F458357

General Info

Members Datasets Scaffolds Average Seq Length
519 248 1038 135

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10319596|Ga0065715_103195962
Length 160
Sequence MSDRVPAIRVLLLPKDTNAYGTIFGGVILSHIDLASAIEARRIAPHHYVTKAMREVEFHEPVHLGDIVSFYTETVHVGRTSVTVRVLVEAERWGDAPELGIDWPRLAGNGAEEAGHDRTNSGSAKSGRGETVKVTEAEVVLVAIDAQGRPVPVRPAPAQA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
164 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
165 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
200 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 1.35
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10319596 3300005293 Bacteria 1004
2 SwRhRL2b_contig_3051 2162886007 Unclassified 1401
3 JGI24751J29686_10139181 3300002459 Bacteria 514
4 Ga0065704_10087933 3300005289 Bacteria 2978
5 Ga0065712_10002770 3300005290 Bacteria 6681
6 Ga0065712_10228407 3300005290 Bacteria 1018
7 Ga0065712_10612142 3300005290 Bacteria 585
8 Ga0065715_10014699 3300005293 Bacteria 2686
9 Ga0065707_10104395 3300005295 Bacteria 2698
10 Ga0065707_10645865 3300005295 Bacteria 666
11 Ga0070683_101332564 3300005329 Bacteria 690
12 Ga0070690_100009909 3300005330 Bacteria 5528
13 Ga0070690_100067716 3300005330 Unclassified 2314
14 Ga0070670_100002686 3300005331 Bacteria 14695
15 Ga0070670_101647432 3300005331 Unclassified 590
16 Ga0070677_10082923 3300005333 Bacteria 1376
17 Ga0070677_10099711 3300005333 Bacteria 1278
18 Ga0068869_100147506 3300005334 Bacteria 1822
19 Ga0070680_100474006 3300005336 Unclassified 1070
20 Ga0070660_100423828 3300005339 Unclassified 1102
21 Ga0070689_100025094 3300005340 Bacteria 4476
22 Ga0070689_100231728 3300005340 Bacteria 1518
23 Ga0070687_100019732 3300005343 Bacteria 3141
24 Ga0070687_100302146 3300005343 Bacteria 1016
25 Ga0070687_100852600 3300005343 Bacteria 650
26 Ga0070661_100688698 3300005344 Bacteria 832
27 Ga0070692_10625070 3300005345 Bacteria 716
28 Ga0070668_100275441 3300005347 Bacteria 1404
29 Ga0070669_100038140 3300005353 Bacteria 3488
30 Ga0070669_100205480 3300005353 Bacteria 1551
31 Ga0070669_100229457 3300005353 Bacteria 1471
32 Ga0070675_100016482 3300005354 Bacteria 5868
33 Ga0070675_100049416 3300005354 Bacteria 3452
34 Ga0070675_100056148 3300005354 Bacteria 3244
35 Ga0070675_100436949 3300005354 Bacteria 1172
36 Ga0070675_100631508 3300005354 Bacteria 973
37 Ga0070671_100829560 3300005355 Bacteria 806
38 Ga0070674_100113149 3300005356 Bacteria 1996
39 Ga0070674_100666524 3300005356 Bacteria 886
40 Ga0070674_101079219 3300005356 Bacteria 708
41 Ga0070674_101976574 3300005356 Bacteria 531
42 Ga0070673_100016689 3300005364 Bacteria 5201
43 Ga0070673_100065295 3300005364 Bacteria 2903
44 Ga0070673_100674596 3300005364 Unclassified 948
45 Ga0070688_100025841 3300005365 Bacteria 3481
46 Ga0070688_100225875 3300005365 Bacteria 1322
47 Ga0070688_100310967 3300005365 Bacteria 1142
48 Ga0070688_100974799 3300005365 Bacteria 672
49 Ga0070659_100207529 3300005366 Bacteria 1614
50 Ga0070659_100849006 3300005366 Bacteria 796
51 Ga0070659_101776909 3300005366 Bacteria 552
52 Ga0070667_101592984 3300005367 Unclassified 614
53 Ga0070711_100273868 3300005439 Bacteria 1333
54 Ga0070705_100901525 3300005440 Bacteria 711
55 Ga0070705_101061145 3300005440 Bacteria 661
56 Ga0070700_100229300 3300005441 Bacteria 1321
57 Ga0070700_101225303 3300005441 Unclassified 628
58 Ga0070700_101643414 3300005441 Bacteria 550
59 Ga0070694_100112820 3300005444 Bacteria 1939
60 Ga0070694_100150234 3300005444 Bacteria 1700
61 Ga0070694_100250471 3300005444 Bacteria 1340
62 Ga0070694_100472513 3300005444 Bacteria 994
63 Ga0070694_100565652 3300005444 Bacteria 912
64 Ga0070708_100163755 3300005445 Bacteria 2073
65 Ga0070708_100242420 3300005445 Bacteria 1692
66 Ga0070663_100690076 3300005455 Bacteria 867
67 Ga0070678_100298189 3300005456 Bacteria 1369
68 Ga0070678_100403405 3300005456 Bacteria 1188
69 Ga0070678_100880904 3300005456 Unclassified 817
70 Ga0070662_100148789 3300005457 Bacteria 1821
71 Ga0068867_101746240 3300005459 Bacteria 584
72 Ga0070685_10073029 3300005466 Bacteria 2038
73 Ga0070685_10748874 3300005466 Bacteria 716
74 Ga0070685_10886646 3300005466 Bacteria 663
75 Ga0070706_100010993 3300005467 Bacteria 8406
76 Ga0070706_100195551 3300005467 Bacteria 1889
77 Ga0070707_100016955 3300005468 Bacteria 6843
78 Ga0070707_100043029 3300005468 Bacteria 4323
79 Ga0070707_100062270 3300005468 Bacteria 3579
80 Ga0070698_100001244 3300005471 Bacteria 28425
81 Ga0070698_100024710 3300005471 Bacteria 6267
82 Ga0070698_100752312 3300005471 Unclassified 918
83 Ga0070698_100944616 3300005471 Bacteria 808
84 Ga0070699_100040764 3300005518 Bacteria 4019
85 Ga0070699_100168774 3300005518 Bacteria 1939
86 Ga0070697_100012054 3300005536 Bacteria 6767
87 Ga0068853_101060127 3300005539 Bacteria 781
88 Ga0070672_100003869 3300005543 Bacteria 9746
89 Ga0070672_100071466 3300005543 Bacteria 2761
90 Ga0070672_100346301 3300005543 Bacteria 1266
