F458315

General Info

Members Datasets Scaffolds Average Seq Length
518 298 1036 106

Family's Representative Sequence

Representative Sequence 3300047317|Ga0495604_0279246|Ga0495604_0279246_332_682
Length 116
Sequence LRGTLIVARALVTMPTSAKRGDVVEIRTLIAHPMETGYRAAEDGSIRPRNLIRRFTCHYNDGRDDVLVFSAELFPAVAANPFIAFTTIATASGTLRFSWSGDQGFTQTETASLAVT

Samples

Sample ID Description Type Environment
1 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
251 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
252 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
253 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
254 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
255 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
275 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
276 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
277 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
278 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
279 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
280 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
284 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
289 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
290 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
291 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
292 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
293 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
294 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
295 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
296 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
297 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
298 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0.19
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 1.54
Rhizoplane 5.6
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495604_0279246 3300047317 Unclassified 1129
2 JGI25159J45721_1020497 3300002987 Bacteria 1271
3 Ga0065715_10234851 3300005293 Bacteria 1220
4 Ga0070676_10223771 3300005328 Bacteria 1244
5 Ga0070690_100033705 3300005330 Bacteria 3208
6 Ga0070690_100716201 3300005330 Unclassified 770
7 Ga0070690_100760205 3300005330 Bacteria 749
8 Ga0070670_100012065 3300005331 Bacteria 7393
9 Ga0070677_10003992 3300005333 Bacteria 4798
10 Ga0070677_10672159 3300005333 Bacteria 581
11 Ga0068869_100174094 3300005334 Bacteria 1683
12 Ga0070666_10359690 3300005335 Bacteria 1042
13 Ga0070680_100401881 3300005336 Bacteria 1168
14 Ga0068868_100005767 3300005338 Bacteria 8720
15 Ga0068868_100518871 3300005338 Bacteria 1046
16 Ga0068868_100954577 3300005338 Bacteria 782
17 Ga0070689_101286965 3300005340 Unclassified 658
18 Ga0070689_101745414 3300005340 Unclassified 567
19 Ga0070691_10062278 3300005341 Bacteria 1796
20 Ga0070691_10158719 3300005341 Bacteria 1164
21 Ga0070687_100282428 3300005343 Unclassified 1045
22 Ga0070692_10632925 3300005345 Bacteria 712
23 Ga0070692_11212180 3300005345 Bacteria 538
24 Ga0070668_100683124 3300005347 Bacteria 904
25 Ga0070668_100756836 3300005347 Bacteria 860
26 Ga0070669_100270508 3300005353 Bacteria 1358
27 Ga0070675_100006306 3300005354 Bacteria 9104
28 Ga0070675_100019468 3300005354 Bacteria 5411
29 Ga0070671_100130726 3300005355 Bacteria 2115
30 Ga0070671_100449352 3300005355 Bacteria 1106
31 Ga0070674_100305485 3300005356 Bacteria 1270
32 Ga0070674_101744513 3300005356 Bacteria 564
33 Ga0070673_100065054 3300005364 Bacteria 2907
34 Ga0070673_100077485 3300005364 Bacteria 2686
35 Ga0070673_100577229 3300005364 Bacteria 1024
36 Ga0070688_100118500 3300005365 Bacteria 1770
37 Ga0070688_100849259 3300005365 Unclassified 717
38 Ga0070659_101915051 3300005366 Bacteria 532
39 Ga0070667_100001934 3300005367 Bacteria 18379
40 Ga0070667_100018352 3300005367 Bacteria 5801
41 Ga0070667_100265722 3300005367 Unclassified 1537
42 Ga0070667_100389776 3300005367 Bacteria 1266
43 Ga0070667_100419426 3300005367 Bacteria 1220
44 Ga0070667_100546984 3300005367 Unclassified 1064
45 Ga0070667_100790419 3300005367 Bacteria 881
46 Ga0070705_100500069 3300005440 Bacteria 923
47 Ga0070700_100250252 3300005441 Bacteria 1271
48 Ga0070700_100845352 3300005441 Bacteria 741
49 Ga0070700_100897057 3300005441 Unclassified 722
50 Ga0070700_101082464 3300005441 Bacteria 663
51 Ga0070694_100692295 3300005444 Bacteria 828
52 Ga0070708_100133064 3300005445 Bacteria 2302
53 Ga0070708_100627245 3300005445 Unclassified 1013
54 Ga0070678_100092562 3300005456 Bacteria 2323
55 Ga0070678_100488448 3300005456 Bacteria 1085
56 Ga0070678_100677513 3300005456 Bacteria 927
57 Ga0070678_100841123 3300005456 Bacteria 836
58 Ga0070662_100110820 3300005457 Bacteria 2091
59 Ga0070662_100534830 3300005457 Bacteria 981
60 Ga0070681_10170552 3300005458 Bacteria 2098
61 Ga0070681_10271016 3300005458 Bacteria 1609
62 Ga0068867_100193844 3300005459 Bacteria 1623
63 Ga0070685_10109996 3300005466 Unclassified 1696
64 Ga0070706_100001825 3300005467 Bacteria 22059
65 Ga0070707_100316859 3300005468 Bacteria 1516
