F458221

General Info

Members Datasets Scaffolds Average Seq Length
518 256 518 297

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100107321|Ga0070694_1001073212
Length 295
Sequence MERMKASDFPKEVLKLFDGYVHGGLSRRQFLDRAAQYAVGGFSAAAMLQALSPNFAWAQQVAKDDKRIRTEYLTYPSPQGSGTMKGYFARPAKAGKLPGVVVIHENRGLNPYVEDVARRLAVEGYVAFAPDALTPVGGYPGDEDKARALFAKQDPQKRIEDLVTGANFLKTHADCNGKLGAVGFCFGGGICNLLAVRMPDLAASVPYYGRQVTAEETAKIKTPLLIHYAETDENINKGWPAYETALKANGVKYQAHFYPGTQHGFHNDTTPRYDEAAAKLSWSRTLAFFKEQLRG

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 3.67
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001997 3300001991 Bacteria 2981
2 JGI24749J21850_1000496 3300002076 Bacteria 5820
3 JGI24751J29686_10002958 3300002459 Bacteria 3426
4 Ga0065707_10197786 3300005295 Bacteria 1326
5 Ga0070658_10263886 3300005327 Bacteria 1463
6 Ga0070676_10001973 3300005328 Bacteria 10422
7 Ga0070676_10045201 3300005328 Bacteria 2564
8 Ga0070676_10095523 3300005328 Bacteria 1828
9 Ga0070683_100007707 3300005329 Bacteria 9114
10 Ga0070683_100064369 3300005329 Bacteria 3413
11 Ga0070683_100122121 3300005329 Bacteria 2461
12 Ga0070690_100072155 3300005330 Bacteria 2244
13 Ga0070670_100029034 3300005331 Bacteria 4760
14 Ga0070670_100055133 3300005331 Bacteria 3412
15 Ga0070670_100056352 3300005331 Bacteria 3373
16 Ga0070670_100140246 3300005331 Bacteria 2090
17 Ga0070670_100523586 3300005331 Bacteria 1056
18 Ga0070677_10009558 3300005333 Bacteria 3293
19 Ga0070677_10102605 3300005333 Bacteria 1264
20 Ga0068869_100002677 3300005334 Bacteria 10767
21 Ga0070666_10006948 3300005335 Bacteria 6975
22 Ga0070666_10064120 3300005335 Bacteria 2491
23 Ga0068868_100027244 3300005338 Bacteria 4360
24 Ga0068868_100081637 3300005338 Bacteria 2592
25 Ga0068868_100088059 3300005338 Bacteria 2498
26 Ga0068868_100159086 3300005338 Bacteria 1864
27 Ga0070660_100005516 3300005339 Bacteria 8762
28 Ga0070660_100071502 3300005339 Bacteria 2709
29 Ga0070689_100037116 3300005340 Bacteria 3726
30 Ga0070689_100044224 3300005340 Bacteria 3425
31 Ga0070689_100045619 3300005340 Bacteria 3375
32 Ga0070689_100062583 3300005340 Bacteria 2896
33 Ga0070687_100014374 3300005343 Bacteria 3555
34 Ga0070661_100015619 3300005344 Bacteria 5360
35 Ga0070661_100025038 3300005344 Bacteria 4285
36 Ga0070661_100030813 3300005344 Bacteria 3876
37 Ga0070661_100110159 3300005344 Bacteria 2055
38 Ga0070661_100203963 3300005344 Bacteria 1512
39 Ga0070692_10016568 3300005345 Bacteria 3506
40 Ga0070668_100028697 3300005347 Bacteria 4222
41 Ga0070668_100271671 3300005347 Bacteria 1413
42 Ga0070669_100007628 3300005353 Bacteria 7733
43 Ga0070669_100033836 3300005353 Bacteria 3698
44 Ga0070669_100056361 3300005353 Bacteria 2881
45 Ga0070675_100017344 3300005354 Bacteria 5720
46 Ga0070675_100268016 3300005354 Bacteria 1498
47 Ga0070671_100019452 3300005355 Bacteria 5526
48 Ga0070671_100066062 3300005355 Bacteria 3014
49 Ga0070671_100116629 3300005355 Bacteria 2245
50 Ga0070671_100223504 3300005355 Bacteria 1597
51 Ga0070674_100051554 3300005356 Bacteria 2836
52 Ga0070674_100331346 3300005356 Bacteria 1223
53 Ga0070673_100003126 3300005364 Bacteria 10246
54 Ga0070673_100084877 3300005364 Bacteria 2576
55 Ga0070673_100153696 3300005364 Bacteria 1951
56 Ga0070673_100167073 3300005364 Bacteria 1875
57 Ga0070688_100225551 3300005365 Bacteria 1323
58 Ga0070659_100141681 3300005366 Bacteria 1957
59 Ga0070667_100013875 3300005367 Bacteria 6660
60 Ga0070667_100045252 3300005367 Bacteria 3699
61 Ga0070667_100353659 3300005367 Bacteria 1330
62 Ga0070703_10015772 3300005406 Bacteria 2164
63 Ga0070709_10039117 3300005434 Bacteria 2909
64 Ga0070701_10018775 3300005438 Bacteria 3255
65 Ga0070711_100083108 3300005439 Bacteria 2287
66 Ga0070711_100092488 3300005439 Bacteria 2182
67 Ga0070705_100080208 3300005440 Bacteria 2001
68 Ga0070700_100011130 3300005441 Bacteria 4978
69 Ga0070700_100120021 3300005441 Bacteria 1760
70 Ga0070694_100107321 3300005444 Bacteria 1984
71 Ga0070708_100010598 3300005445 Bacteria 7474
72 Ga0070708_100075572 3300005445 Bacteria 3041
73 Ga0070663_100009318 3300005455 Bacteria 6076
74 Ga0070663_100053759 3300005455 Bacteria 2876
75 Ga0070663_100108030 3300005455 Bacteria 2086
76 Ga0070678_100010924 3300005456 Bacteria 5573
77 Ga0070678_100015974 3300005456 Bacteria 4785
78 Ga0070678_100252636 3300005456 Bacteria 1479
79 Ga0070662_100001538 3300005457 Bacteria 14231
80 Ga0070662_100201825 3300005457 Bacteria 1578
81 Ga0070681_10009179 3300005458 Bacteria 9720
82 Ga0070681_10087916 3300005458 Bacteria 3060
83 Ga0070681_10128557 3300005458 Bacteria 2466
84 Ga0068867_100002262 3300005459 Bacteria 13543
85 Ga0068867_100021145 3300005459 Bacteria 4641
86 Ga0068867_100053736 3300005459 Bacteria 2975
87 Ga0068867_100061698 3300005459 Bacteria 2784
88 Ga0068867_100182078 3300005459 Bacteria 1671
89 Ga0070685_10008952 3300005466 Bacteria 5162
90 Ga0070685_10080998 3300005466 Bacteria 1946
91 Ga0070706_100043416 3300005467 Bacteria 4154
92 Ga0070706_100119870 3300005467 Bacteria 2452
93 Ga0070706_100277337 3300005467 Bacteria 1564
94 Ga0070706_100546310 3300005467 Bacteria 1078
95 Ga0070707_100081385 3300005468 Bacteria 3126
96 Ga0070707_100245053 3300005468 Bacteria 1744
97 Ga0070707_100245811 3300005468 Bacteria 1741
98 Ga0070707_100616330 3300005468 Bacteria 1048
99 Ga0070698_100014299 3300005471 Bacteria 8390
100 Ga0070698_100335458 3300005471 Bacteria 1443
101 Ga0070699_100292685 3300005518 Bacteria 1460
102 Ga0070679_100346302 3300005530 Bacteria 1434
103 Ga0070684_100017719 3300005535 Bacteria 5854
104 Ga0070684_100022209 3300005535 Bacteria 5288
105 Ga0070684_100101680 3300005535 Bacteria 2568
106 Ga0070697_100016843 3300005536 Bacteria 5746
107 Ga0070697_100416370 3300005536 Bacteria 1167
108 Ga0068853_100008601 3300005539 Bacteria 8206
109 Ga0068853_100361680 3300005539 Bacteria 1352
110 Ga0070672_100005661 3300005543 Bacteria 8318
111 Ga0070672_100005903 3300005543 Bacteria 8168
112 Ga0070672_100147462 3300005543 Bacteria 1945
113 Ga0070672_100293751 3300005543 Bacteria 1376
114 Ga0070686_100034922 3300005544 Bacteria 3102
115 Ga0070665_100016144 3300005548 Bacteria 7495
116 Ga0070704_100041142 3300005549 Bacteria 3187
117 Ga0070704_100083912 3300005549 Bacteria 2353
118 Ga0070704_100117865 3300005549 Bacteria 2033
119 Ga0068855_100004131 3300005563 Bacteria 17708
120 Ga0068855_100004182 3300005563 Bacteria 17611
121 Ga0068855_100023969 3300005563 Bacteria 7305
122 Ga0070664_100010202 3300005564 Bacteria 7618
123 Ga0070664_100062784 3300005564 Bacteria 3168
124 Ga0070664_100067190 3300005564 Bacteria 3064
125 Ga0070664_100092612 3300005564 Bacteria 2617
126 Ga0070664_100125929 3300005564 Bacteria 2247
127 Ga0070664_100163725 3300005564 Bacteria 1969
128 Ga0068857_100013371 3300005577 Bacteria 7149
129 Ga0068857_100066901 3300005577 Bacteria 3198
130 Ga0068854_100032128 3300005578 Bacteria 3650
131 Ga0068854_100384753 3300005578 Bacteria 1157
132 Ga0068856_100000746 3300005614 Bacteria 35249
133 Ga0068852_100003039 3300005616 Bacteria 11673
134 Ga0068852_100133547 3300005616 Bacteria 2288
135 Ga0068852_100167008 3300005616 Bacteria 2060
136 Ga0068852_100308824 3300005616 Bacteria 1533
137 Ga0068859_100013015 3300005617 Bacteria 8357
138 Ga0068859_100027699 3300005617 Bacteria 5683
