F458168

General Info

Members Datasets Scaffolds Average Seq Length
517 262 1034 167

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0023369|Ga0495671_0023369_1591_2163
Length 190
Sequence MGRQRSSDFQRSDAAIRPTGWGNSLKDKTDMTDTTANGADNLPQIGLIAQYVKDLSFENPNSPGVYQWQEQPQIDVNFNISNEQAAEDVYEISVKITAKAVAEAGTAFAVELVFAGLFGIRNVPEEQMRPFLYAEGPRLLFPFARRILADAVQDGGFPPLLLDPIDFGALYMQQQAQLEGAAEGAPIGNA

Samples

Sample ID Description Type Environment
1 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
231 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
237 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
238 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
239 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
243 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
250 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
251 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
252 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
258 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
259 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
260 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
261 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
262 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0.39
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 9.28
Nodule 0
Rhizoplane 3.87
Rhizosphere 77.95
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495671_0023369 3300046692 Bacteria 3230
2 SwRhRL2b_contig_1141627 2162886007 Bacteria 1804
3 JGI24741J21665_1000059 3300001915 Bacteria 26495
4 JGI24741J21665_1007304 3300001915 Bacteria 2150
5 JGI24752J21851_1001321 3300001976 Bacteria 3344
6 JGI24752J21851_1009789 3300001976 Bacteria 1251
7 JGI24740J21852_10019680 3300001979 Bacteria 2373
8 JGI24740J21852_10026617 3300001979 Bacteria 1935
9 JGI24740J21852_10045940 3300001979 Bacteria 1285
10 JGI24739J22299_10001746 3300001989 Bacteria 8275
11 JGI24739J22299_10001909 3300001989 Bacteria 7972
12 JGI24739J22299_10007878 3300001989 Bacteria 3986
13 JGI24739J22299_10011810 3300001989 Bacteria 3217
14 JGI24737J22298_10004672 3300001990 Bacteria 4763
15 JGI24737J22298_10009590 3300001990 Bacteria 3212
16 JGI24737J22298_10011532 3300001990 Bacteria 2894
17 JGI24737J22298_10013167 3300001990 Bacteria 2694
18 JGI24743J22301_10082024 3300001991 Bacteria 681
19 JGI24735J21928_10001274 3300002067 Bacteria 8944
20 JGI24735J21928_10010421 3300002067 Bacteria 2964
21 JGI24735J21928_10017800 3300002067 Bacteria 2195
22 JGI24735J21928_10032985 3300002067 Bacteria 1531
23 JGI24735J21928_10036532 3300002067 Bacteria 1441
24 JGI24738J21930_10000046 3300002075 Bacteria 24386
25 JGI24738J21930_10016807 3300002075 Bacteria 1542
26 JGI24738J21930_10024487 3300002075 Bacteria 1241
27 JGI24738J21930_10088782 3300002075 Bacteria 652
28 JGI24738J21930_10103909 3300002075 Bacteria 608
29 JGI24744J21845_10000962 3300002077 Bacteria 5496
30 JGI24751J29686_10023928 3300002459 Bacteria 1266
31 JGI25150J39212_1000082 3300002774 Bacteria 56551
32 JGI25151J46595_10017607 3300003187 Bacteria 3093
33 JGI25165J46597_1000124 3300003214 Bacteria 131341