66 Ga0070698_100080835 3300005471 Bacteria 3244
67 Ga0070698_100415008 3300005471 Bacteria 1280
68 Ga0070698_100876459 3300005471 Bacteria 843
69 Ga0068853_101000738 3300005539 Bacteria 805
70 Ga0068853_101060733 3300005539 Bacteria 781
71 Ga0070672_100127530 3300005543 Bacteria 2088
72 Ga0070672_100167156 3300005543 Bacteria 1827
73 Ga0070672_101105952 3300005543 Bacteria 704
74 Ga0070695_100211767 3300005545 Bacteria 1392
75 Ga0070693_100126342 3300005547 Bacteria 1593
76 Ga0070665_100251382 3300005548 Bacteria 1769
77 Ga0070665_100321391 3300005548 Bacteria 1552
78 Ga0070664_100895893 3300005564 Bacteria 832
79 Ga0070664_101173520 3300005564 Bacteria 724
80 Ga0068854_100510283 3300005578 Bacteria 1014
81 Ga0068854_101052736 3300005578 Bacteria 723
82 Ga0068852_100086589 3300005616 Bacteria 2793
83 Ga0068852_100765735 3300005616 Bacteria 978
84 Ga0068864_100026836 3300005618 Bacteria 4858
85 Ga0068864_100699867 3300005618 Unclassified 990
86 Ga0068866_10069390 3300005718 Bacteria 1857
87 Ga0068861_100098149 3300005719 Bacteria 2325
88 Ga0068861_100332538 3300005719 Bacteria 1327
89 Ga0068861_101553532 3300005719 Unclassified 651
90 Ga0068863_100124908 3300005841 Bacteria 2455
91 Ga0068863_100176508 3300005841 Bacteria 2050
92 Ga0068863_102434793 3300005841 Bacteria 533
93 Ga0068858_100001491 3300005842 Bacteria 24120
94 Ga0068858_100447831 3300005842 Bacteria 1244
95 Ga0068860_100248482 3300005843 Bacteria 1732
96 Ga0068860_100342294 3300005843 Bacteria 1470
97 Ga0068860_100413067 3300005843 Bacteria 1337
98 Ga0068860_101636485 3300005843 Bacteria 666
99 Ga0068860_101809076 3300005843 Bacteria 633
100 Ga0081455_10109127 3300005937 Bacteria 2203
101 Ga0081540_1153947 3300005983 Bacteria 902
102 Ga0081540_1171255 3300005983 Unclassified 826
103 Ga0081540_1197579 3300005983 Unclassified 735
104 Ga0081539_10076244 3300005985 Bacteria 1777
105 Ga0081539_10130277 3300005985 Unclassified 1236
106 Ga0070717_10247367 3300006028 Bacteria 1574
107 Ga0075368_10363146 3300006042 Bacteria 632
108 Ga0075432_10337857 3300006058 Bacteria 635
109 Ga0070715_10586268 3300006163 Unclassified 651
110 Ga0075362_10269806 3300006177 Bacteria 840
111 Ga0075367_10004522 3300006178 Bacteria 6800
112 Ga0075369_10314348 3300006186 Unclassified 732
113 Ga0075366_10023723 3300006195 Bacteria 3574
114 Ga0097621_100271379 3300006237 Bacteria 1491
115 Ga0097621_100541989 3300006237 Bacteria 1058
116 Ga0075370_10010656 3300006353 Bacteria 4817
117 Ga0068871_100043510 3300006358 Bacteria 3607
118 Ga0068871_100276589 3300006358 Bacteria 1468
119 Ga0068871_101138652 3300006358 Bacteria 730
120 Ga0068871_101140435 3300006358 Bacteria 730
121 Ga0075428_100099045 3300006844 Bacteria 3178
122 Ga0075428_100667128 3300006844 Bacteria 1108
123 Ga0075430_100069054 3300006846 Bacteria 2965
124 Ga0075430_100225490 3300006846 Bacteria 1554
125 Ga0075430_100784012 3300006846 Bacteria 785
126 Ga0075431_100468010 3300006847 Bacteria 1254
127 Ga0075431_100646476 3300006847 Bacteria 1038
128 Ga0075433_10321115 3300006852 Bacteria 1370
129 Ga0075433_10947366 3300006852 Bacteria 750
130 Ga0075434_100128033 3300006871 Bacteria 2556
131 Ga0075434_100751720 3300006871 Bacteria 992
132 Ga0075434_100764426 3300006871 Unclassified 983
133 Ga0075429_100002105 3300006880 Bacteria 16618
134 Ga0075429_100105845 3300006880 Bacteria 2457
135 Ga0075429_100136402 3300006880 Bacteria 2147
136 Ga0075436_100066553 3300006914 Bacteria 2490
137 Ga0075436_100085515 3300006914 Bacteria 2190
138 Ga0075435_100046546 3300007076 Bacteria 3480
139 Ga0111539_10009229 3300009094 Bacteria 12465
140 Ga0111539_10581874 3300009094 Bacteria 1304
141 Ga0111539_10746091 3300009094 Unclassified 1139
142 Ga0105245_10348968 3300009098 Unclassified 1465
143 Ga0114129_10205979 3300009147 Bacteria 2661
144 Ga0114129_10454274 3300009147 Bacteria 1680
145 Ga0114129_11042300 3300009147 Bacteria 1027
146 Ga0114129_11947779 3300009147 Unclassified 712
147 Ga0105243_11736554 3300009148 Bacteria 654
148 Ga0105243_12172686 3300009148 Bacteria 591
149 Ga0105243_12599831 3300009148 Bacteria 546
150 Ga0105243_12839809 3300009148 Bacteria 525
151 Ga0105242_10435933 3300009176 Bacteria 1232
152 Ga0105242_10453050 3300009176 Bacteria 1210
153 Ga0105248_10006873 3300009177 Bacteria 12468
154 Ga0105248_10023404 3300009177 Bacteria 6862
155 Ga0105248_10277532 3300009177 Bacteria 1887
156 Ga0105248_10432041 3300009177 Bacteria 1483
157 Ga0105248_11428276 3300009177 Bacteria 783
158 Ga0105248_11711678 3300009177 Bacteria 713
159 Ga0105238_11968753 3300009551 Bacteria 618
160 Ga0105249_10211616 3300009553 Bacteria 1903
161 Ga0105249_11275078 3300009553 Bacteria 806
162 Ga0105239_10449738 3300010375 Bacteria 1461
163 Ga0105239_10464983 3300010375 Bacteria 1436
164 Ga0157326_1056419 3300012513 Bacteria 590
165 Ga0157374_10129086 3300013296 Bacteria 2445
166 Ga0157378_10064837 3300013297 Bacteria 3269
167 Ga0157378_13279232 3300013297 Bacteria 503
168 Ga0163162_10027568 3300013306 Bacteria 5617