139 Ga0068859_100654517 3300005617 Bacteria 1142
140 Ga0068864_100006588 3300005618 Bacteria 9505
141 Ga0068864_100014275 3300005618 Bacteria 6596
142 Ga0068866_10023866 3300005718 Bacteria 2850
143 Ga0068866_10047452 3300005718 Bacteria 2166
144 Ga0068866_10101730 3300005718 Bacteria 1586
145 Ga0068861_100009473 3300005719 Bacteria 6725
146 Ga0068861_100140355 3300005719 Bacteria 1971
147 Ga0068851_10010102 3300005834 Bacteria 4398
148 Ga0068851_10047706 3300005834 Bacteria 2170
149 Ga0068851_10144772 3300005834 Bacteria 1295
150 Ga0068870_10003596 3300005840 Bacteria 6579
151 Ga0068870_10107769 3300005840 Bacteria 1585
152 Ga0068863_100016845 3300005841 Bacteria 7009
153 Ga0068863_100062542 3300005841 Bacteria 3520
154 Ga0068863_100295024 3300005841 Bacteria 1572
155 Ga0068863_100435424 3300005841 Bacteria 1285
156 Ga0068858_100001192 3300005842 Bacteria 26912
157 Ga0068858_100017451 3300005842 Bacteria 6732
158 Ga0068858_100029593 3300005842 Bacteria 5086
159 Ga0068860_100007115 3300005843 Bacteria 11194
160 Ga0068860_100090775 3300005843 Bacteria 2910
161 Ga0068860_100096601 3300005843 Bacteria 2816
162 Ga0068862_100101350 3300005844 Bacteria 2519
163 Ga0068862_100145720 3300005844 Bacteria 2104
164 Ga0081540_1000042 3300005983 Bacteria 134801
165 Ga0097621_100014800 3300006237 Bacteria 5849
166 Ga0097621_100074533 3300006237 Bacteria 2811
167 Ga0097621_100091943 3300006237 Bacteria 2540
168 Ga0097621_100126205 3300006237 Bacteria 2174
169 Ga0097621_100308122 3300006237 Bacteria 1400
170 Ga0068871_100019474 3300006358 Bacteria 5182
171 Ga0068871_100102702 3300006358 Bacteria 2396
172 Ga0068871_100205022 3300006358 Bacteria 1704
173 Ga0075428_100145291 3300006844 Bacteria 2578
174 Ga0075430_100105751 3300006846 Bacteria 2348
175 Ga0075431_100006092 3300006847 Bacteria 11956
176 Ga0075431_100028888 3300006847 Bacteria 5702
177 Ga0075433_10017261 3300006852 Bacteria 5975
178 Ga0075433_10063668 3300006852 Bacteria 3232
179 Ga0075434_100488086 3300006871 Bacteria 1253
180 Ga0075429_100028668 3300006880 Bacteria 4834
181 Ga0068865_100004601 3300006881 Bacteria 8329
182 Ga0068865_100114536 3300006881 Bacteria 1994
183 Ga0097620_100013015 3300006931 Bacteria 8357
184 Ga0097620_100027696 3300006931 Bacteria 5683
185 Ga0097620_100654545 3300006931 Bacteria 1142
186 Ga0075435_100024026 3300007076 Bacteria 4723
187 Ga0075435_100055343 3300007076 Bacteria 3204
188 Ga0075435_100256373 3300007076 Bacteria 1490
189 Ga0099794_10016914 3300007265 Bacteria 3242
190 Ga0099794_10058196 3300007265 Bacteria 1873
191 Ga0105244_10008828 3300009036 Bacteria 6258
192 Ga0111539_10085890 3300009094 Bacteria 3698
193 Ga0111539_10169231 3300009094 Bacteria 2553
194 Ga0111539_10341965 3300009094 Bacteria 1742
195 Ga0105245_10108478 3300009098 Bacteria 2578
196 Ga0105245_10212119 3300009098 Bacteria 1864
197 Ga0114129_10000222 3300009147 Bacteria 63223
198 Ga0114129_10014457 3300009147 Bacteria 11247
199 Ga0105243_10013583 3300009148 Bacteria 6161
200 Ga0105243_10069879 3300009148 Bacteria 2834
201 Ga0105241_10046557 3300009174 Bacteria 3294
202 Ga0105248_10003625 3300009177 Bacteria 17136
203 Ga0105248_10304621 3300009177 Bacteria 1794
204 Ga0105248_10368127 3300009177 Bacteria 1618
205 Ga0105237_10264485 3300009545 Bacteria 1723
206 Ga0105238_10217020 3300009551 Bacteria 1889
207 Ga0105238_10397099 3300009551 Bacteria 1372
208 Ga0105249_10034990 3300009553 Bacteria 4553
209 Ga0105249_10065701 3300009553 Bacteria 3338
210 Ga0105239_10190588 3300010375 Bacteria 2295
211 Ga0105239_10328954 3300010375 Bacteria 1724
212 Ga0105246_10207978 3300011119 Bacteria 1525
213 Ga0157373_10004302 3300013100 Bacteria 10723
214 Ga0157373_10004442 3300013100 Bacteria 10565
215 Ga0157371_10001640 3300013102 Bacteria 22899
216 Ga0157371_10001710 3300013102 Bacteria 22337
217 Ga0157371_10025809 3300013102 Bacteria 4277
218 Ga0157370_10114837 3300013104 Bacteria 2515
219 Ga0157369_10039334 3300013105 Bacteria 5168
220 Ga0157369_10075247 3300013105 Bacteria 3621
221 Ga0157369_10330831 3300013105 Bacteria 1583
222 Ga0157374_10010788 3300013296 Bacteria 7878
223 Ga0157374_10015424 3300013296 Bacteria 6702
224 Ga0157378_10188709 3300013297 Bacteria 1943
225 Ga0157378_10207287 3300013297 Bacteria 1857
226 Ga0157378_10306951 3300013297 Bacteria 1538
227 Ga0157378_10389390 3300013297 Bacteria 1371
228 Ga0163162_10021274 3300013306 Bacteria 6384
229 Ga0163162_10272613 3300013306 Bacteria 1824
230 Ga0157372_10022097 3300013307 Bacteria 6881
231 Ga0157372_10270770 3300013307 Bacteria 1973
232 Ga0157375_10014243 3300013308 Bacteria 7087
233 Ga0157375_10352542 3300013308 Bacteria 1637
234 Ga0157375_10535431 3300013308 Bacteria 1334
235 Ga0163163_10143347 3300014325 Bacteria 2432
236 Ga0157380_10047569 3300014326 Bacteria 3375
237 Ga0157380_10233779 3300014326 Bacteria 1653
238 Ga0157377_10006467 3300014745 Bacteria 5593
239 Ga0157379_10003933 3300014968 Bacteria 12661
240 Ga0157379_10006259 3300014968 Bacteria 10249
241 Ga0157379_10037415 3300014968 Bacteria 4327
242 Ga0157379_10098858 3300014968 Bacteria 2619
243 Ga0157376_10300644 3300014969 Bacteria 1519
244 Ga0163161_10019409 3300017792 Bacteria 4769
245 Ga0207697_10000857 3300025315 Bacteria 17209
246 Ga0207656_10003924 3300025321 Bacteria 5148
247 Ga0207713_1044229 3300025735 Bacteria 1831
248 Ga0207682_10004209 3300025893 Bacteria 6078
249 Ga0207682_10029170 3300025893 Bacteria 2205
250 Ga0207688_10001485 3300025901 Bacteria 12291
251 Ga0207680_10121254 3300025903 Bacteria 1710
252 Ga0207680_10129343 3300025903 Bacteria 1662
253 Ga0207647_10085388 3300025904 Bacteria 1888
254 Ga0207645_10000812 3300025907 Bacteria 26130
255 Ga0207645_10005560 3300025907 Bacteria 9125
256 Ga0207645_10051188 3300025907 Bacteria 2639
257 Ga0207643_10000681 3300025908 Bacteria 21214
258 Ga0207684_10086706 3300025910 Bacteria 2666
259 Ga0207684_10143251 3300025910 Bacteria 2055
260 Ga0207707_10048808 3300025912 Bacteria 3687
261 Ga0207707_10154276 3300025912 Bacteria 2008
262 Ga0207707_10175624 3300025912 Bacteria 1871
263 Ga0207662_10012687 3300025918 Bacteria 4697
264 Ga0207662_10043571 3300025918 Bacteria 2648
265 Ga0207662_10101869 3300025918 Bacteria 1780
266 Ga0207657_10008928 3300025919 Bacteria 10128
267 Ga0207657_10020575 3300025919 Bacteria 6231
268 Ga0207649_10005496 3300025920 Bacteria 6859
269 Ga0207649_10026742 3300025920 Bacteria 3378
270 Ga0207649_10046056 3300025920 Bacteria 2677
271 Ga0207652_10027507 3300025921 Bacteria 4738
272 Ga0207652_10256694 3300025921 Bacteria 1577
273 Ga0207646_10068968 3300025922 Bacteria 3158
274 Ga0207646_10357938 3300025922 Bacteria 1318
275 Ga0207681_10021713 3300025923 Bacteria 4085
276 Ga0207681_10028621 3300025923 Bacteria 3610
277 Ga0207650_10015326 3300025925 Bacteria 5336
278 Ga0207650_10027987 3300025925 Bacteria 4039
279 Ga0207650_10038875 3300025925 Bacteria 3477
280 Ga0207659_10006549 3300025926 Bacteria 7147
281 Ga0207659_10045079 3300025926 Bacteria 3106
282 Ga0207659_10046263 3300025926 Bacteria 3072
283 Ga0207659_10314554 3300025926 Bacteria 1290
284 Ga0207659_10333824 3300025926 Bacteria 1254
285 Ga0207687_10119540 3300025927 Bacteria 1968
286 Ga0207700_10006029 3300025928 Bacteria 7294
287 Ga0207700_10328669 3300025928 Bacteria 1327
288 Ga0207644_10018478 3300025931 Bacteria 4717