34 JGI25153J46596_10000029 3300003215 Bacteria 201658
35 rootH1_10114615 3300003316 Bacteria 2017
36 rootL2_10121722 3300003322 Bacteria 4385
37 Ga0055529_1009077 3300003763 Bacteria 1313
38 Ga0055526_1005229 3300003771 Bacteria 7536
39 Ga0055537_1003772 3300003773 Bacteria 4555
40 Ga0055536_1023316 3300003781 Bacteria 1822
41 Ga0055530_10012993 3300003791 Bacteria 2868
42 Ga0055540_1001389 3300003792 Bacteria 14446
43 Ga0065704_10082659 3300005289 Bacteria 3556
44 Ga0070658_10000057 3300005327 Bacteria 113572
45 Ga0070658_10000240 3300005327 Bacteria 48689
46 Ga0070658_10108683 3300005327 Bacteria 2296
47 Ga0070658_10229766 3300005327 Bacteria 1571
48 Ga0070658_10556648 3300005327 Bacteria 993
49 Ga0070676_10035721 3300005328 Bacteria 2860
50 Ga0070676_10201159 3300005328 Bacteria 1306
51 Ga0070670_100000016 3300005331 Bacteria 226440
52 Ga0070670_100002773 3300005331 Bacteria 14474
53 Ga0068869_100000304 3300005334 Bacteria 26244
54 Ga0070666_10000273 3300005335 Bacteria 34295
55 Ga0070666_10000551 3300005335 Bacteria 22656
56 Ga0070666_10500080 3300005335 Bacteria 881
57 Ga0068868_100000003 3300005338 Bacteria 155611
58 Ga0070660_100002242 3300005339 Bacteria 13287
59 Ga0070660_100004311 3300005339 Bacteria 9826
60 Ga0070660_100019313 3300005339 Bacteria 4991
61 Ga0070660_100036549 3300005339 Bacteria 3720
62 Ga0070661_100000001 3300005344 Bacteria 424830
63 Ga0070661_100396187 3300005344 Bacteria 1091
64 Ga0070661_100422033 3300005344 Bacteria 1057
65 Ga0070668_100000003 3300005347 Bacteria 195738
66 Ga0070668_100000019 3300005347 Bacteria 98356
67 Ga0070668_100004026 3300005347 Bacteria 10867
68 Ga0070668_100123970 3300005347 Bacteria 2068
69 Ga0070669_100000096 3300005353 Bacteria 86930
70 Ga0070669_100555790 3300005353 Bacteria 957
71 Ga0070675_100003521 3300005354 Bacteria 11872
72 Ga0070671_100000045 3300005355 Bacteria 85779
73 Ga0070671_100000645 3300005355 Bacteria 25008
74 Ga0070671_100038715 3300005355 Bacteria 3957
75 Ga0070671_100241306 3300005355 Bacteria 1534
76 Ga0070674_100542772 3300005356 Bacteria 974
77 Ga0070673_100000008 3300005364 Bacteria 166844
78 Ga0070659_100006974 3300005366 Bacteria 8179
79 Ga0070659_100056905 3300005366 Bacteria 3083
80 Ga0070659_100106332 3300005366 Bacteria 2262
81 Ga0070659_100135635 3300005366 Bacteria 2001
82 Ga0070659_100303951 3300005366 Bacteria 1331
83 Ga0070667_100000035 3300005367 Bacteria 173461
84 Ga0070667_100000094 3300005367 Bacteria 111140
85 Ga0070667_100000111 3300005367 Bacteria 105176
86 Ga0070667_100000425 3300005367 Bacteria 44629
87 Ga0070667_100041822 3300005367 Bacteria 3844
88 Ga0070708_100126989 3300005445 Bacteria 2358
89 Ga0070663_100010688 3300005455 Bacteria 5728
90 Ga0070663_100078289 3300005455 Bacteria 2423
91 Ga0070678_100002275 3300005456 Bacteria 10451
92 Ga0070662_100028203 3300005457 Bacteria 3904
93 Ga0070662_100039860 3300005457 Bacteria 3343
94 Ga0070662_100110775 3300005457 Bacteria 2091
95 Ga0070662_100118443 3300005457 Bacteria 2027
96 Ga0070662_100245156 3300005457 Bacteria 1438
97 Ga0068867_100000003 3300005459 Bacteria 217886
