1
1008 nmdc:mga0n895_25021_c1
1009 nmdc:mga0rr50_42233_c1
1010 nmdc:mga08x19_326610_c1
1011 nmdc:mga0a205_151946_c1
1012 Ga0495601_0037917
1013 Ga0495601_0089567
1014 Ga0495601_0134337
1015 Ga0495601_0167370
1016 Ga0495601_0192757
1017 Ga0495601_0530255
1018 Ga0495612_0005661
1019 Ga0495612_0015116
1020 Ga0495612_0159235
1021 Ga0495595_0028902
1022 Ga0495595_0160839
1023 Ga0495595_0409630
1024 Ga0495595_0447431
1025 Ga0495619_0006212
1026 Ga0495619_0007124
1027 Ga0495619_0303089
1028 Ga0495619_0328170
1029 Ga0495619_0502237
1030 Ga0500566_0023674
1031 Ga0500566_0258495
1032 Ga0466962_0000759
1033 Ga0466962_0001075
1034 Ga0466962_0017202
1035 Ga0466962_0036332
1036 Ga0466962_0050052
1037 Ga0466962_0165906
1038 Ga0466962_0435564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrq-assembly1.cif.gz_A crystal structure of copper-reconstituted fetp from uropathogenic escherichia coli strain f11 0.6929 38 81
3nrp-assembly1.cif.gz_B crystal structure of 'as isolated' uropathogenic e. coli strain f11 fetp recombinantly expressed in the periplasm of e. coli bl21(de3) 0.6854 38 81
4nwn-assembly1.cif.gz_H computationally designed two-component self-assembling tetrahedral cage t32-28 0.6805 38 81
5i0y-assembly1.cif.gz_A copper-bound e46q variant of uropathogenic escherichia coli strain f11 fetp 0.6639 38 81
6wee-assembly1.cif.gz_A copper-bound m88i variant of campylobacter jejuni p19 0.6629 38 81
ID Description Score Start End Superfamily
af_A0A0R4ITC2_22_217_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.698 39 81 2.60.40.10
3nrpB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.6849 38 81 2.60.40.2480
af_A0A0R4IXC4_126_253_2.60.40.2440 Mainly Beta;Sandwich;Immunoglobulin-like;Carbohydrate binding type-21 domain 0.6119 38 81 2.60.40.2440
af_A1Z843_117_195_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5804 24 102 2.60.40.10
af_Q19553_23_111_2.60.40.380 Mainly Beta;Sandwich;Immunoglobulin-like;Purple acid phosphatase-like, N-terminal 0.5708 38 92 2.60.40.380
ID Description Score Start End GO Terms
AF-A0A7W9KNF7-F1-model_v4 Phospholipase 0.9324 18 103
AF-A0A2T0RKD3-F1-model_v4 Phospholipase 0.914 16 104
AF-A0A838EMU4-F1-model_v4 Uncharacterized protein 0.8963 15 107
AF-A0A327Z2V4-F1-model_v4 Phospholipase 0.8891 17 106
AF-A0A6F8XIH7-F1-model_v4 Phospholipase 0.8764 17 107

Map