91 Ga0070672_100782622 3300005543 Bacteria 839
92 Ga0070686_100060728 3300005544 Bacteria 2440
93 Ga0070686_101634021 3300005544 Bacteria 546
94 Ga0070695_100363354 3300005545 Bacteria 1088
95 Ga0070696_100376090 3300005546 Bacteria 1106
96 Ga0070696_100847873 3300005546 Bacteria 755
97 Ga0070665_102274150 3300005548 Bacteria 545
98 Ga0070665_102322773 3300005548 Unclassified 539
99 Ga0070664_100042479 3300005564 Bacteria 3837
100 Ga0070664_100099718 3300005564 Bacteria 2524
101 Ga0068857_100307936 3300005577 Unclassified 1461
102 Ga0068857_101087777 3300005577 Unclassified 772
103 Ga0070702_100340137 3300005615 Bacteria 1053
104 Ga0070702_101140691 3300005615 Unclassified 625
105 Ga0068852_100530903 3300005616 Bacteria 1175
106 Ga0068852_100701257 3300005616 Bacteria 1022
107 Ga0068864_100008113 3300005618 Bacteria 8660
108 Ga0068864_100190483 3300005618 Bacteria 1880
109 Ga0068861_100784536 3300005719 Bacteria 893
110 Ga0068861_100903120 3300005719 Bacteria 837
111 Ga0068870_10081990 3300005840 Bacteria 1785
112 Ga0068863_100315811 3300005841 Bacteria 1517
113 Ga0068863_100865224 3300005841 Bacteria 903
114 Ga0068863_101836844 3300005841 Unclassified 616
115 Ga0068858_100046189 3300005842 Bacteria 4037
116 Ga0068858_100300930 3300005842 Bacteria 1530
117 Ga0068860_100621350 3300005843 Bacteria 1087
118 Ga0068862_100258123 3300005844 Bacteria 1590
119 Ga0068862_100297064 3300005844 Bacteria 1485
120 Ga0068862_101118144 3300005844 Unclassified 783
121 Ga0081538_10030587 3300005981 Bacteria 3651
122 Ga0097621_100454022 3300006237 Bacteria 1155
123 Ga0097621_100995824 3300006237 Bacteria 784
124 Ga0068871_100356406 3300006358 Bacteria 1295
125 Ga0075428_100007688 3300006844 Bacteria 11945
126 Ga0075428_100049686 3300006844 Bacteria 4602
127 Ga0075428_100176694 3300006844 Bacteria 2312
128 Ga0075428_100332531 3300006844 Bacteria 1632
129 Ga0075428_100387313 3300006844 Bacteria 1498
130 Ga0075428_100478707 3300006844 Bacteria 1332
131 Ga0075428_100729779 3300006844 Bacteria 1055
132 Ga0075428_101099226 3300006844 Bacteria 840
133 Ga0075428_101995146 3300006844 Bacteria 601
134 Ga0075430_100108430 3300006846 Bacteria 2317
135 Ga0075430_100227776 3300006846 Bacteria 1546
136 Ga0075430_100237687 3300006846 Bacteria 1510
137 Ga0075430_100440162 3300006846 Bacteria 1076
138 Ga0075430_100784747 3300006846 Bacteria 785
139 Ga0075431_100006361 3300006847 Bacteria 11725
140 Ga0075431_100008459 3300006847 Bacteria 10305
141 Ga0075431_100391235 3300006847 Bacteria 1393
142 Ga0075431_101077204 3300006847 Bacteria 769
143 Ga0075433_10000543 3300006852 Bacteria 24788
144 Ga0075433_10136259 3300006852 Bacteria 2182
145 Ga0075433_10230972 3300006852 Bacteria 1643
146 Ga0075433_11005987 3300006852 Bacteria 726
147 Ga0075434_100056847 3300006871 Bacteria 3889
148 Ga0075434_100060435 3300006871 Bacteria 3769
149 Ga0075434_100103042 3300006871 Bacteria 2862
150 Ga0075434_100109486 3300006871 Bacteria 2773
151 Ga0075434_100169703 3300006871 Bacteria 2202
152 Ga0075434_100306474 3300006871 Unclassified 1608
153 Ga0075434_100580499 3300006871 Bacteria 1140
154 Ga0075434_102037641 3300006871 Bacteria 579
155 Ga0075429_100035509 3300006880 Bacteria 4336
156 Ga0075429_100328219 3300006880 Bacteria 1339
157 Ga0075429_100694043 3300006880 Bacteria 892
158 Ga0075429_100701118 3300006880 Unclassified 887
159 Ga0068865_100203241 3300006881 Bacteria 1539
160 Ga0068865_100685773 3300006881 Bacteria 874
161 Ga0075435_100459787 3300007076 Bacteria 1098
162 Ga0099794_10600049 3300007265 Bacteria 583
163 Ga0111539_10004536 3300009094 Bacteria 18160
164 Ga0111539_10011761 3300009094 Bacteria 10977
165 Ga0111539_10012688 3300009094 Bacteria 10552
166 Ga0111539_10035581 3300009094 Bacteria 6028
167 Ga0111539_10359774 3300009094 Bacteria 1694
168 Ga0111539_12792492 3300009094 Unclassified 566
169 Ga0114129_10020747 3300009147 Bacteria 9337
170 Ga0114129_10079401 3300009147 Bacteria 4563
171 Ga0114129_10131761 3300009147 Bacteria 3432
172 Ga0114129_10140859 3300009147 Bacteria 3306
173 Ga0114129_10173989 3300009147 Bacteria 2933
174 Ga0114129_10184768 3300009147 Bacteria 2834
175 Ga0114129_11349278 3300009147 Unclassified 882
176 Ga0114129_11585015 3300009147 Unclassified 802
177 Ga0114129_12814187 3300009147 Unclassified 578
178 Ga0114129_12930060 3300009147 Unclassified 563
179 Ga0114129_13118939 3300009147 Unclassified 541
180 Ga0105243_12211713 3300009148 Bacteria 587
181 Ga0105243_12963014 3300009148 Bacteria 515
182 Ga0105242_10963033 3300009176 Bacteria 858
183 Ga0105248_10151345 3300009177 Bacteria 2618
184 Ga0105248_11110271 3300009177 Bacteria 894
185 Ga0105249_11522982 3300009553 Bacteria 741
186 Ga0105246_10287151 3300011119 Bacteria 1322
187 Ga0105246_10943033 3300011119 Bacteria 777
188 Ga0105246_12568170 3300011119 Unclassified 503
189 Ga0157373_10192819 3300013100 Bacteria 1436
190 Ga0157374_10177424 3300013296 Bacteria 2080
191 Ga0157374_10891887 3300013296 Bacteria 907