98 Ga0068853_100002796 3300005539 Bacteria 13196
99 Ga0068853_100018954 3300005539 Bacteria 5699
100 Ga0068853_100032036 3300005539 Bacteria 4451
101 Ga0068853_100240549 3300005539 Bacteria 1659
102 Ga0068853_100240559 3300005539 Bacteria 1659
103 Ga0070672_100042621 3300005543 Bacteria 3495
104 Ga0070686_100926854 3300005544 Bacteria 710
105 Ga0070693_100018489 3300005547 Bacteria 3642
106 Ga0070665_100039230 3300005548 Bacteria 4763
107 Ga0070665_100493225 3300005548 Bacteria 1236
108 Ga0070665_100665707 3300005548 Bacteria 1054
109 Ga0068855_100000775 3300005563 Bacteria 39423
110 Ga0068855_100031119 3300005563 Bacteria 6375
111 Ga0068855_100114905 3300005563 Bacteria 3086
112 Ga0068855_100212704 3300005563 Bacteria 2172
113 Ga0068855_100234617 3300005563 Bacteria 2052
114 Ga0070664_100168590 3300005564 Bacteria 1941
115 Ga0070664_100480849 3300005564 Bacteria 1143
116 Ga0068857_100029421 3300005577 Bacteria 4848
117 Ga0068857_100056225 3300005577 Bacteria 3492
118 Ga0068857_100180327 3300005577 Bacteria 1922
119 Ga0068857_100368764 3300005577 Bacteria 1332
120 Ga0068857_100616456 3300005577 Bacteria 1026
121 Ga0068857_100799170 3300005577 Bacteria 901
122 Ga0068854_100000580 3300005578 Bacteria 21838
123 Ga0068854_100037313 3300005578 Bacteria 3410
124 Ga0068854_101690056 3300005578 Bacteria 578
125 Ga0068856_100010236 3300005614 Bacteria 9118
126 Ga0068856_100017188 3300005614 Bacteria 7008
127 Ga0068856_100202500 3300005614 Bacteria 1999
128 Ga0068856_100650946 3300005614 Bacteria 1074
129 Ga0068856_100682740 3300005614 Bacteria 1047
130 Ga0068852_100002650 3300005616 Bacteria 12366
131 Ga0068852_100102624 3300005616 Bacteria 2585
132 Ga0068852_100736406 3300005616 Bacteria 997
133 Ga0068859_100000162 3300005617 Bacteria 65033
134 Ga0068859_100008180 3300005617 Bacteria 10608
135 Ga0068859_100015437 3300005617 Bacteria 7673
136 Ga0068859_100227875 3300005617 Bacteria 1951
137 Ga0068864_100000017 3300005618 Bacteria 285607
138 Ga0068864_100045589 3300005618 Bacteria 3761
139 Ga0068861_100047846 3300005719 Bacteria 3230
140 Ga0068851_10026055 3300005834 Bacteria 2871
141 Ga0068851_10126074 3300005834 Bacteria 1381
142 Ga0068851_10192205 3300005834 Bacteria 1135
143 Ga0068863_100000018 3300005841 Bacteria 206948
144 Ga0068863_100000057 3300005841 Bacteria 123606
145 Ga0068863_100007931 3300005841 Bacteria 10379
146 Ga0068863_100057980 3300005841 Bacteria 3665
147 Ga0068863_100183950 3300005841 Bacteria 2006
148 Ga0068863_100604882 3300005841 Bacteria 1085
149 Ga0068858_100000954 3300005842 Bacteria 29922
150 Ga0068858_100009859 3300005842 Bacteria 9077
151 Ga0068858_100043604 3300005842 Bacteria 4160
152 Ga0068860_100000143 3300005843 Bacteria 116787
153 Ga0068860_100000176 3300005843 Bacteria 105176
154 Ga0068860_100018257 3300005843 Bacteria 6827
155 Ga0068860_100092476 3300005843 Bacteria 2882
156 Ga0068862_100000010 3300005844 Bacteria 285607
157 Ga0068862_100000168 3300005844 Bacteria 72749
158 Ga0068862_100001062 3300005844 Bacteria 26306
159 Ga0097621_100002111 3300006237 Bacteria 13617
160 Ga0075370_10056151 3300006353 Bacteria 2237