289 Ga0207644_10240068 3300025931 Bacteria 1442
290 Ga0207690_10003125 3300025932 Bacteria 9971
291 Ga0207690_10111774 3300025932 Bacteria 1969
292 Ga0207690_10132116 3300025932 Bacteria 1828
293 Ga0207706_10000149 3300025933 Bacteria 76532
294 Ga0207706_10000850 3300025933 Bacteria 31426
295 Ga0207706_10013215 3300025933 Bacteria 7511
296 Ga0207706_10060167 3300025933 Bacteria 3345
297 Ga0207706_10204818 3300025933 Bacteria 1730
298 Ga0207686_10032369 3300025934 Bacteria 3111
299 Ga0207709_10061367 3300025935 Bacteria 2349
300 Ga0207709_10120244 3300025935 Bacteria 1772
301 Ga0207709_10171263 3300025935 Bacteria 1524
302 Ga0207670_10025204 3300025936 Bacteria 3730
303 Ga0207670_10211558 3300025936 Bacteria 1479
304 Ga0207669_10013314 3300025937 Bacteria 4080
305 Ga0207669_10123533 3300025937 Bacteria 1763
306 Ga0207669_10305206 3300025937 Bacteria 1211
307 Ga0207704_10004664 3300025938 Bacteria 6282
308 Ga0207704_10285767 3300025938 Bacteria 1256
309 Ga0207691_10000041 3300025940 Bacteria 106275
310 Ga0207691_10001626 3300025940 Bacteria 22311
311 Ga0207691_10038654 3300025940 Bacteria 4416
312 Ga0207691_10099799 3300025940 Bacteria 2592
313 Ga0207691_10116259 3300025940 Bacteria 2374
314 Ga0207691_10327478 3300025940 Bacteria 1313
315 Ga0207711_10010263 3300025941 Bacteria 7778
316 Ga0207711_10016925 3300025941 Bacteria 6056
317 Ga0207689_10000307 3300025942 Bacteria 45007
318 Ga0207689_10008104 3300025942 Bacteria 9162
319 Ga0207689_10126314 3300025942 Bacteria 2104
320 Ga0207689_10174709 3300025942 Bacteria 1771
321 Ga0207661_10042079 3300025944 Bacteria 3600
322 Ga0207661_10062405 3300025944 Bacteria 3015
323 Ga0207661_10102802 3300025944 Bacteria 2403
324 Ga0207679_10000075 3300025945 Bacteria 87871
325 Ga0207679_10001327 3300025945 Bacteria 15634
326 Ga0207679_10019201 3300025945 Bacteria 4590
327 Ga0207679_10034724 3300025945 Bacteria 3561
328 Ga0207679_10088183 3300025945 Bacteria 2391
329 Ga0207679_10321048 3300025945 Bacteria 1341
330 Ga0207667_10006496 3300025949 Bacteria 14142
331 Ga0207667_10026140 3300025949 Bacteria 6382
332 Ga0207651_10127951 3300025960 Bacteria 1939
333 Ga0207651_10270028 3300025960 Bacteria 1400
334 Ga0207651_10323121 3300025960 Bacteria 1290
335 Ga0207712_10098664 3300025961 Bacteria 2167
336 Ga0207712_10411183 3300025961 Bacteria 1139
337 Ga0207668_10046114 3300025972 Bacteria 2976
338 Ga0207668_10067539 3300025972 Bacteria 2539
339 Ga0207668_10168224 3300025972 Bacteria 1716
340 Ga0207640_10257299 3300025981 Bacteria 1358
341 Ga0207658_10008526 3300025986 Bacteria 6973
342 Ga0207658_10034415 3300025986 Bacteria 3622
343 Ga0207658_10078449 3300025986 Bacteria 2523
344 Ga0207658_10138602 3300025986 Bacteria 1965
345 Ga0207677_10010131 3300026023 Bacteria 5323
346 Ga0207677_10025901 3300026023 Bacteria 3667
347 Ga0207677_10075285 3300026023 Bacteria 2398
348 Ga0207677_10401511 3300026023 Bacteria 1162
349 Ga0207677_10585935 3300026023 Bacteria 977
350 Ga0207703_10023763 3300026035 Bacteria 4821
351 Ga0207703_10062531 3300026035 Bacteria 3049
352 Ga0207639_10024964 3300026041 Bacteria 4330
353 Ga0207639_10159733 3300026041 Bacteria 1898
354 Ga0207639_10285750 3300026041 Bacteria 1452
355 Ga0207678_10005590 3300026067 Bacteria 11238
356 Ga0207678_10010277 3300026067 Bacteria 8216
357 Ga0207678_10047859 3300026067 Bacteria 3697
358 Ga0207708_10003748 3300026075 Bacteria 11200
359 Ga0207708_10003970 3300026075 Bacteria 10889
360 Ga0207708_10015274 3300026075 Bacteria 5757
361 Ga0207702_10004548 3300026078 Bacteria 12292
362 Ga0207702_10066107 3300026078 Bacteria 3098
363 Ga0207702_10346051 3300026078 Bacteria 1421
364 Ga0207641_10109114 3300026088 Bacteria 2450
365 Ga0207641_10212848 3300026088 Bacteria 1788
366 Ga0207648_10001461 3300026089 Bacteria 25990
367 Ga0207648_10006661 3300026089 Bacteria 11462
368 Ga0207648_10006882 3300026089 Bacteria 11270
369 Ga0207648_10056626 3300026089 Bacteria 3421
370 Ga0207648_10141120 3300026089 Bacteria 2123
371 Ga0207648_10453761 3300026089 Bacteria 1168
372 Ga0207676_10008580 3300026095 Bacteria 7261
373 Ga0207676_10045686 3300026095 Bacteria 3385
374 Ga0207676_10604629 3300026095 Bacteria 1053
375 Ga0207674_10010023 3300026116 Bacteria 10781
376 Ga0207674_10037794 3300026116 Bacteria 5017
377 Ga0207674_10044026 3300026116 Bacteria 4600
378 Ga0207675_100001001 3300026118 Bacteria 27952
379 Ga0207675_100084329 3300026118 Bacteria 2981
380 Ga0207683_10000011 3300026121 Bacteria 140261
381 Ga0207683_10011296 3300026121 Bacteria 7615
382 Ga0207683_10042640 3300026121 Bacteria 3963
383 Ga0207683_10116406 3300026121 Bacteria 2396
384 Ga0207683_10118734 3300026121 Bacteria 2372
385 Ga0207683_10130241 3300026121 Bacteria 2262
386 Ga0207698_10013035 3300026142 Bacteria 5470
387 Ga0207698_10219981 3300026142 Bacteria 1715
388 Ga0207698_10444283 3300026142 Bacteria 1250
389 Ga0209969_1003872 3300027360 Bacteria 2084
390 Ga0209966_1008536 3300027695 Bacteria 1821
391 Ga0209974_10000965 3300027876 Bacteria 10084
392 Ga0207428_10077837 3300027907 Bacteria 2596
393 Ga0268266_10030465 3300028379 Bacteria 4584
394 Ga0268266_10250957 3300028379 Bacteria 1636
395 Ga0268265_10183139 3300028380 Bacteria 1801
396 Ga0268264_10017182 3300028381 Bacteria 5925
397 Ga0268264_10085088 3300028381 Bacteria 2713
398 Ga0268264_10396840 3300028381 Bacteria 1325
399 Ga0268264_10537783 3300028381 Bacteria 1144
400 Ga0265318_10003772 3300028577 Bacteria 7529
401 Ga0307517_10027623 3300028786 Bacteria 6805
402 Ga0265328_10003447 3300031239 Bacteria 6988
403 Ga0265329_10004350 3300031242 Bacteria 5911
404 Ga0265339_10052324 3300031249 Bacteria 2225
405 Ga0265331_10002801 3300031250 Bacteria 11558
406 Ga0265327_10031162 3300031251 Unclassified 3001
407 Ga0265327_10039656 3300031251 Bacteria 2556
408 Ga0265316_10068930 3300031344 Bacteria 2730
409 Ga0265313_10025682 3300031595 Bacteria 3115
410 Ga0307508_10033070 3300031616 Bacteria 4670
411 Ga0265314_10004263 3300031711 Bacteria 13385
412 Ga0265342_10191856 3300031712 Bacteria 1114
413 Ga0307516_10025717 3300031730 Bacteria 5989
414 Ga0307413_10016300 3300031824 Bacteria 3835
415 Ga0307410_10135753 3300031852 Bacteria 1813
416 Ga0307406_10055994 3300031901 Bacteria 2523
417 Ga0307406_10067161 3300031901 Bacteria 2337
418 Ga0307407_10029197 3300031903 Bacteria 2959
419 Ga0307412_10013834 3300031911 Bacteria 4742
420 Ga0307409_100066993 3300031995 Bacteria 2834
421 Ga0307409_100179159 3300031995 Bacteria 1874
422 Ga0307416_100121351 3300032002 Bacteria 2330
423 Ga0307411_10186396 3300032005 Bacteria 1580
424 Ga0307411_10272399 3300032005 Bacteria 1343
425 Ga0307411_10450786 3300032005 Bacteria 1076
426 Ga0307415_100028678 3300032126 Bacteria 3545
427 Ga0373936_0000007 3300035113 Bacteria 290641
428 Ga0373943_0054012 3300035170 Bacteria 1986
429 Ga0373961_0070183 3300035241 Bacteria 1082
430 Ga0373931_0023523 3300035691 Bacteria 3112
431 Ga0373931_0183613 3300035691 Bacteria 1240
432 Ga0373931_0269215 3300035691 Bacteria 1042
433 Ga0373927_0005743 3300035695 Bacteria 8524
434 Ga0373927_0006822 3300035695 Bacteria 7771
435 Ga0373947_0262709 3300035725 Bacteria 1144
436 Ga0373947_0343031 3300035725 Bacteria 1001
437 Ga0373937_0043680 3300036401 Bacteria 4093
438 Ga0373937_0188905 3300036401 Bacteria 1935