169 Ga0163162_11875808 3300013306 Unclassified 686
170 Ga0163162_12195470 3300013306 Unclassified 634
171 Ga0157375_10049708 3300013308 Bacteria 4110
172 Ga0157375_10239774 3300013308 Bacteria 1973
173 Ga0157375_10611943 3300013308 Bacteria 1248
174 Ga0157375_10788608 3300013308 Bacteria 1099
175 Ga0157375_11222440 3300013308 Bacteria 882
176 Ga0163163_10072304 3300014325 Bacteria 3438
177 Ga0157380_11033677 3300014326 Bacteria 857
178 Ga0157380_12436083 3300014326 Bacteria 589
179 Ga0157377_10291387 3300014745 Bacteria 1074
180 Ga0157377_10638000 3300014745 Bacteria 765
181 Ga0157379_10121300 3300014968 Bacteria 2351
182 Ga0157379_10243225 3300014968 Bacteria 1632
183 Ga0157376_10269325 3300014969 Unclassified 1599
184 Ga0157376_10589949 3300014969 Bacteria 1105
185 Ga0157376_13090587 3300014969 Bacteria 504
186 Ga0163161_10135383 3300017792 Bacteria 1862
187 Ga0163161_10623337 3300017792 Bacteria 891
188 Ga0163161_11029825 3300017792 Bacteria 704
189 Ga0206354_11619921 3300020081 Bacteria 1037
190 Ga0213876_10760293 3300021384 Bacteria 516
191 Ga0213875_10001156 3300021388 Bacteria 18094
192 Ga0209257_1017993 3300025304 Bacteria 2746
193 Ga0207656_10340748 3300025321 Bacteria 747
194 Ga0207682_10006965 3300025893 Bacteria 4532
195 Ga0207682_10118665 3300025893 Unclassified 1171
196 Ga0207642_10023036 3300025899 Bacteria 2481
197 Ga0207680_10117076 3300025903 Bacteria 1737
198 Ga0207685_10533993 3300025905 Unclassified 622
199 Ga0207685_10709422 3300025905 Unclassified 548
200 Ga0207645_10098185 3300025907 Bacteria 1888
201 Ga0207643_10222779 3300025908 Bacteria 1155
202 Ga0207684_10012679 3300025910 Bacteria 7319
203 Ga0207654_10393795 3300025911 Bacteria 962
204 Ga0207707_10563896 3300025912 Bacteria 967
205 Ga0207707_10863421 3300025912 Bacteria 750
206 Ga0207693_10029437 3300025915 Bacteria 4338
207 Ga0207662_10039202 3300025918 Bacteria 2779
208 Ga0207662_10506596 3300025918 Bacteria 832
209 Ga0207649_10208863 3300025920 Bacteria 1384
210 Ga0207652_10734100 3300025921 Bacteria 880
211 Ga0207681_10099802 3300025923 Bacteria 2091
212 Ga0207681_10687697 3300025923 Bacteria 850
213 Ga0207650_10053215 3300025925 Bacteria 3000
214 Ga0207650_10107363 3300025925 Bacteria 2156
215 Ga0207659_10002348 3300025926 Bacteria 11269
216 Ga0207659_10141618 3300025926 Bacteria 1867
217 Ga0207659_10948778 3300025926 Bacteria 740
218 Ga0207644_11662431 3300025931 Bacteria 535
219 Ga0207690_10529029 3300025932 Bacteria 956
220 Ga0207706_10137355 3300025933 Bacteria 2151
221 Ga0207706_10269782 3300025933 Unclassified 1485
222 Ga0207706_10405557 3300025933 Bacteria 1181
223 Ga0207686_10055492 3300025934 Bacteria 2486
224 Ga0207709_10037819 3300025935 Bacteria 2869
225 Ga0207709_10616127 3300025935 Unclassified 861
226 Ga0207669_10105751 3300025937 Bacteria 1873
227 Ga0207704_10732166 3300025938 Bacteria 821
228 Ga0207691_10153442 3300025940 Bacteria 2024
229 Ga0207691_10605210 3300025940 Bacteria 928
230 Ga0207711_10038008 3300025941 Bacteria 4092
231 Ga0207711_10396267 3300025941 Bacteria 1282
232 Ga0207711_10729140 3300025941 Bacteria 924
233 Ga0207711_10862819 3300025941 Bacteria 842
234 Ga0207689_10012694 3300025942 Bacteria 7196
235 Ga0207661_11399874 3300025944 Unclassified 642
236 Ga0207679_10850173 3300025945 Bacteria 833
237 Ga0207651_10002333 3300025960 Bacteria 9046
238 Ga0207651_10196178 3300025960 Bacteria 1614
239 Ga0207712_10376363 3300025961 Bacteria 1187
240 Ga0207668_10111053 3300025972 Bacteria 2057
241 Ga0207640_10547273 3300025981 Bacteria 972
242 Ga0207658_10010134 3300025986 Bacteria 6403
243 Ga0207658_10191330 3300025986 Bacteria 1701
244 Ga0207658_10386356 3300025986 Bacteria 1227
245 Ga0207658_10718683 3300025986 Bacteria 903
246 Ga0207658_10719759 3300025986 Bacteria 903
247 Ga0207658_11585524 3300025986 Bacteria 599
248 Ga0207658_11995670 3300025986 Unclassified 528
249 Ga0207677_10104901 3300026023 Bacteria 2090
250 Ga0207703_10004681 3300026035 Bacteria 11173
251 Ga0207703_11922908 3300026035 Bacteria 568
252 Ga0207639_10198036 3300026041 Bacteria 1720
253 Ga0207678_10115653 3300026067 Bacteria 2288
254 Ga0207708_10112521 3300026075 Bacteria 2114
255 Ga0207708_10141520 3300026075 Bacteria 1887
256 Ga0207708_10307074 3300026075 Bacteria 1291
257 Ga0207708_10315466 3300026075 Bacteria 1274
258 Ga0207708_10820973 3300026075 Bacteria 801
259 Ga0207641_10024266 3300026088 Bacteria 4998
260 Ga0207641_12049305 3300026088 Bacteria 573
261 Ga0207648_10193842 3300026089 Bacteria 1801
262 Ga0207648_10256461 3300026089 Bacteria 1560
263 Ga0207648_10306293 3300026089 Bacteria 1426
264 Ga0207676_10002643 3300026095 Bacteria 12753
265 Ga0207676_10390597 3300026095 Unclassified 1298
266 Ga0207676_10673177 3300026095 Bacteria 1000
267 Ga0207675_100123211 3300026118 Bacteria 2454
268 Ga0207675_100123470 3300026118 Bacteria 2451
269 Ga0207675_100226104 3300026118 Bacteria 1804
270 Ga0207675_101084752 3300026118 Bacteria 820
271 Ga0207683_10029725 3300026121 Bacteria 4732