161 Ga0068871_100144562 3300006358 Bacteria 2024
162 Ga0068865_100000002 3300006881 Bacteria 285745
163 Ga0097620_100000162 3300006931 Bacteria 65033
164 Ga0097620_100008180 3300006931 Bacteria 10608
165 Ga0097620_100015437 3300006931 Bacteria 7673
166 Ga0097620_100227876 3300006931 Bacteria 1951
167 Ga0105251_10002120 3300009011 Bacteria 15958
168 Ga0105240_10212646 3300009093 Bacteria 2258
169 Ga0105240_10375990 3300009093 Bacteria 1605
170 Ga0105240_10888461 3300009093 Bacteria 959
171 Ga0105245_10000060 3300009098 Bacteria 119425
172 Ga0105247_10002007 3300009101 Bacteria 14094
173 Ga0105247_10005739 3300009101 Bacteria 7770
174 Ga0105243_10000031 3300009148 Bacteria 185825
175 Ga0105241_10012470 3300009174 Bacteria 6231
176 Ga0105242_10002064 3300009176 Bacteria 15835
177 Ga0105248_10000105 3300009177 Bacteria 94143
178 Ga0105248_10059315 3300009177 Bacteria 4298
179 Ga0105248_10061601 3300009177 Bacteria 4213
180 Ga0105237_10012606 3300009545 Bacteria 8903
181 Ga0105237_10047388 3300009545 Bacteria 4321
182 Ga0105237_10140995 3300009545 Bacteria 2405
183 Ga0105237_10341274 3300009545 Bacteria 1502
184 Ga0105238_10119763 3300009551 Bacteria 2612
185 Ga0105249_10000726 3300009553 Bacteria 29928
186 Ga0105249_10006675 3300009553 Bacteria 10049
187 Ga0105249_10015591 3300009553 Bacteria 6728
188 Ga0105239_10098456 3300010375 Bacteria 3233
189 Ga0105239_10334964 3300010375 Bacteria 1707
190 Ga0105239_11228159 3300010375 Bacteria 864
191 Ga0105239_11682002 3300010375 Bacteria 734
192 Ga0105246_10016791 3300011119 Bacteria 4642
193 Ga0157373_10016737 3300013100 Bacteria 5344
194 Ga0157373_10342218 3300013100 Bacteria 1066
195 Ga0157371_10320927 3300013102 Bacteria 1124
196 Ga0157371_10363587 3300013102 Bacteria 1055
197 Ga0157370_10002244 3300013104 Bacteria 23479
198 Ga0157370_10067462 3300013104 Bacteria 3382
199 Ga0157369_10073034 3300013105 Bacteria 3681
200 Ga0157369_10256159 3300013105 Bacteria 1826
201 Ga0157369_10287391 3300013105 Bacteria 1712
202 Ga0157374_10000105 3300013296 Bacteria 78376
203 Ga0157374_10192124 3300013296 Bacteria 1997
204 Ga0157378_10001674 3300013297 Bacteria 19981
205 Ga0163162_10013622 3300013306 Bacteria 7943
206 Ga0163162_10029572 3300013306 Bacteria 5422
207 Ga0163162_10087987 3300013306 Bacteria 3185
208 Ga0157372_10002932 3300013307 Bacteria 18418
209 Ga0157372_10479842 3300013307 Bacteria 1450
210 Ga0157372_10821618 3300013307 Bacteria 1079
211 Ga0157372_11429678 3300013307 Bacteria 797
212 Ga0157375_10000564 3300013308 Bacteria 33338
213 Ga0163163_10256422 3300014325 Bacteria 1800
214 Ga0163163_10281245 3300014325 Bacteria 1715
215 Ga0157380_10550172 3300014326 Bacteria 1132
216 Ga0157379_10161363 3300014968 Unclassified 2023
217 Ga0157379_10175008 3300014968 Bacteria 1938
218 Ga0157376_10034714 3300014969 Bacteria 4075
219 Ga0163161_10095917 3300017792 Bacteria 2201
220 Ga0206352_10857486 3300020078 Bacteria 608
221 Ga0207427_102361 3300025231 Bacteria 5169
222 Ga0207425_1000020 3300025245 Bacteria 372623
223 Ga0209026_1005668 3300025250 Bacteria 3287
224 Ga0209148_1000112 3300025254 Bacteria 197101