439 Ga0373937_0287681 3300036401 Bacteria 1552
440 Ga0373925_0001090 3300037068 Bacteria 24348
441 Ga0373925_0059498 3300037068 Bacteria 2866
442 Ga0395905_0307046 3300037471 Bacteria 1475
443 Ga0451807_2371905 3300041486 Bacteria 1948
444 Ga0451851_1337042 3300041507 Bacteria 1261
445 Ga0439441_002589 3300042001 Bacteria 2566
446 Ga0439448_0010594 3300042005 Bacteria 2736
447 Ga0439446_0110842 3300042156 Bacteria 875
448 Ga0451577_0016117 3300042876 Bacteria 6929
449 Ga0451577_0342082 3300042876 Bacteria 1357
450 Ga0453684_0102721 3300044712 Bacteria 3495
451 Ga0453684_0421862 3300044712 Bacteria 1490
452 Ga0451576_0224459 3300045051 Bacteria 1962
453 Ga0451576_0358745 3300045051 Bacteria 1526
454 Ga0495580_0009283 3300046472 Bacteria 7740
455 Ga0495605_0000006 3300046474 Bacteria 361304
456 Ga0495583_0001201 3300046506 Bacteria 27777
457 Ga0495598_0028023 3300046537 Bacteria 1559
458 Ga0495621_0042336 3300046539 Bacteria 1603
459 Ga0495656_0065715 3300046615 Bacteria 1596
460 Ga0495647_0031568 3300046681 Bacteria 1971
461 Ga0495658_0066937 3300046683 Bacteria 2076
462 Ga0496100_0124362 3300048903 Bacteria 1809
463 Ga0496100_0329809 3300048903 Bacteria 1148
464 Ga0496101_0017794 3300048904 Bacteria 4823
465 Ga0496102_0033765 3300048905 Bacteria 4600
466 Ga0496103_0176331 3300048906 Bacteria 1373
467 Ga0496104_0157903 3300048907 Bacteria 2176
468 Ga0496105_0006652 3300048908 Bacteria 8897
469 Ga0496106_0000594 3300048909 Bacteria 25897
470 Ga0496106_0028362 3300048909 Bacteria 4170
471 Ga0496107_0036451 3300048910 Bacteria 3528
472 Ga0496107_0131759 3300048910 Bacteria 1846
473 Ga0496108_0011489 3300048911 Bacteria 7197
474 Ga0496109_0026238 3300048912 Bacteria 5195
475 Ga0496110_0061314 3300048913 Bacteria 3319
476 Ga0496113_0453031 3300048916 Bacteria 1031
477 Ga0496114_0018160 3300048917 Bacteria 5682
478 Ga0496114_0065095 3300048917 Bacteria 3053
479 Ga0496114_0149759 3300048917 Bacteria 2024
480 Ga0501040_0050792 3300049576 Bacteria 2837
481 Ga0501042_0014715 3300049578 Bacteria 5342
482 Ga0501048_0124786 3300049582 Bacteria 1820
483 Ga0501071_0012799 3300049587 Bacteria 5705
484 Ga0501072_0016931 3300049588 Bacteria 5601
485 Ga0501075_0010190 3300049591 Bacteria 6599
486 Ga0501076_0002204 3300049592 Bacteria 13350
487 Ga0501076_0040143 3300049592 Bacteria 3677
488 Ga0501080_0207006 3300049742 Bacteria 1799
489 Ga0501081_0018795 3300049743 Bacteria 4590
490 Ga0501035_0073569 3300049822 Bacteria 3024
491 Ga0501045_0040816 3300049824 Bacteria 3375
492 Ga0501045_0051170 3300049824 Bacteria 3015
493 nmdc:mga05p37_2369_c2 3300050507 Bacteria 10210
494 nmdc:mga05p37_619104_c1 3300050507 Bacteria 1218
495 nmdc:mga05p37_9254_c1 3300050507 Bacteria 11642
496 nmdc:mga09592_149054_c1 3300050508 Bacteria 2018
497 nmdc:mga0qj67_190680_c1 3300050509 Bacteria 1666
498 nmdc:mga0qj67_56730_c1 3300050509 Bacteria 3105
499 nmdc:mga06r32_5485_c1 3300050510 Bacteria 11422
500 nmdc:mga06r32_68038_c1 3300050510 Bacteria 3440
501 nmdc:mga0n895_55429_c1 3300050512 Bacteria 3901
502 nmdc:mga0rr50_12671_c1 3300050513 Bacteria 5460
503 nmdc:mga0rr50_67461_c1 3300050513 Bacteria 2717
504 nmdc:mga0a205_48332_c1 3300050515 Bacteria 4106
505 nmdc:mga0a205_51827_c1 3300050515 Bacteria 3962
506 Ga0500578_0106473 3300053086 Bacteria 1771
507 Ga0500641_0003285 3300053096 Bacteria 5717
508 Ga0500642_0008825 3300053130 Bacteria 3469
509 Ga0500622_0003851 3300053156 Bacteria 9754
510 Ga0501084_0013765 3300054114 Bacteria 6694
511 Ga0501084_0047604 3300054114 Bacteria 3591
512 Ga0590071_000045 3300059421 Bacteria 31970
513 Ga0590071_004445 3300059421 Bacteria 3403
514 Ga0590075_000041 3300059424 Bacteria 33435
515 Ga0590075_011037 3300059424 Bacteria 2180
516 Ga0590077_000363 3300059426 Bacteria 12745
517 Ga0590077_002897 3300059426 Bacteria 3600
518 Ga0501082_0004635 3300060353 Bacteria 11998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0110842 Ga0439446_0110842_13_786 255
2 3300005364 Ga0070673_100153696 Ga0070673_1001536962 293
3 3300005365 Ga0070688_100225551 Ga0070688_1002255512 293
4 3300005441 Ga0070700_100120021 Ga0070700_1001200211 293
5 3300005459 Ga0068867_100053736 Ga0068867_1000537361 293
6 3300005564 Ga0070664_100067190 Ga0070664_1000671903 293
7 3300005616 Ga0068852_100308824 Ga0068852_1003088241 293
8 3300013297 Ga0157378_10306951 Ga0157378_103069511 293
9 3300013306 Ga0163162_10272613 Ga0163162_102726132 293
10 3300013308 Ga0157375_10352542 Ga0157375_103525422 293
11 3300025918 Ga0207662_10043571 Ga0207662_100435712 293
12 3300025960 Ga0207651_10127951 Ga0207651_101279512 293
13 3300026089 Ga0207648_10453761 Ga0207648_104537612 293
14 3300005468 Ga0070707_100616330 Ga0070707_1006163301 294
15 3300035725 Ga0373947_0343031 Ga0373947_0343031_70_957 294
16 3300037068 Ga0373925_0001090 Ga0373925_0001090_11660_12547 294
17 3300005295 Ga0065707_10197786 Ga0065707_101977862 295
18 3300005331 Ga0070670_100055133 Ga0070670_1000551331 295
19 3300005331 Ga0070670_100523586 Ga0070670_1005235861 295
20 3300005333 Ga0070677_10102605 Ga0070677_101026052 295
21 3300005338 Ga0068868_100159086 Ga0068868_1001590862 295
22 3300005344 Ga0070661_100015619 Ga0070661_1000156193 295
23 3300005344 Ga0070661_100110159 Ga0070661_1001101592 295
24 3300005344 Ga0070661_100203963 Ga0070661_1002039632 295
25 3300005347 Ga0070668_100028697 Ga0070668_1000286973 295
26 3300005347 Ga0070668_100271671 Ga0070668_1002716712 295
27 3300005354 Ga0070675_100268016 Ga0070675_1002680162 295
28 3300005434 Ga0070709_10039117 Ga0070709_100391171 295
29 3300005444 Ga0070694_100107321 Ga0070694_1001073212 295
30 3300005455 Ga0070663_100053759 Ga0070663_1000537592 295
31 3300005456 Ga0070678_100252636 Ga0070678_1002526362 295
32 3300005459 Ga0068867_100061698 Ga0068867_1000616985 295
33 3300005535 Ga0070684_100022209 Ga0070684_1000222095 295
34 3300005543 Ga0070672_100005661 Ga0070672_1000056614 295
35 3300005549 Ga0070704_100041142 Ga0070704_1000411423 295
36 3300005564 Ga0070664_100010202 Ga0070664_1000102023 295
37 3300005564 Ga0070664_100163725 Ga0070664_1001637252 295
38 3300005577 Ga0068857_100013371 Ga0068857_1000133717 295
39 3300005616 Ga0068852_100003039 Ga0068852_1000030393 295
40 3300005834 Ga0068851_10047706 Ga0068851_100477063 295
41 3300005983 Ga0081540_1000042 Ga0081540_100004243 295
42 3300006237 Ga0097621_100126205 Ga0097621_1001262051 295
43 3300006844 Ga0075428_100145291 Ga0075428_1001452912 295
44 3300006846 Ga0075430_100105751 Ga0075430_1001057512 295
45 3300007076 Ga0075435_100256373 Ga0075435_1002563731 295
46 3300009036 Ga0105244_10008828 Ga0105244_100088282 295
47 3300009147 Ga0114129_10000222 Ga0114129_1000022212 295
48 3300009545 Ga0105237_10264485 Ga0105237_102644851 295
49 3300009551 Ga0105238_10217020 Ga0105238_102170202 295
50 3300010375 Ga0105239_10190588 Ga0105239_101905882 295
51 3300013102 Ga0157371_10001710 Ga0157371_100017107 295
52 3300013102 Ga0157371_10025809 Ga0157371_100258092 295
53 3300013105 Ga0157369_10075247 Ga0157369_100752472 295
54 3300013105 Ga0157369_10330831 Ga0157369_103308312 295
55 3300013307 Ga0157372_10270770 Ga0157372_102707701 295
56 3300013308 Ga0157375_10535431 Ga0157375_105354312 295
57 3300014968 Ga0157379_10098858 Ga0157379_100988581 295
58 3300025735 Ga0207713_1044229 Ga0207713_10442292 295