272 Ga0207683_10037515 3300026121 Bacteria 4220
273 Ga0207698_10800604 3300026142 Bacteria 944
274 Ga0207698_11838730 3300026142 Bacteria 621
275 Ga0207428_11191616 3300027907 Unclassified 530
276 Ga0268266_10152993 3300028379 Bacteria 2081
277 Ga0268266_10266412 3300028379 Bacteria 1589
278 Ga0268265_10132292 3300028380 Bacteria 2075
279 Ga0268264_10384805 3300028381 Bacteria 1344
280 Ga0268264_10503895 3300028381 Bacteria 1181
281 Ga0268264_11150246 3300028381 Bacteria 785
282 Ga0265337_1002058 3300028556 Bacteria 9514
283 Ga0265322_10135415 3300028654 Unclassified 703
284 Ga0307517_10003242 3300028786 Bacteria 25464
285 Ga0307517_10031397 3300028786 Bacteria 6184
286 Ga0307517_10219374 3300028786 Bacteria 1158
287 Ga0307515_10020398 3300028794 Bacteria 11827
288 Ga0307515_10203111 3300028794 Bacteria 1851
289 Ga0307515_10789255 3300028794 Bacteria 571
290 Ga0265338_10506172 3300028800 Bacteria 850
291 Ga0307512_10303972 3300030522 Bacteria 740
292 Ga0265340_10280704 3300031247 Unclassified 740
293 Ga0265327_10241025 3300031251 Bacteria 808
294 Ga0307513_10138092 3300031456 Bacteria 2369
295 Ga0307513_10204584 3300031456 Bacteria 1811
296 Ga0307513_10442962 3300031456 Bacteria 1025
297 Ga0307513_10824354 3300031456 Bacteria 634
298 Ga0307509_10011769 3300031507 Bacteria 10546
299 Ga0307509_10061405 3300031507 Bacteria 3967
300 Ga0307509_10144352 3300031507 Bacteria 2309
301 Ga0307509_10238741 3300031507 Bacteria 1612
302 Ga0307509_10249437 3300031507 Bacteria 1560
303 Ga0307408_100296546 3300031548 Bacteria 1352
304 Ga0307508_10000028 3300031616 Bacteria 168639
305 Ga0307508_10001494 3300031616 Bacteria 26240
306 Ga0307508_10084591 3300031616 Bacteria 2754
307 Ga0307508_10090171 3300031616 Bacteria 2652
308 Ga0307508_10183549 3300031616 Bacteria 1694
309 Ga0307508_10424636 3300031616 Bacteria 921
310 Ga0307514_10034183 3300031649 Bacteria 4052
311 Ga0307514_10200893 3300031649 Bacteria 1253
312 Ga0265314_10007585 3300031711 Bacteria 9394
313 Ga0307516_10001972 3300031730 Bacteria 28094
314 Ga0307516_10008523 3300031730 Bacteria 11583
315 Ga0307516_10141690 3300031730 Bacteria 2173
316 Ga0307405_10253902 3300031731 Bacteria 1310
317 Ga0307406_10136257 3300031901 Bacteria 1731
318 Ga0307406_10742459 3300031901 Bacteria 823
319 Ga0307412_10625285 3300031911 Bacteria 915
320 Ga0307409_100527420 3300031995 Bacteria 1155
321 Ga0307409_101884431 3300031995 Bacteria 627
322 Ga0307416_100337055 3300032002 Bacteria 1519
323 Ga0307416_100421979 3300032002 Bacteria 1378
324 Ga0307416_102694861 3300032002 Bacteria 594
325 Ga0307414_10374694 3300032004 Bacteria 1229
326 Ga0307414_12328952 3300032004 Bacteria 500
327 Ga0307411_11286481 3300032005 Bacteria 666
328 Ga0307507_10130849 3300033179 Bacteria 1964
329 Ga0307507_10301735 3300033179 Bacteria 981
330 Ga0307510_10143253 3300033180 Bacteria 2028
331 Ga0307510_10167684 3300033180 Bacteria 1780
332 Ga0307510_10178141 3300033180 Bacteria 1693
333 Ga0373959_0142517 3300034820 Bacteria 601
334 Ga0373928_0133745 3300035084 Bacteria 674
335 Ga0373952_0035993 3300035092 Bacteria 1123
336 Ga0373939_0151732 3300035114 Bacteria 844
337 Ga0373941_0407957 3300035115 Bacteria 563
338 Ga0373945_0113780 3300035116 Bacteria 1070
339 Ga0373945_0157610 3300035116 Bacteria 924
340 Ga0373960_0036932 3300035121 Bacteria 1394
341 Ga0373943_0761713 3300035170 Unclassified 575
342 Ga0373946_0073438 3300035171 Bacteria 1483
343 Ga0373961_0128031 3300035241 Bacteria 848
344 Ga0373931_0073394 3300035691 Bacteria 1872
345 Ga0373927_0052202 3300035695 Bacteria 2645
346 Ga0373927_0492175 3300035695 Bacteria 810
347 Ga0373927_0644682 3300035695 Bacteria 700
348 Ga0373927_1041042 3300035695 Bacteria 540
349 Ga0373933_0300626 3300035724 Unclassified 1039
350 Ga0373947_0239676 3300035725 Bacteria 1197
351 Ga0373947_0664265 3300035725 Bacteria 711
352 Ga0373925_0209758 3300037068 Bacteria 1552
353 Ga0373925_0608284 3300037068 Bacteria 900
354 Ga0373925_1268496 3300037068 Bacteria 605
355 Ga0436364_0382047 3300037853 Bacteria 47579
356 Ga0436365_0805120 3300039437 Bacteria 652
357 Ga0436365_1918854 3300039437 Bacteria 6240
358 Ga0436365_1924540 3300039437 Bacteria 934
359 Ga0436360_0610658 3300039438 Bacteria 697
360 Ga0436361_0885027 3300039447 Bacteria 766
361 Ga0439465_0016814 3300041413 Bacteria 2283
362 Ga0439465_0158003 3300041413 Bacteria 812
363 Ga0439465_0392462 3300041413 Bacteria 527
364 Ga0451853_4095136 3300041512 Bacteria 605
365 Ga0451577_1487455 3300042876 Bacteria 599
366 Ga0453684_2505444 3300044712 Bacteria 509
367 Ga0451576_2560407 3300045051 Unclassified 521
368 Ga0495592_0003197 3300046454 Bacteria 11742
369 Ga0495629_0071739 3300046459 Bacteria 2417
370 Ga0495629_0138809 3300046459 Bacteria 1692
371 Ga0495629_0413365 3300046459 Unclassified 916
372 Ga0495629_0549873 3300046459 Bacteria 775
373 Ga0495638_0292215 3300046460 Bacteria 881
374 Ga0495638_0388548 3300046460 Bacteria 727
375 Ga0495605_0242335 3300046474 Bacteria 774
376 Ga0495664_0307751 3300046477 Unclassified 956