192 Ga0157374_11954521 3300013296 Archaea 613
193 Ga0163162_10520406 3300013306 Bacteria 1319
194 Ga0157375_10410029 3300013308 Bacteria 1521
195 Ga0157375_10590362 3300013308 Bacteria 1270
196 Ga0157375_11128339 3300013308 Bacteria 918
197 Ga0163163_10028947 3300014325 Bacteria 5325
198 Ga0163163_10745783 3300014325 Bacteria 1043
199 Ga0157380_10090713 3300014326 Bacteria 2522
200 Ga0157380_10333911 3300014326 Bacteria 1411
201 Ga0157380_10449047 3300014326 Bacteria 1238
202 Ga0157380_10489989 3300014326 Bacteria 1191
203 Ga0157380_11398877 3300014326 Unclassified 750
204 Ga0157377_10132391 3300014745 Bacteria 1525
205 Ga0157377_10264930 3300014745 Bacteria 1120
206 Ga0157377_10610006 3300014745 Bacteria 780
207 Ga0157376_10027231 3300014969 Bacteria 4528
208 Ga0157376_10205704 3300014969 Bacteria 1814
209 Ga0157376_10560760 3300014969 Bacteria 1132
210 Ga0157376_10700052 3300014969 Bacteria 1018
211 Ga0213876_10085039 3300021384 Bacteria 1673
212 Ga0207697_10146633 3300025315 Bacteria 1025
213 Ga0207653_10150593 3300025885 Bacteria 856
214 Ga0207682_10072405 3300025893 Bacteria 1462
215 Ga0207688_10106983 3300025901 Bacteria 1620
216 Ga0207680_10686827 3300025903 Unclassified 733
217 Ga0207645_10355360 3300025907 Bacteria 981
218 Ga0207643_10074488 3300025908 Bacteria 1958
219 Ga0207643_10197615 3300025908 Bacteria 1223
220 Ga0207684_10008351 3300025910 Bacteria 9206
221 Ga0207660_10043026 3300025917 Bacteria 3172
222 Ga0207662_10005759 3300025918 Bacteria 6633
223 Ga0207662_10161793 3300025918 Bacteria 1430
224 Ga0207657_10316410 3300025919 Unclassified 1235
225 Ga0207646_10017752 3300025922 Bacteria 6646
226 Ga0207646_10062775 3300025922 Bacteria 3317
227 Ga0207681_10035554 3300025923 Bacteria 3283
228 Ga0207681_10575874 3300025923 Bacteria 928
229 Ga0207681_11056773 3300025923 Unclassified 682
230 Ga0207681_11765043 3300025923 Bacteria 516
231 Ga0207650_10038776 3300025925 Bacteria 3481
232 Ga0207650_10321990 3300025925 Bacteria 1266
233 Ga0207650_11385224 3300025925 Unclassified 598
234 Ga0207659_10002444 3300025926 Bacteria 11077
235 Ga0207659_10003788 3300025926 Bacteria 9118
236 Ga0207659_10146309 3300025926 Bacteria 1840
237 Ga0207659_10273592 3300025926 Bacteria 1378
238 Ga0207659_10403021 3300025926 Bacteria 1144
239 Ga0207659_10448968 3300025926 Bacteria 1086
240 Ga0207659_10450683 3300025926 Bacteria 1084
241 Ga0207644_10984066 3300025931 Bacteria 708
242 Ga0207690_10233851 3300025932 Bacteria 1412
243 Ga0207690_11468247 3300025932 Bacteria 570
244 Ga0207706_10470695 3300025933 Bacteria 1086
245 Ga0207706_10623323 3300025933 Unclassified 925
246 Ga0207670_10123343 3300025936 Bacteria 1887
247 Ga0207670_10134444 3300025936 Bacteria 1816
248 Ga0207670_10174804 3300025936 Bacteria 1613
249 Ga0207669_10425201 3300025937 Bacteria 1046
250 Ga0207669_11059878 3300025937 Bacteria 683
251 Ga0207704_10335699 3300025938 Bacteria 1171
252 Ga0207691_10033422 3300025940 Bacteria 4788
253 Ga0207691_10063591 3300025940 Bacteria 3346
254 Ga0207691_10067742 3300025940 Bacteria 3227
255 Ga0207691_10068713 3300025940 Bacteria 3201
256 Ga0207691_10469808 3300025940 Bacteria 1069
257 Ga0207711_11019554 3300025941 Bacteria 767
258 Ga0207689_10057887 3300025942 Bacteria 3188
259 Ga0207689_10280512 3300025942 Bacteria 1380
260 Ga0207689_10603611 3300025942 Bacteria 923
261 Ga0207679_10074358 3300025945 Bacteria 2574
262 Ga0207679_10166993 3300025945 Bacteria 1808
263 Ga0207651_10064484 3300025960 Bacteria 2564
264 Ga0207651_10119815 3300025960 Bacteria 1993
265 Ga0207651_10210641 3300025960 Bacteria 1564
266 Ga0207712_10433835 3300025961 Bacteria 1111
267 Ga0207712_10977902 3300025961 Bacteria 750
268 Ga0207668_10247732 3300025972 Bacteria 1445
269 Ga0207668_10331253 3300025972 Bacteria 1267
270 Ga0207703_10264670 3300026035 Bacteria 1555
271 Ga0207703_11951843 3300026035 Bacteria 563
272 Ga0207678_10771816 3300026067 Bacteria 848
273 Ga0207708_10050315 3300026075 Bacteria 3172
274 Ga0207708_10227636 3300026075 Bacteria 1496
275 Ga0207708_11609866 3300026075 Bacteria 571
276 Ga0207641_10562455 3300026088 Bacteria 1113
277 Ga0207648_10093814 3300026089 Bacteria 2624
278 Ga0207648_11756107 3300026089 Bacteria 582
279 Ga0207676_10040113 3300026095 Bacteria 3586
280 Ga0207676_10087617 3300026095 Bacteria 2547
281 Ga0207674_10298199 3300026116 Bacteria 1561
282 Ga0207674_10707715 3300026116 Unclassified 972
283 Ga0207675_100458516 3300026118 Bacteria 1264
284 Ga0207675_100983178 3300026118 Unclassified 862
285 Ga0207675_101208089 3300026118 Unclassified 776
286 Ga0207675_101233958 3300026118 Bacteria 768
287 Ga0207683_10045645 3300026121 Bacteria 3832
288 Ga0207683_10805523 3300026121 Unclassified 872
289 Ga0207698_10370722 3300026142 Bacteria 1359
290 Ga0209974_10064751 3300027876 Bacteria 1241
291 Ga0209974_10097084 3300027876 Bacteria 1027
292 Ga0207428_10002731 3300027907 Bacteria 17583
293 Ga0207428_10005111 3300027907 Bacteria 12312