59 3300025920 Ga0207649_10005496 Ga0207649_100054964 295
60 3300025926 Ga0207659_10046263 Ga0207659_100462633 295
61 3300025928 Ga0207700_10328669 Ga0207700_103286691 295
62 3300025940 Ga0207691_10038654 Ga0207691_100386544 295
63 3300025940 Ga0207691_10099799 Ga0207691_100997993 295
64 3300025942 Ga0207689_10174709 Ga0207689_101747092 295
65 3300025945 Ga0207679_10000075 Ga0207679_1000007519 295
66 3300025945 Ga0207679_10321048 Ga0207679_103210481 295
67 3300025972 Ga0207668_10067539 Ga0207668_100675392 295
68 3300026023 Ga0207677_10075285 Ga0207677_100752852 295
69 3300026067 Ga0207678_10010277 Ga0207678_100102779 295
70 3300026078 Ga0207702_10066107 Ga0207702_100661073 295
71 3300026089 Ga0207648_10006882 Ga0207648_1000688210 295
72 3300026116 Ga0207674_10044026 Ga0207674_100440262 295
73 3300026121 Ga0207683_10116406 Ga0207683_101164062 295
74 3300026121 Ga0207683_10118734 Ga0207683_101187344 295
75 3300026142 Ga0207698_10444283 Ga0207698_104442831 295
76 3300031251 Ga0265327_10031162 Ga0265327_100311625 295
77 3300031901 Ga0307406_10067161 Ga0307406_100671612 295
78 3300031995 Ga0307409_100179159 Ga0307409_1001791592 295
79 3300032005 Ga0307411_10272399 Ga0307411_102723992 295
80 3300032005 Ga0307411_10450786 Ga0307411_104507862 295
81 3300032126 Ga0307415_100028678 Ga0307415_1000286783 295
82 3300037471 Ga0395905_0307046 Ga0395905_0307046_435_1322 295
83 3300042005 Ga0439448_0010594 Ga0439448_0010594_1833_2720 295
84 3300044712 Ga0453684_0102721 Ga0453684_0102721_81_968 295
85 3300046474 Ga0495605_0000006 Ga0495605_0000006_62741_63628 295
86 3300046506 Ga0495583_0001201 Ga0495583_0001201_350_1237 295
87 3300049742 Ga0501080_0207006 Ga0501080_0207006_505_1392 295
88 3300050507 nmdc:mga05p37_9254_c1 nmdc:mga05p37_9254_c1_5223_6110 295
89 3300050509 nmdc:mga0qj67_190680_c1 nmdc:mga0qj67_190680_c1_115_1002 295
90 3300053130 Ga0500642_0008825 Ga0500642_0008825_1213_2112 295
91 3300054114 Ga0501084_0013765 Ga0501084_0013765_4786_5673 295
92 3300054114 Ga0501084_0047604 Ga0501084_0047604_1680_2567 295
93 3300059421 Ga0590071_000045 Ga0590071_000045_23052_23951 295
94 3300059424 Ga0590075_000041 Ga0590075_000041_30030_30929 295
95 3300059426 Ga0590077_002897 Ga0590077_002897_1421_2320 295
96 3300001991 JGI24743J22301_10001997 JGI24743J22301_100019973 296
97 3300002076 JGI24749J21850_1000496 JGI24749J21850_10004964 296
98 3300002459 JGI24751J29686_10002958 JGI24751J29686_100029583 296
99 3300005327 Ga0070658_10263886 Ga0070658_102638861 296
100 3300005328 Ga0070676_10001973 Ga0070676_100019736 296
101 3300005328 Ga0070676_10045201 Ga0070676_100452012 296
102 3300005328 Ga0070676_10095523 Ga0070676_100955232 296
103 3300005329 Ga0070683_100007707 Ga0070683_1000077077 296
104 3300005329 Ga0070683_100064369 Ga0070683_1000643694 296
105 3300005329 Ga0070683_100122121 Ga0070683_1001221212 296
106 3300005330 Ga0070690_100072155 Ga0070690_1000721551 296
107 3300005331 Ga0070670_100029034 Ga0070670_1000290343 296
108 3300005331 Ga0070670_100056352 Ga0070670_1000563522 296
109 3300005331 Ga0070670_100140246 Ga0070670_1001402463 296
110 3300005333 Ga0070677_10009558 Ga0070677_100095582 296
111 3300005334 Ga0068869_100002677 Ga0068869_1000026774 296
112 3300005335 Ga0070666_10006948 Ga0070666_100069483 296
113 3300005335 Ga0070666_10064120 Ga0070666_100641202 296
114 3300005338 Ga0068868_100027244 Ga0068868_1000272442 296
115 3300005338 Ga0068868_100081637 Ga0068868_1000816372 296
116 3300005338 Ga0068868_100088059 Ga0068868_1000880592 296
117 3300005339 Ga0070660_100005516 Ga0070660_1000055165 296
118 3300005339 Ga0070660_100071502 Ga0070660_1000715023 296
119 3300005340 Ga0070689_100037116 Ga0070689_1000371162 296
120 3300005340 Ga0070689_100044224 Ga0070689_1000442244 296
121 3300005340 Ga0070689_100045619 Ga0070689_1000456193 296
122 3300005340 Ga0070689_100062583 Ga0070689_1000625832 296
123 3300005343 Ga0070687_100014374 Ga0070687_1000143742 296
124 3300005344 Ga0070661_100025038 Ga0070661_1000250383 296
125 3300005344 Ga0070661_100030813 Ga0070661_1000308132 296
126 3300005345 Ga0070692_10016568 Ga0070692_100165683 296
127 3300005353 Ga0070669_100007628 Ga0070669_1000076284 296
128 3300005353 Ga0070669_100033836 Ga0070669_1000338362 296
129 3300005353 Ga0070669_100056361 Ga0070669_1000563613 296
130 3300005354 Ga0070675_100017344 Ga0070675_1000173444 296
131 3300005355 Ga0070671_100019452 Ga0070671_1000194523 296
132 3300005355 Ga0070671_100066062 Ga0070671_1000660623 296
133 3300005355 Ga0070671_100116629 Ga0070671_1001166292 296
134 3300005355 Ga0070671_100223504 Ga0070671_1002235042 296
135 3300005356 Ga0070674_100051554 Ga0070674_1000515542 296
136 3300005356 Ga0070674_100331346 Ga0070674_1003313461 296
137 3300005364 Ga0070673_100003126 Ga0070673_1000031265 296
138 3300005364 Ga0070673_100084877 Ga0070673_1000848772 296
139 3300005364 Ga0070673_100167073 Ga0070673_1001670733 296
140 3300005366 Ga0070659_100141681 Ga0070659_1001416812 296
141 3300005367 Ga0070667_100013875 Ga0070667_1000138752 296
142 3300005367 Ga0070667_100045252 Ga0070667_1000452522 296
143 3300005367 Ga0070667_100353659 Ga0070667_1003536592 296
144 3300005406 Ga0070703_10015772 Ga0070703_100157721 296
145 3300005438 Ga0070701_10018775 Ga0070701_100187752 296
146 3300005439 Ga0070711_100083108 Ga0070711_1000831082 296
147 3300005439 Ga0070711_100092488 Ga0070711_1000924882 296
148 3300005440 Ga0070705_100080208 Ga0070705_1000802082 296
149 3300005441 Ga0070700_100011130 Ga0070700_1000111303 296
150 3300005445 Ga0070708_100010598 Ga0070708_1000105982 296
151 3300005445 Ga0070708_100075572 Ga0070708_1000755723 296
152 3300005455 Ga0070663_100009318 Ga0070663_1000093187 296
153 3300005455 Ga0070663_100108030 Ga0070663_1001080302 296
154 3300005456 Ga0070678_100010924 Ga0070678_1000109242 296
155 3300005456 Ga0070678_100015974 Ga0070678_1000159743 296
156 3300005457 Ga0070662_100001538 Ga0070662_1000015387 296
157 3300005457 Ga0070662_100201825 Ga0070662_1002018252 296
158 3300005458 Ga0070681_10009179 Ga0070681_100091799 296
159 3300005458 Ga0070681_10087916 Ga0070681_100879163 296
160 3300005458 Ga0070681_10128557 Ga0070681_101285572 296
161 3300005459 Ga0068867_100002262 Ga0068867_10000226211 296
162 3300005459 Ga0068867_100021145 Ga0068867_1000211453 296
163 3300005459 Ga0068867_100182078 Ga0068867_1001820781 296
164 3300005466 Ga0070685_10008952 Ga0070685_100089525 296
165 3300005466 Ga0070685_10080998 Ga0070685_100809982 296
166 3300005467 Ga0070706_100043416 Ga0070706_1000434161 296
167 3300005467 Ga0070706_100119870 Ga0070706_1001198703 296
168 3300005467 Ga0070706_100277337 Ga0070706_1002773373 296
169 3300005467 Ga0070706_100546310 Ga0070706_1005463101 296
170 3300005468 Ga0070707_100081385 Ga0070707_1000813854 296
171 3300005468 Ga0070707_100245053 Ga0070707_1002450531 296
172 3300005468 Ga0070707_100245811 Ga0070707_1002458111 296
173 3300005471 Ga0070698_100014299 Ga0070698_1000142993 296
174 3300005471 Ga0070698_100335458 Ga0070698_1003354582 296
175 3300005518 Ga0070699_100292685 Ga0070699_1002926852 296
176 3300005530 Ga0070679_100346302 Ga0070679_1003463022 296
177 3300005535 Ga0070684_100017719 Ga0070684_1000177192 296
178 3300005535 Ga0070684_100101680 Ga0070684_1001016803 296
179 3300005536 Ga0070697_100016843 Ga0070697_1000168435 296