225 Ga0209148_1001678 3300025254 Bacteria 9918
226 Ga0209129_1006432 3300025258 Bacteria 3792
227 Ga0209233_1000189 3300025261 Bacteria 131465
228 Ga0209565_1000054 3300025263 Bacteria 206016
229 Ga0209455_1002619 3300025272 Bacteria 6832
230 Ga0209676_1005291 3300025292 Bacteria 6804
231 Ga0209025_1006842 3300025294 Bacteria 8703
232 Ga0209564_1000565 3300025295 Bacteria 58712
233 Ga0209758_1000004 3300025297 Bacteria 1375322
234 Ga0209758_1024667 3300025297 Bacteria 2672
235 Ga0209050_1000001 3300025298 Bacteria 3563507
236 Ga0209050_1008535 3300025298 Bacteria 5449
237 Ga0209050_1048181 3300025298 Bacteria 1103
238 Ga0207426_1024269 3300025302 Bacteria 2060
239 Ga0209051_1000951 3300025303 Bacteria 28407
240 Ga0207697_10000413 3300025315 Bacteria 24173
241 Ga0207697_10052730 3300025315 Bacteria 1684
242 Ga0207713_1024951 3300025735 Bacteria 2771
243 Ga0207680_10000535 3300025903 Bacteria 18090
244 Ga0207680_10026800 3300025903 Bacteria 3199
245 Ga0207680_10454984 3300025903 Bacteria 909
246 Ga0207647_10001317 3300025904 Bacteria 19072
247 Ga0207647_10003339 3300025904 Bacteria 12043
248 Ga0207647_10005759 3300025904 Bacteria 9042
249 Ga0207647_10011008 3300025904 Bacteria 6363
250 Ga0207647_10017534 3300025904 Bacteria 4866
251 Ga0207645_10008956 3300025907 Bacteria 6948
252 Ga0207645_10512159 3300025907 Bacteria 813
253 Ga0207705_10000014 3300025909 Bacteria 434286
254 Ga0207705_10000117 3300025909 Bacteria 88666
255 Ga0207705_10022977 3300025909 Bacteria 4447
256 Ga0207705_10212725 3300025909 Bacteria 1467
257 Ga0207705_10826685 3300025909 Bacteria 718
258 Ga0207654_10060951 3300025911 Bacteria 2206
259 Ga0207695_10296108 3300025913 Bacteria 1510
260 Ga0207671_10066630 3300025914 Bacteria 2680
261 Ga0207671_10247681 3300025914 Bacteria 1401
262 Ga0207657_10000145 3300025919 Bacteria 72001
263 Ga0207657_10006094 3300025919 Bacteria 12538
264 Ga0207657_10017393 3300025919 Bacteria 6895
265 Ga0207657_10027429 3300025919 Bacteria 5216
266 Ga0207657_10028296 3300025919 Bacteria 5115
267 Ga0207649_10000018 3300025920 Bacteria 225137
268 Ga0207649_10346694 3300025920 Bacteria 1098
269 Ga0207681_10000030 3300025923 Bacteria 173766
270 Ga0207681_10041066 3300025923 Bacteria 3082
271 Ga0207694_10100081 3300025924 Bacteria 2296
272 Ga0207694_10189489 3300025924 Bacteria 1670
273 Ga0207650_10000057 3300025925 Bacteria 156913
274 Ga0207650_10001273 3300025925 Bacteria 18290
275 Ga0207650_10003128 3300025925 Bacteria 11399
276 Ga0207650_10273268 3300025925 Bacteria 1374
277 Ga0207659_10002618 3300025926 Bacteria 10712
278 Ga0207687_10008725 3300025927 Bacteria 6623
279 Ga0207644_10000017 3300025931 Bacteria 177818
280 Ga0207644_10000754 3300025931 Bacteria 20540
281 Ga0207644_10098333 3300025931 Bacteria 2193
282 Ga0207690_10007306 3300025932 Bacteria 6559
283 Ga0207690_10077798 3300025932 Bacteria 2307
284 Ga0207690_10643032 3300025932 Bacteria 869
285 Ga0207706_10003424 3300025933 Bacteria 15149
286 Ga0207706_10003480 3300025933 Bacteria 15024
287 Ga0207706_10006160 3300025933 Bacteria 11140
288 Ga0207706_10082272 3300025933 Bacteria 2830
289 Ga0207706_10091175 3300025933 Bacteria 2680