377 Ga0495585_0526332 3300046492 Bacteria 560
378 Ga0495620_0014834 3300046515 Bacteria 3950
379 Ga0495628_0003761 3300046516 Bacteria 13506
380 Ga0495630_0137475 3300046517 Bacteria 1857
381 Ga0495632_0023136 3300046519 Bacteria 3322
382 Ga0495643_0380731 3300046522 Bacteria 626
383 Ga0495648_0165713 3300046524 Bacteria 1138
384 Ga0495666_0244756 3300046526 Bacteria 818
385 Ga0495642_0077828 3300046528 Unclassified 1393
386 Ga0495642_0139154 3300046528 Bacteria 1047
387 Ga0495652_0004307 3300046529 Bacteria 13639
388 Ga0495586_0212621 3300046535 Bacteria 1098
389 Ga0495587_0145445 3300046536 Bacteria 1352
390 Ga0495598_0100529 3300046537 Bacteria 956
391 Ga0495598_0405343 3300046537 Bacteria 534
392 Ga0495645_0000291 3300046543 Bacteria 36790
393 Ga0495645_0623269 3300046543 Bacteria 661
394 Ga0495622_0147486 3300046557 Bacteria 1066
395 Ga0495656_0114647 3300046615 Bacteria 1265
396 Ga0495668_0467214 3300046616 Bacteria 695
397 Ga0495599_0000245 3300046678 Bacteria 34256
398 Ga0495647_0050269 3300046681 Bacteria 1617
399 Ga0495647_0142234 3300046681 Bacteria 1024
400 Ga0495658_0138006 3300046683 Bacteria 1489
401 Ga0495658_0829797 3300046683 Unclassified 592
402 Ga0495658_0946367 3300046683 Bacteria 550
403 Ga0495613_0423115 3300046689 Bacteria 906
404 Ga0495613_0860389 3300046689 Bacteria 589
405 Ga0495624_0390814 3300046690 Unclassified 835
406 Ga0495670_0257133 3300046691 Bacteria 932
407 Ga0495660_0252359 3300046810 Bacteria 818
408 Ga0495674_1048774 3300047319 Unclassified 623
409 Ga0495676_0047900 3300047321 Bacteria 3451
410 Ga0495676_0765192 3300047321 Bacteria 623
411 Ga0495687_031664 3300047443 Bacteria 2424
412 Ga0495673_0363027 3300047469 Bacteria 509
413 Ga0495686_0150603 3300047472 Bacteria 1366
414 Ga0495593_0186164 3300047673 Bacteria 1045
415 Ga0495593_0396692 3300047673 Unclassified 690
416 Ga0496100_0331361 3300048903 Bacteria 1146
417 Ga0496100_1567944 3300048903 Unclassified 520
418 Ga0496101_0136945 3300048904 Bacteria 1864
419 Ga0496101_0737977 3300048904 Bacteria 777
420 Ga0496102_0188147 3300048905 Bacteria 1945
421 Ga0496104_0005692 3300048907 Bacteria 10907
422 Ga0496104_0332233 3300048907 Bacteria 1433
423 Ga0496104_0415083 3300048907 Bacteria 1258
424 Ga0496105_0031452 3300048908 Bacteria 4351
425 Ga0496106_0014751 3300048909 Bacteria 5777
426 Ga0496106_0066317 3300048909 Bacteria 2749
427 Ga0496106_0134738 3300048909 Bacteria 1939
428 Ga0496107_0044804 3300048910 Bacteria 3181
429 Ga0496108_0084786 3300048911 Bacteria 2689
430 Ga0496108_0126383 3300048911 Bacteria 2195
431 Ga0496109_0060092 3300048912 Bacteria 3473
432 Ga0496109_0070026 3300048912 Bacteria 3218
433 Ga0496110_0218787 3300048913 Bacteria 1732
434 Ga0496110_0260447 3300048913 Bacteria 1578
435 Ga0496110_0912950 3300048913 Unclassified 784
436 Ga0496111_0149763 3300048914 Bacteria 1730
437 Ga0496112_0045510 3300048915 Bacteria 4302
438 Ga0496113_0316650 3300048916 Bacteria 1250
439 Ga0496114_0454455 3300048917 Bacteria 1134
440 Ga0496114_0470793 3300048917 Bacteria 1112
441 Ga0496114_1334141 3300048917 Bacteria 604
442 Ga0496115_0003236 3300048918 Bacteria 11694
443 Ga0496115_0882269 3300048918 Bacteria 691
444 Ga0496115_1302384 3300048918 Unclassified 541
445 Ga0496121_0434825 3300048924 Bacteria 850
446 Ga0501292_013792 3300049515 Bacteria 1247
447 Ga0501036_0841957 3300049572 Bacteria 754
448 Ga0501072_1108805 3300049588 Bacteria 616
449 Ga0501073_0518683 3300049589 Bacteria 824
450 Ga0501073_0630227 3300049589 Unclassified 740
451 Ga0501073_0795854 3300049589 Archaea 652
452 Ga0501077_1055283 3300049593 Bacteria 523
453 Ga0501206_010588 3300049653 Bacteria 1237
454 Ga0501257_127485 3300049686 Bacteria 686
455 Ga0501262_030681 3300049759 Bacteria 773
456 Ga0501265_007110 3300049762 Bacteria 1312
457 Ga0501273_026708 3300049770 Bacteria 806
458 Ga0501281_03487 3300049777 Bacteria 1125
459 nmdc:mga0k408_150168_c1 3300050493 Bacteria 1387
460 nmdc:mga0k408_25675_c1 3300050493 Bacteria 3338
461 nmdc:mga0k408_410172_c1 3300050493 Bacteria 806
462 nmdc:mga06z11_53167_c1 3300050494 Bacteria 2082
463 nmdc:mga04h51_159569_c1 3300050495 Bacteria 867
464 nmdc:mga07m45_60323_c1 3300050496 Bacteria 2147
465 nmdc:mga05p37_1057915_c1 3300050507 Unclassified 855
466 nmdc:mga05p37_1379781_c1 3300050507 Unclassified 711
467 nmdc:mga05p37_230932_c1 3300050507 Bacteria 2229
468 nmdc:mga05p37_691751_c1 3300050507 Unclassified 1134
469 nmdc:mga09592_136261_c1 3300050508 Bacteria 2115
470 nmdc:mga09592_165401_c1 3300050508 Bacteria 1912
471 nmdc:mga09592_18972_c1 3300050508 Bacteria 5644
472 nmdc:mga0qj67_220531_c1 3300050509 Bacteria 1540
473 nmdc:mga0qj67_36305_c1 3300050509 Bacteria 3856
474 nmdc:mga06r32_31289_c1 3300050510 Bacteria 4997
475 nmdc:mga06r32_391772_c1 3300050510 Bacteria 1372
476 nmdc:mga08y16_416069_c1 3300050511 Bacteria 1374
477 nmdc:mga08y16_89461_c1 3300050511 Bacteria 3209
478 nmdc:mga0n895_119964_c1 3300050512 Bacteria 2651
479 nmdc:mga0n895_418621_c1 3300050512 Bacteria 1354