180 3300005536 Ga0070697_100416370 Ga0070697_1004163701 296
181 3300005539 Ga0068853_100008601 Ga0068853_1000086013 296
182 3300005539 Ga0068853_100361680 Ga0068853_1003616802 296
183 3300005543 Ga0070672_100005903 Ga0070672_1000059034 296
184 3300005543 Ga0070672_100147462 Ga0070672_1001474622 296
185 3300005543 Ga0070672_100293751 Ga0070672_1002937512 296
186 3300005544 Ga0070686_100034922 Ga0070686_1000349222 296
187 3300005548 Ga0070665_100016144 Ga0070665_1000161444 296
188 3300005549 Ga0070704_100083912 Ga0070704_1000839122 296
189 3300005549 Ga0070704_100117865 Ga0070704_1001178653 296
190 3300005563 Ga0068855_100004131 Ga0068855_10000413119 296
191 3300005563 Ga0068855_100004182 Ga0068855_10000418210 296
192 3300005563 Ga0068855_100023969 Ga0068855_1000239697 296
193 3300005564 Ga0070664_100062784 Ga0070664_1000627842 296
194 3300005564 Ga0070664_100092612 Ga0070664_1000926122 296
195 3300005564 Ga0070664_100125929 Ga0070664_1001259292 296
196 3300005577 Ga0068857_100066901 Ga0068857_1000669015 296
197 3300005578 Ga0068854_100032128 Ga0068854_1000321286 296
198 3300005578 Ga0068854_100384753 Ga0068854_1003847532 296
199 3300005614 Ga0068856_100000746 Ga0068856_10000074633 296
200 3300005616 Ga0068852_100133547 Ga0068852_1001335472 296
201 3300005616 Ga0068852_100167008 Ga0068852_1001670082 296
202 3300005617 Ga0068859_100013015 Ga0068859_1000130158 296
203 3300005617 Ga0068859_100027699 Ga0068859_1000276993 296
204 3300005617 Ga0068859_100654517 Ga0068859_1006545171 296
205 3300005618 Ga0068864_100006588 Ga0068864_1000065889 296
206 3300005618 Ga0068864_100014275 Ga0068864_1000142755 296
207 3300005718 Ga0068866_10023866 Ga0068866_100238662 296
208 3300005718 Ga0068866_10047452 Ga0068866_100474521 296
209 3300005718 Ga0068866_10101730 Ga0068866_101017302 296
210 3300005719 Ga0068861_100009473 Ga0068861_1000094736 296
211 3300005719 Ga0068861_100140355 Ga0068861_1001403552 296
212 3300005834 Ga0068851_10010102 Ga0068851_100101025 296
213 3300005834 Ga0068851_10144772 Ga0068851_101447722 296
214 3300005840 Ga0068870_10003596 Ga0068870_100035965 296
215 3300005840 Ga0068870_10107769 Ga0068870_101077692 296
216 3300005841 Ga0068863_100016845 Ga0068863_1000168453 296
217 3300005841 Ga0068863_100062542 Ga0068863_1000625422 296
218 3300005841 Ga0068863_100295024 Ga0068863_1002950242 296
219 3300005841 Ga0068863_100435424 Ga0068863_1004354242 296
220 3300005842 Ga0068858_100001192 Ga0068858_10000119227 296
221 3300005842 Ga0068858_100017451 Ga0068858_1000174513 296
222 3300005842 Ga0068858_100029593 Ga0068858_1000295932 296
223 3300005843 Ga0068860_100007115 Ga0068860_1000071158 296
224 3300005843 Ga0068860_100090775 Ga0068860_1000907752 296
225 3300005843 Ga0068860_100096601 Ga0068860_1000966013 296
226 3300005844 Ga0068862_100101350 Ga0068862_1001013502 296
227 3300005844 Ga0068862_100145720 Ga0068862_1001457202 296
228 3300006237 Ga0097621_100014800 Ga0097621_1000148002 296
229 3300006237 Ga0097621_100074533 Ga0097621_1000745333 296
230 3300006237 Ga0097621_100091943 Ga0097621_1000919431 296
231 3300006237 Ga0097621_100308122 Ga0097621_1003081222 296
232 3300006358 Ga0068871_100019474 Ga0068871_1000194743 296
233 3300006358 Ga0068871_100102702 Ga0068871_1001027021 296
234 3300006358 Ga0068871_100205022 Ga0068871_1002050222 296
235 3300006847 Ga0075431_100006092 Ga0075431_10000609212 296
236 3300006847 Ga0075431_100028888 Ga0075431_1000288885 296
237 3300006852 Ga0075433_10017261 Ga0075433_100172614 296
238 3300006852 Ga0075433_10063668 Ga0075433_100636684 296
239 3300006871 Ga0075434_100488086 Ga0075434_1004880862 296
240 3300006880 Ga0075429_100028668 Ga0075429_1000286685 296
241 3300006881 Ga0068865_100004601 Ga0068865_1000046012 296
242 3300006881 Ga0068865_100114536 Ga0068865_1001145362 296
243 3300006931 Ga0097620_100013015 Ga0097620_1000130158 296
244 3300006931 Ga0097620_100027696 Ga0097620_1000276964 296
245 3300006931 Ga0097620_100654545 Ga0097620_1006545451 296
246 3300007076 Ga0075435_100024026 Ga0075435_1000240262 296
247 3300007076 Ga0075435_100055343 Ga0075435_1000553434 296
248 3300007265 Ga0099794_10016914 Ga0099794_100169143 296
249 3300007265 Ga0099794_10058196 Ga0099794_100581962 296
250 3300009094 Ga0111539_10085890 Ga0111539_100858902 296
251 3300009094 Ga0111539_10169231 Ga0111539_101692312 296
252 3300009094 Ga0111539_10341965 Ga0111539_103419652 296
253 3300009098 Ga0105245_10108478 Ga0105245_101084783 296
254 3300009098 Ga0105245_10212119 Ga0105245_102121192 296
255 3300009147 Ga0114129_10014457 Ga0114129_100144575 296
256 3300009148 Ga0105243_10013583 Ga0105243_100135837 296
257 3300009148 Ga0105243_10069879 Ga0105243_100698792 296
258 3300009174 Ga0105241_10046557 Ga0105241_100465572 296
259 3300009177 Ga0105248_10003625 Ga0105248_1000362512 296
260 3300009177 Ga0105248_10304621 Ga0105248_103046211 296
261 3300009177 Ga0105248_10368127 Ga0105248_103681272 296
262 3300009551 Ga0105238_10397099 Ga0105238_103970992 296
263 3300009553 Ga0105249_10034990 Ga0105249_100349903 296
264 3300009553 Ga0105249_10065701 Ga0105249_100657012 296
265 3300010375 Ga0105239_10328954 Ga0105239_103289542 296
266 3300011119 Ga0105246_10207978 Ga0105246_102079782 296
267 3300013100 Ga0157373_10004302 Ga0157373_100043025 296
268 3300013100 Ga0157373_10004442 Ga0157373_100044422 296
269 3300013102 Ga0157371_10001640 Ga0157371_1000164016 296
270 3300013104 Ga0157370_10114837 Ga0157370_101148373 296
271 3300013105 Ga0157369_10039334 Ga0157369_100393342 296
272 3300013296 Ga0157374_10010788 Ga0157374_100107884 296
273 3300013296 Ga0157374_10015424 Ga0157374_100154245 296
274 3300013297 Ga0157378_10188709 Ga0157378_101887092 296
275 3300013297 Ga0157378_10207287 Ga0157378_102072872 296
276 3300013297 Ga0157378_10389390 Ga0157378_103893902 296
277 3300013306 Ga0163162_10021274 Ga0163162_100212745 296
278 3300013307 Ga0157372_10022097 Ga0157372_100220972 296
279 3300013308 Ga0157375_10014243 Ga0157375_100142434 296
280 3300014325 Ga0163163_10143347 Ga0163163_101433471 296
281 3300014326 Ga0157380_10047569 Ga0157380_100475692 296
282 3300014326 Ga0157380_10233779 Ga0157380_102337792 296
283 3300014745 Ga0157377_10006467 Ga0157377_100064674 296
284 3300014968 Ga0157379_10003933 Ga0157379_100039333 296
285 3300014968 Ga0157379_10006259 Ga0157379_100062599 296
286 3300014968 Ga0157379_10037415 Ga0157379_100374152 296
287 3300014969 Ga0157376_10300644 Ga0157376_103006441 296
288 3300017792 Ga0163161_10019409 Ga0163161_100194092 296
289 3300025315 Ga0207697_10000857 Ga0207697_100008575 296
290 3300025321 Ga0207656_10003924 Ga0207656_100039245 296
291 3300025893 Ga0207682_10004209 Ga0207682_100042097 296
292 3300025893 Ga0207682_10029170 Ga0207682_100291701 296
293 3300025901 Ga0207688_10001485 Ga0207688_1000148511 296
294 3300025903 Ga0207680_10121254 Ga0207680_101212541 296
295 3300025903 Ga0207680_10129343 Ga0207680_101293432 296
296 3300025904 Ga0207647_10085388 Ga0207647_100853882 296
297 3300025907 Ga0207645_10000812 Ga0207645_100008126 296
298 3300025907 Ga0207645_10005560 Ga0207645_100055608 296
299 3300025907 Ga0207645_10051188 Ga0207645_100511884 296
300 3300025908 Ga0207643_10000681 Ga0207643_100006813 296
301 3300025910 Ga0207684_10086706 Ga0207684_100867062 296