294 Ga0207428_10059508 3300027907 Bacteria 3029
295 Ga0207428_10060828 3300027907 Bacteria 2992
296 Ga0268265_10506217 3300028380 Bacteria 1139
297 Ga0268265_10664390 3300028380 Bacteria 1003
298 Ga0268265_11099200 3300028380 Bacteria 789
299 Ga0268264_11443234 3300028381 Bacteria 699
300 Ga0307408_100052086 3300031548 Unclassified 2951
301 Ga0307408_100993461 3300031548 Bacteria 773
302 Ga0316576_10006147 3300031727 Bacteria 7440
303 Ga0316578_10059409 3300031728 Bacteria 2249
304 Ga0307405_11306829 3300031731 Bacteria 631
305 Ga0307413_10036448 3300031824 Bacteria 2831
306 Ga0307413_10175753 3300031824 Bacteria 1521
307 Ga0307413_10178334 3300031824 Bacteria 1512
308 Ga0307413_10182100 3300031824 Unclassified 1499
309 Ga0307410_10001177 3300031852 Bacteria 11550
310 Ga0307410_10018437 3300031852 Bacteria 4218
311 Ga0307410_10102337 3300031852 Bacteria 2055
312 Ga0307410_10456588 3300031852 Bacteria 1043
313 Ga0307406_10087576 3300031901 Bacteria 2087
314 Ga0307406_10523113 3300031901 Bacteria 966
315 Ga0307406_10549564 3300031901 Bacteria 944
316 Ga0307406_12131206 3300031901 Bacteria 503
317 Ga0307407_10001884 3300031903 Bacteria 7911
318 Ga0307407_10009309 3300031903 Bacteria 4566
319 Ga0307407_10017382 3300031903 Bacteria 3607
320 Ga0307407_10040326 3300031903 Bacteria 2603
321 Ga0307407_10054545 3300031903 Bacteria 2306
322 Ga0307407_10152344 3300031903 Bacteria 1504
323 Ga0307412_10016281 3300031911 Bacteria 4427
324 Ga0307412_10021429 3300031911 Bacteria 3948
325 Ga0307409_100001060 3300031995 Bacteria 12912
326 Ga0307409_100001302 3300031995 Bacteria 12104
327 Ga0307409_100001558 3300031995 Bacteria 11395
328 Ga0307409_100023684 3300031995 Unclassified 4262
329 Ga0307409_100276541 3300031995 Bacteria 1549
330 Ga0307416_100011322 3300032002 Bacteria 5938
331 Ga0307416_100013949 3300032002 Bacteria 5481
332 Ga0307416_100308662 3300032002 Bacteria 1577
333 Ga0307414_10011398 3300032004 Bacteria 5211
334 Ga0307414_10136583 3300032004 Bacteria 1913
335 Ga0307414_10171969 3300032004 Bacteria 1733
336 Ga0307414_10664370 3300032004 Archaea 940
337 Ga0307411_10006136 3300032005 Bacteria 5978
338 Ga0307411_10009107 3300032005 Bacteria 5195
339 Ga0307411_10047847 3300032005 Bacteria 2767
340 Ga0307411_10076188 3300032005 Bacteria 2292
341 Ga0307411_11055389 3300032005 Bacteria 730
342 Ga0307415_100007117 3300032126 Bacteria 6091
343 Ga0373952_0187741 3300035092 Bacteria 599
344 Ga0373945_0071632 3300035116 Bacteria 1313
345 Ga0373943_0290054 3300035170 Bacteria 927
346 Ga0373955_0235823 3300035172 Bacteria 1095
347 Ga0373961_0054552 3300035241 Bacteria 1195
348 Ga0373962_0025683 3300035242 Bacteria 1583
349 Ga0316574_0012813 3300035398 Bacteria 4806
350 Ga0373937_0030698 3300036401 Bacteria 4867
351 Ga0373937_1758168 3300036401 Bacteria 567
352 Ga0316584_0085649 3300036712 Bacteria 2359
353 Ga0373925_0157746 3300037068 Bacteria 1786
354 Ga0395900_0321802 3300037418 Bacteria 1527
355 Ga0436365_0099061 3300039437 Unclassified 793
356 Ga0436365_1110495 3300039437 Bacteria 1702
357 Ga0436363_1140780 3300039450 Bacteria 578
358 Ga0439439_0149034 3300041406 Bacteria 664
359 Ga0439461_0159578 3300041410 Bacteria 587
360 Ga0451798_0970356 3300041458 Bacteria 519
361 Ga0451800_0032756 3300041459 Unclassified 691
362 Ga0451807_0558487 3300041486 Unclassified 779
363 Ga0451853_0346547 3300041512 Bacteria 891
364 Ga0451853_1943915 3300041512 Bacteria 1370
365 Ga0439433_0004078 3300041999 Bacteria 3141
366 Ga0439443_097458 3300042003 Unclassified 560
367 Ga0450894_015095 3300042131 Bacteria 1022
368 Ga0450910_014172 3300042147 Bacteria 1165
369 Ga0439446_0017722 3300042156 Bacteria 1991
370 Ga0450908_045159 3300042184 Bacteria 764
371 Ga0439435_0116598 3300042436 Bacteria 833
372 Ga0439444_0100362 3300042437 Unclassified 656
373 Ga0495629_0680852 3300046459 Bacteria 684
374 Ga0495662_0384543 3300046476 Bacteria 689
375 Ga0495594_0515818 3300046499 Bacteria 679
376 Ga0495608_0377263 3300046511 Bacteria 870
377 Ga0495618_0404031 3300046514 Bacteria 835
378 Ga0495628_1167407 3300046516 Bacteria 523
379 Ga0495630_0010985 3300046517 Bacteria 6546
380 Ga0495630_0444142 3300046517 Bacteria 994
381 Ga0495666_0174832 3300046526 Bacteria 993
382 Ga0495642_0128809 3300046528 Bacteria 1089
383 Ga0495640_0702902 3300046533 Bacteria 606
384 Ga0495598_0386025 3300046537 Bacteria 545
385 Ga0495598_0468326 3300046537 Bacteria 501
386 Ga0495609_0067806 3300046538 Bacteria 1571
387 Ga0495621_0072587 3300046539 Bacteria 1270
388 Ga0495656_0017209 3300046615 Bacteria 2756
389 Ga0495656_0197019 3300046615 Bacteria 998
390 Ga0495656_0657157 3300046615 Bacteria 563
391 Ga0495634_0142340 3300046642 Bacteria 1522
392 Ga0495646_0632852 3300046680 Bacteria 542
393 Ga0495658_0397899 3300046683 Bacteria 878
394 Ga0495613_0936828 3300046689 Bacteria 559
395 Ga0495624_0174769 3300046690 Bacteria 1310
396 Ga0495670_0344506 3300046691 Bacteria 802
397 Ga0495636_0340901 3300047318 Unclassified 706