480 nmdc:mga0n895_54156_c1 3300050512 Bacteria 3945
481 nmdc:mga0rr50_167668_c1 3300050513 Bacteria 1787
482 nmdc:mga0rr50_362401_c1 3300050513 Bacteria 1220
483 nmdc:mga08x19_167032_c1 3300050514 Unclassified 1497
484 nmdc:mga08x19_45393_c1 3300050514 Bacteria 2808
485 nmdc:mga0a205_120788_c1 3300050515 Bacteria 2519
486 nmdc:mga0a205_612365_c1 3300050515 Bacteria 942
487 nmdc:mga0sz30_210294_c1 3300050516 Unclassified 864
488 Ga0500578_0017684 3300053086 Bacteria 4581
489 Ga0500644_0001913 3300053088 Bacteria 5344
490 Ga0500644_0040632 3300053088 Bacteria 1540
491 Ga0500651_0085062 3300053093 Bacteria 1955
492 Ga0500562_014001 3300053108 Bacteria 2052
493 Ga0500593_195696 3300053117 Bacteria 735
494 Ga0500594_0057184 3300053118 Bacteria 1114
495 Ga0500621_260855 3300053126 Bacteria 576
496 Ga0500655_028403 3300053133 Bacteria 1070
497 Ga0500561_0057733 3300053137 Bacteria 1078
498 Ga0500568_0055893 3300053139 Bacteria 1539
499 Ga0500586_029554 3300053145 Bacteria 1797
500 Ga0500622_0008466 3300053156 Bacteria 5753
501 Ga0500636_0044331 3300053177 Bacteria 2623
502 Ga0500636_0284305 3300053177 Bacteria 824
503 Ga0500645_005748 3300053730 Bacteria 4514
504 Ga0500587_002482 3300053739 Bacteria 2621
505 Ga0500661_041863 3300055283 Bacteria 812
506 Ga0501082_1365219 3300060353 Bacteria 619
507 Ga0530510_0499976 3300061734 Bacteria 922
508 2828307174 2828305725 Bacteria 4916900
509 2871480012 2871474448 Bacteria 6806570
510 2878789946 2878788777 Bacteria 6567085
511 2885315497 2885312484 Bacteria 6415165
512 2888347631 2888343758 Bacteria 6611049
513 2894416541 2894414249 Bacteria 4405451
514 2924760245 2924754689 Bacteria 6774424
515 2958077699 2958071322 Bacteria 6815895
516 2970542803 2970540015 Bacteria 6977556
517 8004401458 8004395343 Bacteria 6620908
518 8004637164 8004633249 Bacteria 6723080
519 Ga0495604_0279246
520 JGI25159J45721_1020497
521 Ga0065715_10234851
522 Ga0070676_10223771
523 Ga0070690_100033705
524 Ga0070690_100716201
525 Ga0070690_100760205
526 Ga0070670_100012065
527 Ga0070677_10003992
528 Ga0070677_10672159
529 Ga0068869_100174094
530 Ga0070666_10359690
531 Ga0070680_100401881
532 Ga0068868_100005767
533 Ga0068868_100518871
534 Ga0068868_100954577
535 Ga0070689_101286965
536 Ga0070689_101745414
537 Ga0070691_10062278
538 Ga0070691_10158719
539 Ga0070687_100282428
540 Ga0070692_10632925
541 Ga0070692_11212180
542 Ga0070668_100683124
543 Ga0070668_100756836
544 Ga0070669_100270508
545 Ga0070675_100006306
546 Ga0070675_100019468
547 Ga0070671_100130726
548 Ga0070671_100449352
549 Ga0070674_100305485
550 Ga0070674_101744513
551 Ga0070673_100065054
552 Ga0070673_100077485
553 Ga0070673_100577229
554 Ga0070688_100118500
555 Ga0070688_100849259
556 Ga0070659_101915051
557 Ga0070667_100001934
558 Ga0070667_100018352
559 Ga0070667_100265722
560 Ga0070667_100389776
561 Ga0070667_100419426
562 Ga0070667_100546984
563 Ga0070667_100790419
564 Ga0070705_100500069
565 Ga0070700_100250252
566 Ga0070700_100845352
567 Ga0070700_100897057
568 Ga0070700_101082464
569 Ga0070694_100692295
570 Ga0070708_100133064
571 Ga0070708_100627245
572 Ga0070678_100092562
573 Ga0070678_100488448
574 Ga0070678_100677513
575 Ga0070678_100841123
576 Ga0070662_100110820
577 Ga0070662_100534830
578 Ga0070681_10170552
579 Ga0070681_10271016
580 Ga0068867_100193844
581 Ga0070685_10109996
582 Ga0070706_100001825
583 Ga0070707_100316859
584 Ga0070698_100080835
585 Ga0070698_100415008
586 Ga0070698_100876459
587 Ga0068853_101000738
588 Ga0068853_101060733
589 Ga0070672_100127530
590 Ga0070672_100167156
591 Ga0070672_101105952
592 Ga0070695_100211767
593 Ga0070693_100126342
594 Ga0070665_100251382
595 Ga0070665_100321391
596 Ga0070664_100895893
597 Ga0070664_101173520
598 Ga0068854_100510283
599 Ga0068854_101052736
600 Ga0068852_100086589
601 Ga0068852_100765735
602 Ga0068864_100026836
603 Ga0068864_100699867
604 Ga0068866_10069390
605 Ga0068861_100098149
606 Ga0068861_100332538
607 Ga0068861_101553532
608 Ga0068863_100124908
609 Ga0068863_100176508
610 Ga0068863_102434793
611 Ga0068858_100001491
612 Ga0068858_100447831
613 Ga0068860_100248482
614 Ga0068860_100342294
615 Ga0068860_100413067
616 Ga0068860_101636485
617 Ga0068860_101809076
618 Ga0081455_10109127
619 Ga0081540_1153947
620 Ga0081540_1171255
621 Ga0081540_1197579
622 Ga0081539_10076244
623 Ga0081539_10130277
624 Ga0070717_10247367
625 Ga0075368_10363146
626 Ga0075432_10337857
627 Ga0070715_10586268
628 Ga0075362_10269806
629 Ga0075367_10004522
630 Ga0075369_10314348
631 Ga0075366_10023723
632 Ga0097621_100271379
633 Ga0097621_100541989
634 Ga0075370_10010656
635 Ga0068871_100043510
636 Ga0068871_100276589
637 Ga0068871_101138652
638 Ga0068871_101140435
639 Ga0075428_100099045
640 Ga0075428_100667128
641 Ga0075430_100069054
642 Ga0075430_100225490
643 Ga0075430_100784012
644 Ga0075431_100468010
645 Ga0075431_100646476
646 Ga0075433_10321115
647 Ga0075433_10947366
648 Ga0075434_100128033
649 Ga0075434_100751720