302 3300025910 Ga0207684_10143251 Ga0207684_101432512 296
303 3300025912 Ga0207707_10048808 Ga0207707_100488083 296
304 3300025912 Ga0207707_10154276 Ga0207707_101542763 296
305 3300025912 Ga0207707_10175624 Ga0207707_101756242 296
306 3300025918 Ga0207662_10012687 Ga0207662_100126872 296
307 3300025918 Ga0207662_10101869 Ga0207662_101018692 296
308 3300025919 Ga0207657_10008928 Ga0207657_100089284 296
309 3300025919 Ga0207657_10020575 Ga0207657_100205754 296
310 3300025920 Ga0207649_10026742 Ga0207649_100267423 296
311 3300025920 Ga0207649_10046056 Ga0207649_100460563 296
312 3300025921 Ga0207652_10027507 Ga0207652_100275075 296
313 3300025921 Ga0207652_10256694 Ga0207652_102566942 296
314 3300025922 Ga0207646_10068968 Ga0207646_100689684 296
315 3300025922 Ga0207646_10357938 Ga0207646_103579381 296
316 3300025923 Ga0207681_10021713 Ga0207681_100217133 296
317 3300025923 Ga0207681_10028621 Ga0207681_100286213 296
318 3300025925 Ga0207650_10015326 Ga0207650_100153267 296
319 3300025925 Ga0207650_10027987 Ga0207650_100279872 296
320 3300025925 Ga0207650_10038875 Ga0207650_100388753 296
321 3300025926 Ga0207659_10006549 Ga0207659_100065498 296
322 3300025926 Ga0207659_10045079 Ga0207659_100450794 296
323 3300025926 Ga0207659_10314554 Ga0207659_103145541 296
324 3300025926 Ga0207659_10333824 Ga0207659_103338241 296
325 3300025927 Ga0207687_10119540 Ga0207687_101195402 296
326 3300025928 Ga0207700_10006029 Ga0207700_100060293 296
327 3300025931 Ga0207644_10018478 Ga0207644_100184782 296
328 3300025931 Ga0207644_10240068 Ga0207644_102400682 296
329 3300025932 Ga0207690_10003125 Ga0207690_100031257 296
330 3300025932 Ga0207690_10111774 Ga0207690_101117743 296
331 3300025932 Ga0207690_10132116 Ga0207690_101321162 296
332 3300025933 Ga0207706_10000149 Ga0207706_1000014948 296
333 3300025933 Ga0207706_10000850 Ga0207706_1000085021 296
334 3300025933 Ga0207706_10013215 Ga0207706_100132155 296
335 3300025933 Ga0207706_10060167 Ga0207706_100601673 296
336 3300025933 Ga0207706_10204818 Ga0207706_102048182 296
337 3300025934 Ga0207686_10032369 Ga0207686_100323692 296
338 3300025935 Ga0207709_10061367 Ga0207709_100613672 296
339 3300025935 Ga0207709_10120244 Ga0207709_101202442 296
340 3300025935 Ga0207709_10171263 Ga0207709_101712631 296
341 3300025936 Ga0207670_10025204 Ga0207670_100252042 296
342 3300025936 Ga0207670_10211558 Ga0207670_102115582 296
343 3300025937 Ga0207669_10013314 Ga0207669_100133142 296
344 3300025937 Ga0207669_10123533 Ga0207669_101235332 296
345 3300025937 Ga0207669_10305206 Ga0207669_103052062 296
346 3300025938 Ga0207704_10004664 Ga0207704_100046645 296
347 3300025938 Ga0207704_10285767 Ga0207704_102857671 296
348 3300025940 Ga0207691_10000041 Ga0207691_100000415 296
349 3300025940 Ga0207691_10001626 Ga0207691_1000162611 296
350 3300025940 Ga0207691_10116259 Ga0207691_101162593 296
351 3300025940 Ga0207691_10327478 Ga0207691_103274782 296
352 3300025941 Ga0207711_10010263 Ga0207711_100102633 296
353 3300025941 Ga0207711_10016925 Ga0207711_100169254 296
354 3300025942 Ga0207689_10000307 Ga0207689_1000030739 296
355 3300025942 Ga0207689_10008104 Ga0207689_100081044 296
356 3300025942 Ga0207689_10126314 Ga0207689_101263143 296
357 3300025944 Ga0207661_10042079 Ga0207661_100420792 296
358 3300025944 Ga0207661_10062405 Ga0207661_100624053 296
359 3300025944 Ga0207661_10102802 Ga0207661_101028023 296
360 3300025945 Ga0207679_10001327 Ga0207679_100013279 296
361 3300025945 Ga0207679_10019201 Ga0207679_100192013 296
362 3300025945 Ga0207679_10034724 Ga0207679_100347243 296
363 3300025945 Ga0207679_10088183 Ga0207679_100881832 296
364 3300025949 Ga0207667_10006496 Ga0207667_100064967 296
365 3300025949 Ga0207667_10026140 Ga0207667_100261407 296
366 3300025960 Ga0207651_10270028 Ga0207651_102700282 296
367 3300025960 Ga0207651_10323121 Ga0207651_103231211 296
368 3300025961 Ga0207712_10098664 Ga0207712_100986642 296
369 3300025961 Ga0207712_10411183 Ga0207712_104111831 296
370 3300025972 Ga0207668_10046114 Ga0207668_100461143 296
371 3300025972 Ga0207668_10168224 Ga0207668_101682242 296
372 3300025981 Ga0207640_10257299 Ga0207640_102572992 296
373 3300025986 Ga0207658_10008526 Ga0207658_100085263 296
374 3300025986 Ga0207658_10034415 Ga0207658_100344152 296
375 3300025986 Ga0207658_10078449 Ga0207658_100784492 296
376 3300025986 Ga0207658_10138602 Ga0207658_101386022 296
377 3300026023 Ga0207677_10010131 Ga0207677_100101312 296
378 3300026023 Ga0207677_10025901 Ga0207677_100259012 296
379 3300026023 Ga0207677_10401511 Ga0207677_104015111 296
380 3300026023 Ga0207677_10585935 Ga0207677_105859351 296
381 3300026035 Ga0207703_10023763 Ga0207703_100237633 296
382 3300026035 Ga0207703_10062531 Ga0207703_100625313 296
383 3300026041 Ga0207639_10024964 Ga0207639_100249642 296
384 3300026041 Ga0207639_10159733 Ga0207639_101597332 296
385 3300026041 Ga0207639_10285750 Ga0207639_102857502 296
386 3300026067 Ga0207678_10005590 Ga0207678_100055908 296
387 3300026067 Ga0207678_10047859 Ga0207678_100478595 296
388 3300026075 Ga0207708_10003748 Ga0207708_100037482 296
389 3300026075 Ga0207708_10003970 Ga0207708_100039704 296
390 3300026075 Ga0207708_10015274 Ga0207708_100152742 296
391 3300026078 Ga0207702_10004548 Ga0207702_1000454814 296
392 3300026078 Ga0207702_10346051 Ga0207702_103460512 296
393 3300026088 Ga0207641_10109114 Ga0207641_101091143 296
394 3300026088 Ga0207641_10212848 Ga0207641_102128482 296
395 3300026089 Ga0207648_10001461 Ga0207648_1000146116 296
396 3300026089 Ga0207648_10006661 Ga0207648_100066613 296
397 3300026089 Ga0207648_10056626 Ga0207648_100566262 296
398 3300026089 Ga0207648_10141120 Ga0207648_101411202 296
399 3300026095 Ga0207676_10008580 Ga0207676_100085802 296
400 3300026095 Ga0207676_10045686 Ga0207676_100456862 296
401 3300026095 Ga0207676_10604629 Ga0207676_106046291 296
402 3300026116 Ga0207674_10010023 Ga0207674_100100235 296
403 3300026116 Ga0207674_10037794 Ga0207674_100377943 296
404 3300026118 Ga0207675_100001001 Ga0207675_10000100117 296
405 3300026118 Ga0207675_100084329 Ga0207675_1000843292 296
406 3300026121 Ga0207683_10000011 Ga0207683_10000011112 296
407 3300026121 Ga0207683_10011296 Ga0207683_100112967 296
408 3300026121 Ga0207683_10042640 Ga0207683_100426404 296
409 3300026121 Ga0207683_10130241 Ga0207683_101302412 296
410 3300026142 Ga0207698_10013035 Ga0207698_100130356 296
411 3300026142 Ga0207698_10219981 Ga0207698_102199812 296
412 3300027360 Ga0209969_1003872 Ga0209969_10038722 296
413 3300027695 Ga0209966_1008536 Ga0209966_10085361 296
414 3300027876 Ga0209974_10000965 Ga0209974_100009653 296
415 3300027907 Ga0207428_10077837 Ga0207428_100778373 296
416 3300028379 Ga0268266_10030465 Ga0268266_100304653 296
417 3300028379 Ga0268266_10250957 Ga0268266_102509572 296
418 3300028380 Ga0268265_10183139 Ga0268265_101831392 296
419 3300028381 Ga0268264_10017182 Ga0268264_100171824 296
420 3300028381 Ga0268264_10085088 Ga0268264_100850882 296
421 3300028381 Ga0268264_10396840 Ga0268264_103968402 296
422 3300028381 Ga0268264_10537783 Ga0268264_105377831 296
423 3300028577 Ga0265318_10003772 Ga0265318_100037727 296
424 3300028786 Ga0307517_10027623 Ga0307517_100276237 296
425 3300031239 Ga0265328_10003447 Ga0265328_100034475 296
426 3300031242 Ga0265329_10004350 Ga0265329_100043503 296