398 Ga0495672_0010071 3300047320 Bacteria 6766
399 Ga0495676_0250289 3300047321 Bacteria 1209
400 Ga0495680_0505639 3300047322 Bacteria 820
401 Ga0495683_0473602 3300047323 Unclassified 511
402 Ga0496100_1044367 3300048903 Bacteria 643
403 Ga0496106_0819519 3300048909 Unclassified 738
404 Ga0496109_1187670 3300048912 Bacteria 700
405 Ga0496113_0356070 3300048916 Bacteria 1174
406 Ga0501299_071131 3300049522 Bacteria 755
407 Ga0501301_041336 3300049524 Unclassified 523
408 Ga0501031_0095574 3300049568 Bacteria 1939
409 Ga0501033_0853716 3300049570 Bacteria 614
410 Ga0501033_0983751 3300049570 Bacteria 564
411 Ga0501036_0103846 3300049572 Bacteria 2403
412 Ga0501036_0579840 3300049572 Bacteria 931
413 Ga0501037_0656202 3300049573 Bacteria 701
414 Ga0501038_0146533 3300049574 Bacteria 1927
415 Ga0501038_0628420 3300049574 Bacteria 810
416 Ga0501039_0028187 3300049575 Bacteria 4321
417 Ga0501040_0018905 3300049576 Bacteria 4579
418 Ga0501040_0113640 3300049576 Bacteria 1895
419 Ga0501040_0747887 3300049576 Unclassified 707
420 Ga0501041_0010542 3300049577 Bacteria 5449
421 Ga0501041_0185685 3300049577 Bacteria 1302
422 Ga0501042_0008973 3300049578 Bacteria 6639
423 Ga0501042_0030332 3300049578 Bacteria 3818
424 Ga0501042_0164119 3300049578 Bacteria 1603
425 Ga0501042_0237622 3300049578 Unclassified 1315
426 Ga0501043_0100323 3300049579 Bacteria 2276
427 Ga0501046_0295349 3300049580 Bacteria 1184
428 Ga0501048_0105663 3300049582 Bacteria 1987
429 Ga0501048_0296053 3300049582 Bacteria 1151
430 Ga0501048_0933525 3300049582 Bacteria 624
431 Ga0501068_0197738 3300049584 Bacteria 1275
432 Ga0501071_0064359 3300049587 Bacteria 2661
433 Ga0501071_0126771 3300049587 Bacteria 1895
434 Ga0501071_1112992 3300049587 Unclassified 610
435 Ga0501072_0016006 3300049588 Bacteria 5751
436 Ga0501072_0053959 3300049588 Bacteria 3166
437 Ga0501072_0255591 3300049588 Bacteria 1395
438 Ga0501072_0328789 3300049588 Bacteria 1215
439 Ga0501073_0175552 3300049589 Bacteria 1483
440 Ga0501074_0067026 3300049590 Bacteria 2582
441 Ga0501075_0047163 3300049591 Bacteria 3238
442 Ga0501076_0001662 3300049592 Bacteria 15032
443 Ga0501076_0041952 3300049592 Bacteria 3602
444 Ga0501076_0212465 3300049592 Bacteria 1581
445 Ga0501077_0052459 3300049593 Bacteria 2590
446 Ga0501077_0368392 3300049593 Bacteria 917
447 Ga0501077_0603131 3300049593 Bacteria 705
448 Ga0501219_011373 3300049703 Unclassified 679
449 Ga0501079_0052724 3300049741 Bacteria 3139
450 Ga0501079_0094036 3300049741 Bacteria 2323
451 Ga0501079_0124521 3300049741 Bacteria 2005
452 Ga0501079_0127918 3300049741 Bacteria 1976
453 Ga0501080_0642210 3300049742 Bacteria 940
454 Ga0501080_0777565 3300049742 Unclassified 841
455 Ga0501080_0969406 3300049742 Bacteria 739
456 Ga0501081_0030523 3300049743 Bacteria 3649
457 Ga0501081_0031654 3300049743 Bacteria 3585
458 Ga0501081_0048363 3300049743 Bacteria 2927
459 Ga0501081_0217483 3300049743 Bacteria 1389
460 Ga0501081_1046946 3300049743 Unclassified 617
461 Ga0501083_0584156 3300049744 Bacteria 727
462 Ga0501035_0712769 3300049822 Bacteria 808
463 Ga0501035_1495809 3300049822 Unclassified 515
464 Ga0501045_0011263 3300049824 Bacteria 6276
465 Ga0501045_0060678 3300049824 Bacteria 2773
466 Ga0501045_0170432 3300049824 Bacteria 1621
467 Ga0501045_0222768 3300049824 Bacteria 1404
468 nmdc:mga00v17_378999_c1 3300050491 Unclassified 919
469 nmdc:mga0k408_323282_c1 3300050493 Bacteria 920
470 nmdc:mga07m45_640978_c1 3300050496 Unclassified 612
471 nmdc:mga05p37_1143886_c1 3300050507 Unclassified 810
472 nmdc:mga05p37_114930_c1 3300050507 Bacteria 3308
473 nmdc:mga05p37_146419_c1 3300050507 Bacteria 2892
474 nmdc:mga05p37_30642_c1 3300050507 Bacteria 6564
475 nmdc:mga05p37_66974_c2 3300050507 Bacteria 3838
476 nmdc:mga09592_87820_c1 3300050508 Bacteria 2655
477 nmdc:mga09592_906982_c1 3300050508 Unclassified 740
478 nmdc:mga0qj67_193201_c1 3300050509 Bacteria 1654
479 nmdc:mga0qj67_295773_c1 3300050509 Bacteria 1312
480 nmdc:mga0qj67_36048_c1 3300050509 Bacteria 3868
481 nmdc:mga0qj67_54431_c1 3300050509 Bacteria 3168
482 nmdc:mga0qj67_733034_c1 3300050509 Bacteria 785
483 nmdc:mga06r32_393875_c1 3300050510 Bacteria 1367
484 nmdc:mga06r32_527801_c1 3300050510 Bacteria 1156
485 nmdc:mga06r32_7026_c1 3300050510 Bacteria 10125
486 nmdc:mga08y16_1104973_c1 3300050511 Unclassified 768
487 nmdc:mga08y16_375169_c1 3300050511 Bacteria 1459
488 nmdc:mga08y16_58426_c1 3300050511 Bacteria 4030
489 nmdc:mga08y16_62676_c1 3300050511 Bacteria 3883
490 nmdc:mga08y16_9763_c1 3300050511 Bacteria 10079
491 nmdc:mga0n895_1485337_c1 3300050512 Bacteria 644
492 nmdc:mga0n895_203638_c1 3300050512 Bacteria 2009
493 nmdc:mga0n895_328379_c1 3300050512 Bacteria 1550
494 nmdc:mga0n895_368047_c1 3300050512 Bacteria 1455
495 nmdc:mga0n895_58037_c1 3300050512 Bacteria 3816
496 nmdc:mga0n895_690474_c1 3300050512 Unclassified 1017
497 nmdc:mga0n895_90644_c1 3300050512 Bacteria 3059