650 Ga0075434_100764426
651 Ga0075429_100002105
652 Ga0075429_100105845
653 Ga0075429_100136402
654 Ga0075436_100066553
655 Ga0075436_100085515
656 Ga0075435_100046546
657 Ga0111539_10009229
658 Ga0111539_10581874
659 Ga0111539_10746091
660 Ga0105245_10348968
661 Ga0114129_10205979
662 Ga0114129_10454274
663 Ga0114129_11042300
664 Ga0114129_11947779
665 Ga0105243_11736554
666 Ga0105243_12172686
667 Ga0105243_12599831
668 Ga0105243_12839809
669 Ga0105242_10435933
670 Ga0105242_10453050
671 Ga0105248_10006873
672 Ga0105248_10023404
673 Ga0105248_10277532
674 Ga0105248_10432041
675 Ga0105248_11428276
676 Ga0105248_11711678
677 Ga0105238_11968753
678 Ga0105249_10211616
679 Ga0105249_11275078
680 Ga0105239_10449738
681 Ga0105239_10464983
682 Ga0157326_1056419
683 Ga0157374_10129086
684 Ga0157378_10064837
685 Ga0157378_13279232
686 Ga0163162_10027568
687 Ga0163162_11875808
688 Ga0163162_12195470
689 Ga0157375_10049708
690 Ga0157375_10239774
691 Ga0157375_10611943
692 Ga0157375_10788608
693 Ga0157375_11222440
694 Ga0163163_10072304
695 Ga0157380_11033677
696 Ga0157380_12436083
697 Ga0157377_10291387
698 Ga0157377_10638000
699 Ga0157379_10121300
700 Ga0157379_10243225
701 Ga0157376_10269325
702 Ga0157376_10589949
703 Ga0157376_13090587
704 Ga0163161_10135383
705 Ga0163161_10623337
706 Ga0163161_11029825
707 Ga0206354_11619921
708 Ga0213876_10760293
709 Ga0213875_10001156
710 Ga0209257_1017993
711 Ga0207656_10340748
712 Ga0207682_10006965
713 Ga0207682_10118665
714 Ga0207642_10023036
715 Ga0207680_10117076
716 Ga0207685_10533993
717 Ga0207685_10709422
718 Ga0207645_10098185
719 Ga0207643_10222779
720 Ga0207684_10012679
721 Ga0207654_10393795
722 Ga0207707_10563896
723 Ga0207707_10863421
724 Ga0207693_10029437
725 Ga0207662_10039202
726 Ga0207662_10506596
727 Ga0207649_10208863
728 Ga0207652_10734100
729 Ga0207681_10099802
730 Ga0207681_10687697
731 Ga0207650_10053215
732 Ga0207650_10107363
733 Ga0207659_10002348
734 Ga0207659_10141618
735 Ga0207659_10948778
736 Ga0207644_11662431
737 Ga0207690_10529029
738 Ga0207706_10137355
739 Ga0207706_10269782
740 Ga0207706_10405557
741 Ga0207686_10055492
742 Ga0207709_10037819
743 Ga0207709_10616127
744 Ga0207669_10105751
745 Ga0207704_10732166
746 Ga0207691_10153442
747 Ga0207691_10605210
748 Ga0207711_10038008
749 Ga0207711_10396267
750 Ga0207711_10729140
751 Ga0207711_10862819
752 Ga0207689_10012694
753 Ga0207661_11399874
754 Ga0207679_10850173
755 Ga0207651_10002333
756 Ga0207651_10196178
757 Ga0207712_10376363
758 Ga0207668_10111053
759 Ga0207640_10547273
760 Ga0207658_10010134
761 Ga0207658_10191330
762 Ga0207658_10386356
763 Ga0207658_10718683
764 Ga0207658_10719759
765 Ga0207658_11585524
766 Ga0207658_11995670
767 Ga0207677_10104901
768 Ga0207703_10004681
769 Ga0207703_11922908
770 Ga0207639_10198036
771 Ga0207678_10115653
772 Ga0207708_10112521
773 Ga0207708_10141520
774 Ga0207708_10307074
775 Ga0207708_10315466
776 Ga0207708_10820973
777 Ga0207641_10024266
778 Ga0207641_12049305
779 Ga0207648_10193842
780 Ga0207648_10256461
781 Ga0207648_10306293
782 Ga0207676_10002643
783 Ga0207676_10390597
784 Ga0207676_10673177
785 Ga0207675_100123211
786 Ga0207675_100123470
787 Ga0207675_100226104
788 Ga0207675_101084752
789 Ga0207683_10029725
790 Ga0207683_10037515
791 Ga0207698_10800604
792 Ga0207698_11838730
793 Ga0207428_11191616
794 Ga0268266_10152993
795 Ga0268266_10266412
796 Ga0268265_10132292
797 Ga0268264_10384805
798 Ga0268264_10503895
799 Ga0268264_11150246
800 Ga0265337_1002058
801 Ga0265322_10135415
802 Ga0307517_10003242
803 Ga0307517_10031397
804 Ga0307517_10219374
805 Ga0307515_10020398
806 Ga0307515_10203111
807 Ga0307515_10789255
808 Ga0265338_10506172
809 Ga0307512_10303972
810 Ga0265340_10280704
811 Ga0265327_10241025
812 Ga0307513_10138092
813 Ga0307513_10204584
814 Ga0307513_10442962
815 Ga0307513_10824354
816 Ga0307509_10011769
817 Ga0307509_10061405
818 Ga0307509_10144352
819 Ga0307509_10238741
820 Ga0307509_10249437
821 Ga0307408_100296546
822 Ga0307508_10000028
823 Ga0307508_10001494
824 Ga0307508_10084591
825 Ga0307508_10090171
826 Ga0307508_10183549
827 Ga0307508_10424636
828 Ga0307514_10034183
829 Ga0307514_10200893
830 Ga0265314_10007585
831 Ga0307516_10001972
832 Ga0307516_10008523
833 Ga0307516_10141690
834 Ga0307405_10253902
835 Ga0307406_10136257
836 Ga0307406_10742459
837 Ga0307412_10625285
838 Ga0307409_100527420
839 Ga0307409_101884431
840 Ga0307416_100337055
841 Ga0307416_100421979
842 Ga0307416_102694861
843 Ga0307414_10374694
844 Ga0307414_12328952
845 Ga0307411_11286481
846 Ga0307507_10130849
847 Ga0307507_10301735
848 Ga0307510_10143253
849 Ga0307510_10167684
850 Ga0307510_10178141
851 Ga0373959_0142517
852 Ga0373928_0133745
853 Ga0373952_0035993
854 Ga0373939_0151732
855 Ga0373941_0407957
856 Ga0373945_0113780
857 Ga0373945_0157610
858 Ga0373960_0036932
859 Ga0373943_0761713
860 Ga0373946_0073438
861 Ga0373961_0128031
862 Ga0373931_0073394
863 Ga0373927_0052202
864 Ga0373927_0492175
865 Ga0373927_0644682