427 3300031249 Ga0265339_10052324 Ga0265339_100523242 296
428 3300031250 Ga0265331_10002801 Ga0265331_1000280110 296
429 3300031251 Ga0265327_10039656 Ga0265327_100396562 296
430 3300031344 Ga0265316_10068930 Ga0265316_100689302 296
431 3300031595 Ga0265313_10025682 Ga0265313_100256822 296
432 3300031616 Ga0307508_10033070 Ga0307508_100330706 296
433 3300031711 Ga0265314_10004263 Ga0265314_100042633 296
434 3300031712 Ga0265342_10191856 Ga0265342_101918562 296
435 3300031730 Ga0307516_10025717 Ga0307516_100257173 296
436 3300031824 Ga0307413_10016300 Ga0307413_100163003 296
437 3300031852 Ga0307410_10135753 Ga0307410_101357531 296
438 3300031901 Ga0307406_10055994 Ga0307406_100559942 296
439 3300031903 Ga0307407_10029197 Ga0307407_100291972 296
440 3300031911 Ga0307412_10013834 Ga0307412_100138342 296
441 3300031995 Ga0307409_100066993 Ga0307409_1000669933 296
442 3300032002 Ga0307416_100121351 Ga0307416_1001213512 296
443 3300032005 Ga0307411_10186396 Ga0307411_101863961 296
444 3300035113 Ga0373936_0000007 Ga0373936_0000007_35607_36497 296
445 3300035170 Ga0373943_0054012 Ga0373943_0054012_657_1556 296
446 3300035241 Ga0373961_0070183 Ga0373961_0070183_133_1038 296
447 3300035691 Ga0373931_0023523 Ga0373931_0023523_2203_3096 296
448 3300035691 Ga0373931_0183613 Ga0373931_0183613_325_1215 296
449 3300035691 Ga0373931_0269215 Ga0373931_0269215_39_929 296
450 3300035695 Ga0373927_0005743 Ga0373927_0005743_4653_5543 296
451 3300035695 Ga0373927_0006822 Ga0373927_0006822_4969_5859 296
452 3300035725 Ga0373947_0262709 Ga0373947_0262709_238_1128 296
453 3300036401 Ga0373937_0043680 Ga0373937_0043680_59_949 296
454 3300036401 Ga0373937_0188905 Ga0373937_0188905_882_1772 296
455 3300036401 Ga0373937_0287681 Ga0373937_0287681_13_927 296
456 3300037068 Ga0373925_0059498 Ga0373925_0059498_1087_1977 296
457 3300041486 Ga0451807_2371905 Ga0451807_2371905_410_1405 296
458 3300041507 Ga0451851_1337042 Ga0451851_1337042_172_1158 296
459 3300042001 Ga0439441_002589 Ga0439441_002589_801_1700 296
460 3300042876 Ga0451577_0016117 Ga0451577_0016117_1407_2318 296
461 3300042876 Ga0451577_0342082 Ga0451577_0342082_442_1332 296
462 3300044712 Ga0453684_0421862 Ga0453684_0421862_445_1335 296
463 3300045051 Ga0451576_0224459 Ga0451576_0224459_768_1661 296
464 3300045051 Ga0451576_0358745 Ga0451576_0358745_452_1342 296
465 3300046472 Ga0495580_0009283 Ga0495580_0009283_1571_2470 296
466 3300046537 Ga0495598_0028023 Ga0495598_0028023_16_906 296
467 3300046539 Ga0495621_0042336 Ga0495621_0042336_435_1325 296
468 3300046615 Ga0495656_0065715 Ga0495656_0065715_624_1514 296
469 3300046681 Ga0495647_0031568 Ga0495647_0031568_375_1265 296
470 3300046683 Ga0495658_0066937 Ga0495658_0066937_724_1614 296
471 3300048903 Ga0496100_0124362 Ga0496100_0124362_526_1419 296
472 3300048903 Ga0496100_0329809 Ga0496100_0329809_22_912 296
473 3300048904 Ga0496101_0017794 Ga0496101_0017794_3072_3962 296
474 3300048905 Ga0496102_0033765 Ga0496102_0033765_769_1659 296
475 3300048906 Ga0496103_0176331 Ga0496103_0176331_468_1358 296
476 3300048907 Ga0496104_0157903 Ga0496104_0157903_645_1535 296
477 3300048908 Ga0496105_0006652 Ga0496105_0006652_3224_4114 296
478 3300048909 Ga0496106_0000594 Ga0496106_0000594_5305_6195 296
479 3300048909 Ga0496106_0028362 Ga0496106_0028362_603_1493 296
480 3300048910 Ga0496107_0036451 Ga0496107_0036451_1900_2790 296
481 3300048910 Ga0496107_0131759 Ga0496107_0131759_257_1147 296
482 3300048911 Ga0496108_0011489 Ga0496108_0011489_3310_4200 296
483 3300048912 Ga0496109_0026238 Ga0496109_0026238_1122_2012 296
484 3300048913 Ga0496110_0061314 Ga0496110_0061314_2397_3290 296
485 3300048916 Ga0496113_0453031 Ga0496113_0453031_70_975 296
486 3300048917 Ga0496114_0018160 Ga0496114_0018160_4469_5359 296
487 3300048917 Ga0496114_0065095 Ga0496114_0065095_414_1304 296
488 3300048917 Ga0496114_0149759 Ga0496114_0149759_430_1323 296
489 3300049576 Ga0501040_0050792 Ga0501040_0050792_875_1798 296
490 3300049578 Ga0501042_0014715 Ga0501042_0014715_767_1657 296
491 3300049582 Ga0501048_0124786 Ga0501048_0124786_190_1080 296
492 3300049587 Ga0501071_0012799 Ga0501071_0012799_3229_4152 296
493 3300049588 Ga0501072_0016931 Ga0501072_0016931_3475_4398 296
494 3300049591 Ga0501075_0010190 Ga0501075_0010190_635_1525 296
495 3300049592 Ga0501076_0002204 Ga0501076_0002204_11730_12620 296
496 3300049592 Ga0501076_0040143 Ga0501076_0040143_753_1676 296
497 3300049743 Ga0501081_0018795 Ga0501081_0018795_3239_4345 296
498 3300049822 Ga0501035_0073569 Ga0501035_0073569_427_1317 296
499 3300049824 Ga0501045_0040816 Ga0501045_0040816_1060_1950 296
500 3300049824 Ga0501045_0051170 Ga0501045_0051170_718_1641 296
501 3300050507 nmdc:mga05p37_2369_c2 nmdc:mga05p37_2369_c2_8026_8916 296
502 3300050507 nmdc:mga05p37_619104_c1 nmdc:mga05p37_619104_c1_225_1115 296
503 3300050508 nmdc:mga09592_149054_c1 nmdc:mga09592_149054_c1_839_1729 296
504 3300050509 nmdc:mga0qj67_56730_c1 nmdc:mga0qj67_56730_c1_1636_2526 296
505 3300050510 nmdc:mga06r32_5485_c1 nmdc:mga06r32_5485_c1_8255_9151 296
506 3300050510 nmdc:mga06r32_68038_c1 nmdc:mga06r32_68038_c1_699_1589 296
507 3300050512 nmdc:mga0n895_55429_c1 nmdc:mga0n895_55429_c1_2798_3703 296
508 3300050513 nmdc:mga0rr50_12671_c1 nmdc:mga0rr50_12671_c1_3690_4595 296
509 3300050513 nmdc:mga0rr50_67461_c1 nmdc:mga0rr50_67461_c1_1385_2275 296
510 3300050515 nmdc:mga0a205_48332_c1 nmdc:mga0a205_48332_c1_2426_3316 296
511 3300050515 nmdc:mga0a205_51827_c1 nmdc:mga0a205_51827_c1_1952_2842 296
512 3300053086 Ga0500578_0106473 Ga0500578_0106473_744_1646 296
513 3300053096 Ga0500641_0003285 Ga0500641_0003285_1056_1946 296
514 3300053156 Ga0500622_0003851 Ga0500622_0003851_3664_4581 296
515 3300059421 Ga0590071_004445 Ga0590071_004445_1492_2388 296
516 3300059424 Ga0590075_011037 Ga0590075_011037_1074_1970 296
517 3300059426 Ga0590077_000363 Ga0590077_000363_840_1736 296
518 3300060353 Ga0501082_0004635 Ga0501082_0004635_5851_6741 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23678

1

39

0.96

PF01738

DLH

Dienelactone hydrolase family

84

293

0.91

PF08840

BAAT_C

BAAT / Acyl-CoA thioester hydrolase C terminal

160

258

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9913 60 294
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9748 60 294
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8816 73 295
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8801 68 294
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8762 73 292
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9903 60 294 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9735 60 294 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8958 84 294 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8909 70 294 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8853 68 294 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2N1UQI7-F1-model_v4 Dienelactone hydrolase 1 179 294 GO:0016787
AF-A0A6N3QHR6-F1-model_v4 Putative enzyme 0.9995 181 294 GO:0016787
AF-A0A838RYB0-F1-model_v4 Dienelactone hydrolase family protein 0.999 201 293 GO:0016787
AF-A0A376VX57-F1-model_v4 YghX 0.9987 190 293 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9972 190 293 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map