498 nmdc:mga08x19_834809_c1 3300050514 Bacteria 654
499 nmdc:mga0a205_20670_c1 3300050515 Bacteria 6216
500 nmdc:mga0a205_324492_c1 3300050515 Bacteria 1410
501 nmdc:mga0a205_63428_c1 3300050515 Bacteria 3570
502 nmdc:mga0a205_63455_c1 3300050515 Bacteria 3569
503 Ga0495612_0018754 3300053078 Bacteria 2770
504 Ga0500556_0097541 3300053104 Bacteria 1129
505 Ga0500652_082155 3300053131 Bacteria 1342
506 Ga0501084_0036653 3300054114 Bacteria 4097
507 Ga0501084_0169811 3300054114 Bacteria 1841
508 Ga0501084_0519928 3300054114 Bacteria 1006
509 Ga0590071_000092 3300059421 Bacteria 24984
510 Ga0590074_013491 3300059423 Bacteria 1381
511 Ga0590075_000590 3300059424 Bacteria 9777
512 Ga0590077_001771 3300059426 Bacteria 4860
513 Ga0590077_001939 3300059426 Unclassified 4562
514 Ga0501082_0111403 3300060353 Bacteria 2369
515 Ga0501082_0188661 3300060353 Bacteria 1794
516 Ga0501082_1196554 3300060353 Unclassified 664
517 Ga0501082_1463597 3300060353 Bacteria 596
518 Ga0530510_0009781 3300061734 Bacteria 6729
519 Ga0530510_0086644 3300061734 Bacteria 2282
520 Ga0065715_10319596
521 SwRhRL2b_contig_3051
522 JGI24751J29686_10139181
523 Ga0065704_10087933
524 Ga0065712_10002770
525 Ga0065712_10228407
526 Ga0065712_10612142
527 Ga0065715_10014699
528 Ga0065707_10104395
529 Ga0065707_10645865
530 Ga0070683_101332564
531 Ga0070690_100009909
532 Ga0070690_100067716
533 Ga0070670_100002686
534 Ga0070670_101647432
535 Ga0070677_10082923
536 Ga0070677_10099711
537 Ga0068869_100147506
538 Ga0070680_100474006
539 Ga0070660_100423828
540 Ga0070689_100025094
541 Ga0070689_100231728
542 Ga0070687_100019732
543 Ga0070687_100302146
544 Ga0070687_100852600
545 Ga0070661_100688698
546 Ga0070692_10625070
547 Ga0070668_100275441
548 Ga0070669_100038140
549 Ga0070669_100205480
550 Ga0070669_100229457
551 Ga0070675_100016482
552 Ga0070675_100049416
553 Ga0070675_100056148
554 Ga0070675_100436949
555 Ga0070675_100631508
556 Ga0070671_100829560
557 Ga0070674_100113149
558 Ga0070674_100666524
559 Ga0070674_101079219
560 Ga0070674_101976574
561 Ga0070673_100016689
562 Ga0070673_100065295
563 Ga0070673_100674596
564 Ga0070688_100025841
565 Ga0070688_100225875
566 Ga0070688_100310967
567 Ga0070688_100974799
568 Ga0070659_100207529
569 Ga0070659_100849006
570 Ga0070659_101776909
571 Ga0070667_101592984
572 Ga0070711_100273868
573 Ga0070705_100901525
574 Ga0070705_101061145
575 Ga0070700_100229300
576 Ga0070700_101225303
577 Ga0070700_101643414
578 Ga0070694_100112820
579 Ga0070694_100150234
580 Ga0070694_100250471
581 Ga0070694_100472513
582 Ga0070694_100565652
583 Ga0070708_100163755
584 Ga0070708_100242420
585 Ga0070663_100690076
586 Ga0070678_100298189
587 Ga0070678_100403405
588 Ga0070678_100880904
589 Ga0070662_100148789
590 Ga0068867_101746240
591 Ga0070685_10073029
592 Ga0070685_10748874
593 Ga0070685_10886646
594 Ga0070706_100010993
595 Ga0070706_100195551
596 Ga0070707_100016955
597 Ga0070707_100043029
598 Ga0070707_100062270
599 Ga0070698_100001244
600 Ga0070698_100024710
601 Ga0070698_100752312
602 Ga0070698_100944616
603 Ga0070699_100040764
604 Ga0070699_100168774
605 Ga0070697_100012054
606 Ga0068853_101060127
607 Ga0070672_100003869
608 Ga0070672_100071466
609 Ga0070672_100346301
610 Ga0070672_100782622
611 Ga0070686_100060728
612 Ga0070686_101634021
613 Ga0070695_100363354
614 Ga0070696_100376090
615 Ga0070696_100847873
616 Ga0070665_102274150
617 Ga0070665_102322773
618 Ga0070664_100042479
619 Ga0070664_100099718
620 Ga0068857_100307936
621 Ga0068857_101087777
622 Ga0070702_100340137
623 Ga0070702_101140691
624 Ga0068852_100530903
625 Ga0068852_100701257
626 Ga0068864_100008113
627 Ga0068864_100190483
628 Ga0068861_100784536
629 Ga0068861_100903120
630 Ga0068870_10081990
631 Ga0068863_100315811
632 Ga0068863_100865224
633 Ga0068863_101836844
634 Ga0068858_100046189
635 Ga0068858_100300930
636 Ga0068860_100621350
637 Ga0068862_100258123
638 Ga0068862_100297064
639 Ga0068862_101118144
640 Ga0081538_10030587
641 Ga0097621_100454022
642 Ga0097621_100995824
643 Ga0068871_100356406
644 Ga0075428_100007688
645 Ga0075428_100049686
646 Ga0075428_100176694
647 Ga0075428_100332531
648 Ga0075428_100387313
649 Ga0075428_100478707
650 Ga0075428_100729779
651 Ga0075428_101099226
652 Ga0075428_101995146
653 Ga0075430_100108430
654 Ga0075430_100227776
655 Ga0075430_100237687
656 Ga0075430_100440162
657 Ga0075430_100784747
658 Ga0075431_100006361
659 Ga0075431_100008459
660 Ga0075431_100391235
661 Ga0075431_101077204
662 Ga0075433_10000543
663 Ga0075433_10136259
664 Ga0075433_10230972
665 Ga0075433_11005987
666 Ga0075434_100056847
667 Ga0075434_100060435
668 Ga0075434_100103042
669 Ga0075434_100109486
670 Ga0075434_100169703
671 Ga0075434_100306474
672 Ga0075434_100580499
673 Ga0075434_102037641
674 Ga0075429_100035509
675 Ga0075429_100328219
676 Ga0075429_100694043
677 Ga0075429_100701118
678 Ga0068865_100203241
679 Ga0068865_100685773
680 Ga0075435_100459787
681 Ga0099794_10600049
682 Ga0111539_10004536