866 Ga0373927_1041042
867 Ga0373933_0300626
868 Ga0373947_0239676
869 Ga0373947_0664265
870 Ga0373925_0209758
871 Ga0373925_0608284
872 Ga0373925_1268496
873 Ga0436364_0382047
874 Ga0436365_0805120
875 Ga0436365_1918854
876 Ga0436365_1924540
877 Ga0436360_0610658
878 Ga0436361_0885027
879 Ga0439465_0016814
880 Ga0439465_0158003
881 Ga0439465_0392462
882 Ga0451853_4095136
883 Ga0451577_1487455
884 Ga0453684_2505444
885 Ga0451576_2560407
886 Ga0495592_0003197
887 Ga0495629_0071739
888 Ga0495629_0138809
889 Ga0495629_0413365
890 Ga0495629_0549873
891 Ga0495638_0292215
892 Ga0495638_0388548
893 Ga0495605_0242335
894 Ga0495664_0307751
895 Ga0495585_0526332
896 Ga0495620_0014834
897 Ga0495628_0003761
898 Ga0495630_0137475
899 Ga0495632_0023136
900 Ga0495643_0380731
901 Ga0495648_0165713
902 Ga0495666_0244756
903 Ga0495642_0077828
904 Ga0495642_0139154
905 Ga0495652_0004307
906 Ga0495586_0212621
907 Ga0495587_0145445
908 Ga0495598_0100529
909 Ga0495598_0405343
910 Ga0495645_0000291
911 Ga0495645_0623269
912 Ga0495622_0147486
913 Ga0495656_0114647
914 Ga0495668_0467214
915 Ga0495599_0000245
916 Ga0495647_0050269
917 Ga0495647_0142234
918 Ga0495658_0138006
919 Ga0495658_0829797
920 Ga0495658_0946367
921 Ga0495613_0423115
922 Ga0495613_0860389
923 Ga0495624_0390814
924 Ga0495670_0257133
925 Ga0495660_0252359
926 Ga0495674_1048774
927 Ga0495676_0047900
928 Ga0495676_0765192
929 Ga0495687_031664
930 Ga0495673_0363027
931 Ga0495686_0150603
932 Ga0495593_0186164
933 Ga0495593_0396692
934 Ga0496100_0331361
935 Ga0496100_1567944
936 Ga0496101_0136945
937 Ga0496101_0737977
938 Ga0496102_0188147
939 Ga0496104_0005692
940 Ga0496104_0332233
941 Ga0496104_0415083
942 Ga0496105_0031452
943 Ga0496106_0014751
944 Ga0496106_0066317
945 Ga0496106_0134738
946 Ga0496107_0044804
947 Ga0496108_0084786
948 Ga0496108_0126383
949 Ga0496109_0060092
950 Ga0496109_0070026
951 Ga0496110_0218787
952 Ga0496110_0260447
953 Ga0496110_0912950
954 Ga0496111_0149763
955 Ga0496112_0045510
956 Ga0496113_0316650
957 Ga0496114_0454455
958 Ga0496114_0470793
959 Ga0496114_1334141
960 Ga0496115_0003236
961 Ga0496115_0882269
962 Ga0496115_1302384
963 Ga0496121_0434825
964 Ga0501292_013792
965 Ga0501036_0841957
966 Ga0501072_1108805
967 Ga0501073_0518683
968 Ga0501073_0630227
969 Ga0501073_0795854
970 Ga0501077_1055283
971 Ga0501206_010588
972 Ga0501257_127485
973 Ga0501262_030681
974 Ga0501265_007110
975 Ga0501273_026708
976 Ga0501281_03487
977 nmdc:mga0k408_150168_c1
978 nmdc:mga0k408_25675_c1
979 nmdc:mga0k408_410172_c1
980 nmdc:mga06z11_53167_c1
981 nmdc:mga04h51_159569_c1
982 nmdc:mga07m45_60323_c1
983 nmdc:mga05p37_1057915_c1
984 nmdc:mga05p37_1379781_c1
985 nmdc:mga05p37_230932_c1
986 nmdc:mga05p37_691751_c1
987 nmdc:mga09592_136261_c1
988 nmdc:mga09592_165401_c1
989 nmdc:mga09592_18972_c1
990 nmdc:mga0qj67_220531_c1
991 nmdc:mga0qj67_36305_c1
992 nmdc:mga06r32_31289_c1
993 nmdc:mga06r32_391772_c1
994 nmdc:mga08y16_416069_c1
995 nmdc:mga08y16_89461_c1
996 nmdc:mga0n895_119964_c1
997 nmdc:mga0n895_418621_c1
998 nmdc:mga0n895_54156_c1
999 nmdc:mga0rr50_167668_c1
1000 nmdc:mga0rr50_362401_c1
1001 nmdc:mga08x19_167032_c1
1002 nmdc:mga08x19_45393_c1
1003 nmdc:mga0a205_120788_c1
1004 nmdc:mga0a205_612365_c1
1005 nmdc:mga0sz30_210294_c1
1006 Ga0500578_0017684
1007 Ga0500644_0001913
1008 Ga0500644_0040632
1009 Ga0500651_0085062
1010 Ga0500562_014001
1011 Ga0500593_195696
1012 Ga0500594_0057184
1013 Ga0500621_260855
1014 Ga0500655_028403
1015 Ga0500561_0057733
1016 Ga0500568_0055893
1017 Ga0500586_029554
1018 Ga0500622_0008466
1019 Ga0500636_0044331
1020 Ga0500636_0284305
1021 Ga0500645_005748
1022 Ga0500587_002482
1023 Ga0500661_041863
1024 Ga0501082_1365219
1025 Ga0530510_0499976
1026 2828307174
1027 2871480012
1028 2878789946
1029 2885315497
1030 2888347631
1031 2894416541
1032 2924760245
1033 2958077699
1034 2970542803
1035 8004401458
1036 8004637164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

12

112

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9265 2 105
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9151 2 106
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9043 1 106
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8957 1 106
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8917 2 105
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9043 1 106 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8957 1 106 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8194 4 106 2.60.40.2470
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8057 1 104 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8026 5 106 2.60.40.730
ID Description Score Start End GO Terms
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.8983 41 106
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.8861 41 106
AF-A0A059FXN1-F1-model_v4 Putative sulfur oxidation protein SoxZ 0.8835 1 106
AF-A0A7V8ISW7-F1-model_v4 deleted 0.8827 1 106
AF-V6F1C0-F1-model_v4 Sulfur oxidation protein (SoxZ) 0.8823 1 106

Map