683 Ga0111539_10011761
684 Ga0111539_10012688
685 Ga0111539_10035581
686 Ga0111539_10359774
687 Ga0111539_12792492
688 Ga0114129_10020747
689 Ga0114129_10079401
690 Ga0114129_10131761
691 Ga0114129_10140859
692 Ga0114129_10173989
693 Ga0114129_10184768
694 Ga0114129_11349278
695 Ga0114129_11585015
696 Ga0114129_12814187
697 Ga0114129_12930060
698 Ga0114129_13118939
699 Ga0105243_12211713
700 Ga0105243_12963014
701 Ga0105242_10963033
702 Ga0105248_10151345
703 Ga0105248_11110271
704 Ga0105249_11522982
705 Ga0105246_10287151
706 Ga0105246_10943033
707 Ga0105246_12568170
708 Ga0157373_10192819
709 Ga0157374_10177424
710 Ga0157374_10891887
711 Ga0157374_11954521
712 Ga0163162_10520406
713 Ga0157375_10410029
714 Ga0157375_10590362
715 Ga0157375_11128339
716 Ga0163163_10028947
717 Ga0163163_10745783
718 Ga0157380_10090713
719 Ga0157380_10333911
720 Ga0157380_10449047
721 Ga0157380_10489989
722 Ga0157380_11398877
723 Ga0157377_10132391
724 Ga0157377_10264930
725 Ga0157377_10610006
726 Ga0157376_10027231
727 Ga0157376_10205704
728 Ga0157376_10560760
729 Ga0157376_10700052
730 Ga0213876_10085039
731 Ga0207697_10146633
732 Ga0207653_10150593
733 Ga0207682_10072405
734 Ga0207688_10106983
735 Ga0207680_10686827
736 Ga0207645_10355360
737 Ga0207643_10074488
738 Ga0207643_10197615
739 Ga0207684_10008351
740 Ga0207660_10043026
741 Ga0207662_10005759
742 Ga0207662_10161793
743 Ga0207657_10316410
744 Ga0207646_10017752
745 Ga0207646_10062775
746 Ga0207681_10035554
747 Ga0207681_10575874
748 Ga0207681_11056773
749 Ga0207681_11765043
750 Ga0207650_10038776
751 Ga0207650_10321990
752 Ga0207650_11385224
753 Ga0207659_10002444
754 Ga0207659_10003788
755 Ga0207659_10146309
756 Ga0207659_10273592
757 Ga0207659_10403021
758 Ga0207659_10448968
759 Ga0207659_10450683
760 Ga0207644_10984066
761 Ga0207690_10233851
762 Ga0207690_11468247
763 Ga0207706_10470695
764 Ga0207706_10623323
765 Ga0207670_10123343
766 Ga0207670_10134444
767 Ga0207670_10174804
768 Ga0207669_10425201
769 Ga0207669_11059878
770 Ga0207704_10335699
771 Ga0207691_10033422
772 Ga0207691_10063591
773 Ga0207691_10067742
774 Ga0207691_10068713
775 Ga0207691_10469808
776 Ga0207711_11019554
777 Ga0207689_10057887
778 Ga0207689_10280512
779 Ga0207689_10603611
780 Ga0207679_10074358
781 Ga0207679_10166993
782 Ga0207651_10064484
783 Ga0207651_10119815
784 Ga0207651_10210641
785 Ga0207712_10433835
786 Ga0207712_10977902
787 Ga0207668_10247732
788 Ga0207668_10331253
789 Ga0207703_10264670
790 Ga0207703_11951843
791 Ga0207678_10771816
792 Ga0207708_10050315
793 Ga0207708_10227636
794 Ga0207708_11609866
795 Ga0207641_10562455
796 Ga0207648_10093814
797 Ga0207648_11756107
798 Ga0207676_10040113
799 Ga0207676_10087617
800 Ga0207674_10298199
801 Ga0207674_10707715
802 Ga0207675_100458516
803 Ga0207675_100983178
804 Ga0207675_101208089
805 Ga0207675_101233958
806 Ga0207683_10045645
807 Ga0207683_10805523
808 Ga0207698_10370722
809 Ga0209974_10064751
810 Ga0209974_10097084
811 Ga0207428_10002731
812 Ga0207428_10005111
813 Ga0207428_10059508
814 Ga0207428_10060828
815 Ga0268265_10506217
816 Ga0268265_10664390
817 Ga0268265_11099200
818 Ga0268264_11443234
819 Ga0307408_100052086
820 Ga0307408_100993461
821 Ga0316576_10006147
822 Ga0316578_10059409
823 Ga0307405_11306829
824 Ga0307413_10036448
825 Ga0307413_10175753
826 Ga0307413_10178334
827 Ga0307413_10182100
828 Ga0307410_10001177
829 Ga0307410_10018437
830 Ga0307410_10102337
831 Ga0307410_10456588
832 Ga0307406_10087576
833 Ga0307406_10523113
834 Ga0307406_10549564
835 Ga0307406_12131206
836 Ga0307407_10001884
837 Ga0307407_10009309
838 Ga0307407_10017382
839 Ga0307407_10040326
840 Ga0307407_10054545
841 Ga0307407_10152344
842 Ga0307412_10016281
843 Ga0307412_10021429
844 Ga0307409_100001060
845 Ga0307409_100001302
846 Ga0307409_100001558
847 Ga0307409_100023684
848 Ga0307409_100276541
849 Ga0307416_100011322
850 Ga0307416_100013949
851 Ga0307416_100308662
852 Ga0307414_10011398
853 Ga0307414_10136583
854 Ga0307414_10171969
855 Ga0307414_10664370
856 Ga0307411_10006136
857 Ga0307411_10009107
858 Ga0307411_10047847
859 Ga0307411_10076188
860 Ga0307411_11055389
861 Ga0307415_100007117
862 Ga0373952_0187741
863 Ga0373945_0071632
864 Ga0373943_0290054
865 Ga0373955_0235823
866 Ga0373961_0054552
867 Ga0373962_0025683
868 Ga0316574_0012813
869 Ga0373937_0030698
870 Ga0373937_1758168
871 Ga0316584_0085649
872 Ga0373925_0157746
873 Ga0395900_0321802
874 Ga0436365_0099061
875 Ga0436365_1110495
876 Ga0436363_1140780
877 Ga0439439_0149034
878 Ga0439461_0159578
879 Ga0451798_0970356
880 Ga0451800_0032756
881 Ga0451807_0558487
882 Ga0451853_0346547
883 Ga0451853_1943915
884 Ga0439433_0004078
885 Ga0439443_097458
886 Ga0450894_015095
887 Ga0450910_014172
888 Ga0439446_0017722
889 Ga0450908_045159
890 Ga0439435_0116598
891 Ga0439444_0100362
892 Ga0495629_0680852
893 Ga0495662_0384543
894 Ga0495594_0515818
895 Ga0495608_0377263
896 Ga0495618_0404031
897 Ga0495628_1167407
898 Ga0495630_0010985
899 Ga0495630_0444142
900 Ga0495666_0174832
901 Ga0495642_0128809
902 Ga0495640_0702902
903 Ga0495598_0386025
904 Ga0495598_0468326
905 Ga0495609_0067806
906 Ga0495621_0072587
907 Ga0495656_0017209
908 Ga0495656_0197019
909 Ga0495656_0657157
910 Ga0495634_0142340
911 Ga0495646_0632852
912 Ga0495658_0397899
913 Ga0495613_0936828
914 Ga0495624_0174769
915 Ga0495670_0344506
916 Ga0495636_0340901
917 Ga0495672_0010071
918 Ga0495676_0250289
919 Ga0495680_0505639
920 Ga0495683_0473602
921 Ga0496100_1044367
922 Ga0496106_0819519
923 Ga0496109_1187670
924 Ga0496113_0356070
925 Ga0501299_071131
926 Ga0501301_041336
927 Ga0501031_0095574
928 Ga0501033_0853716
929 Ga0501033_0983751
930 Ga0501036_0103846
931 Ga0501036_0579840
932 Ga0501037_0656202
933 Ga0501038_0146533
934 Ga0501038_0628420
935 Ga0501039_0028187
936 Ga0501040_0018905
937 Ga0501040_0113640
938 Ga0501040_0747887
939 Ga0501041_0010542
940 Ga0501041_0185685
941 Ga0501042_0008973
942 Ga0501042_0030332
943 Ga0501042_0164119
944 Ga0501042_0237622
945 Ga0501043_0100323
946 Ga0501046_0295349
947 Ga0501048_0105663
948 Ga0501048_0296053
949 Ga0501048_0933525
950 Ga0501068_0197738
951 Ga0501071_0064359
952 Ga0501071_0126771
953 Ga0501071_1112992
954 Ga0501072_0016006
955 Ga0501072_0053959
956 Ga0501072_0255591
957 Ga0501072_0328789
958 Ga0501073_0175552
959 Ga0501074_0067026
960 Ga0501075_0047163
961 Ga0501076_0001662
962 Ga0501076_0041952
963 Ga0501076_0212465
964 Ga0501077_0052459
965 Ga0501077_0368392
966 Ga0501077_0603131
967 Ga0501219_011373
968 Ga0501079_0052724
969 Ga0501079_0094036
970 Ga0501079_0124521
971 Ga0501079_0127918
972 Ga0501080_0642210
973 Ga0501080_0777565
974 Ga0501080_0969406
975 Ga0501081_0030523
976 Ga0501081_0031654
977 Ga0501081_0048363
978 Ga0501081_0217483
979 Ga0501081_1046946
980 Ga0501083_0584156
981 Ga0501035_0712769
982 Ga0501035_1495809
983 Ga0501045_0011263
984 Ga0501045_0060678
985 Ga0501045_0170432
986 Ga0501045_0222768
987 nmdc:mga00v17_378999_c1
988 nmdc:mga0k408_323282_c1
989 nmdc:mga07m45_640978_c1
990 nmdc:mga05p37_1143886_c1
991 nmdc:mga05p37_114930_c1
992 nmdc:mga05p37_146419_c1
993 nmdc:mga05p37_30642_c1
994 nmdc:mga05p37_66974_c2
995 nmdc:mga09592_87820_c1
996 nmdc:mga09592_906982_c1
997 nmdc:mga0qj67_193201_c1
998 nmdc:mga0qj67_295773_c1
999 nmdc:mga0qj67_36048_c1
1000 nmdc:mga0qj67_54431_c1
1001 nmdc:mga0qj67_733034_c1
1002 nmdc:mga06r32_393875_c1
1003 nmdc:mga06r32_527801_c1
1004 nmdc:mga06r32_7026_c1
1005 nmdc:mga08y16_1104973_c1
1006 nmdc:mga08y16_375169_c1
1007 nmdc:mga08y16_58426_c1
1008 nmdc:mga08y16_62676_c1
1009 nmdc:mga08y16_9763_c1
1010 nmdc:mga0n895_1485337_c1
1011 nmdc:mga0n895_203638_c1
1012 nmdc:mga0n895_328379_c1
1013 nmdc:mga0n895_368047_c1
1014 nmdc:mga0n895_58037_c1
1015 nmdc:mga0n895_690474_c1
1016 nmdc:mga0n895_90644_c1
1017 nmdc:mga08x19_834809_c1
1018 nmdc:mga0a205_20670_c1
1019 nmdc:mga0a205_324492_c1
1020 nmdc:mga0a205_63428_c1
1021 nmdc:mga0a205_63455_c1
1022 Ga0495612_0018754
1023 Ga0500556_0097541
1024 Ga0500652_082155
1025 Ga0501084_0036653
1026 Ga0501084_0169811
1027 Ga0501084_0519928
1028 Ga0590071_000092
1029 Ga0590074_013491
1030 Ga0590075_000590
1031 Ga0590077_001771
1032 Ga0590077_001939
1033 Ga0501082_0111403
1034 Ga0501082_0188661
1035 Ga0501082_1196554
1036 Ga0501082_1463597
1037 Ga0530510_0009781
1038 Ga0530510_0086644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

20

94

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2b-assembly1.cif.gz_A crystal structure of the c-terminal domain of mouse acyl-coa thioesterase 7 0.9544 17 130
5szv-assembly2.cif.gz_D novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9526 17 130
2qq2-assembly1.cif.gz_A crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9525 17 130
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.951 17 130
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9501 17 130
ID Description Score Start End Superfamily
af_Q91V12_220_381_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9473 17 129 3.10.129.10
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9467 17 130 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9461 17 120 3.10.129.10
af_E9QJN3_178_320_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9452 17 130 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9387 17 129 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1V5M854-F1-model_v4 Putative acyl-CoA thioester hydrolase (EC 3.1.2.-) 0.9824 12 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A7L9BR27-F1-model_v4 Acyl-CoA thioesterase 0.9807 14 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A7Z9IHY8-F1-model_v4 Acyl-CoA thioesterase 0.9797 15 129 GO:0005829
GO:0006637
GO:0009062
GO:0016020
GO:0052816
AF-A0A2D7GZK1-F1-model_v4 Acyl-CoA thioesterase 0.9777 15 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A4P5XKW2-F1-model_v4 Acyl-CoA thioesterase 0.9773 15 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816

Map