290 Ga0207706_10167134 3300025933 Bacteria 1933
291 Ga0207686_10001447 3300025934 Bacteria 13454
292 Ga0207709_10000122 3300025935 Bacteria 116068
293 Ga0207704_10000003 3300025938 Bacteria 285808
294 Ga0207691_10040717 3300025940 Bacteria 4292
295 Ga0207711_10000031 3300025941 Bacteria 203323
296 Ga0207711_10085382 3300025941 Bacteria 2766
297 Ga0207711_10349868 3300025941 Bacteria 1368
298 Ga0207689_10062452 3300025942 Bacteria 3064
299 Ga0207667_10000007 3300025949 Bacteria 630590
300 Ga0207667_10019916 3300025949 Bacteria 7476
301 Ga0207667_10608350 3300025949 Bacteria 1101
302 Ga0207651_10000003 3300025960 Bacteria 308050
303 Ga0207712_10000565 3300025961 Bacteria 29915
304 Ga0207712_10002695 3300025961 Bacteria 11335
305 Ga0207712_10265741 3300025961 Bacteria 1393
306 Ga0207668_10000006 3300025972 Bacteria 191468
307 Ga0207668_10000296 3300025972 Bacteria 32653
308 Ga0207668_10001238 3300025972 Bacteria 15207
309 Ga0207668_10007041 3300025972 Bacteria 6671
310 Ga0207668_10109505 3300025972 Bacteria 2069
311 Ga0207640_10000106 3300025981 Bacteria 63751
312 Ga0207640_10011715 3300025981 Bacteria 4972
313 Ga0207640_10041728 3300025981 Bacteria 2920
314 Ga0207658_10000026 3300025986 Bacteria 178292
315 Ga0207658_10000072 3300025986 Bacteria 112469
316 Ga0207658_10000901 3300025986 Bacteria 24758
317 Ga0207658_10063456 3300025986 Bacteria 2768
318 Ga0207677_10000364 3300026023 Bacteria 31713
319 Ga0207703_10000234 3300026035 Bacteria 63325
320 Ga0207703_10008520 3300026035 Bacteria 8100
321 Ga0207703_10010614 3300026035 Bacteria 7197
322 Ga0207639_10003148 3300026041 Bacteria 11093
323 Ga0207639_10003539 3300026041 Bacteria 10493
324 Ga0207639_10017177 3300026041 Bacteria 5128
325 Ga0207639_10134163 3300026041 Bacteria 2054
326 Ga0207639_10147065 3300026041 Bacteria 1970
327 Ga0207639_10327863 3300026041 Bacteria 1361
328 Ga0207678_10000239 3300026067 Bacteria 49386
329 Ga0207678_10004809 3300026067 Bacteria 12131
330 Ga0207702_10001635 3300026078 Bacteria 22162
331 Ga0207702_10012845 3300026078 Bacteria 6967
332 Ga0207702_10041044 3300026078 Bacteria 3879
333 Ga0207702_10399984 3300026078 Bacteria 1324
334 Ga0207702_10601626 3300026078 Bacteria 1079
335 Ga0207641_10000002 3300026088 Bacteria 981004
336 Ga0207641_10000096 3300026088 Bacteria 123585
337 Ga0207641_10000660 3300026088 Bacteria 37609
338 Ga0207641_10003011 3300026088 Bacteria 15212
339 Ga0207641_10045531 3300026088 Bacteria 3694
340 Ga0207641_10268033 3300026088 Bacteria 1601
341 Ga0207648_10000007 3300026089 Bacteria 217865
342 Ga0207676_10000005 3300026095 Bacteria 698744
343 Ga0207676_10033271 3300026095 Bacteria 3893
344 Ga0207674_10000748 3300026116 Bacteria 42600
345 Ga0207674_10011216 3300026116 Bacteria 10072
346 Ga0207674_10193095 3300026116 Bacteria 1986
347 Ga0207674_10581891 3300026116 Bacteria 1081
348 Ga0207675_100003556 3300026118 Bacteria 15186
349 Ga0207683_10008189 3300026121 Bacteria 8942
350 Ga0207698_10001842 3300026142 Bacteria 12384
351 Ga0207698_10002847 3300026142 Bacteria 10346
352 Ga0207698_10221031 3300026142 Bacteria 1712
353 Ga0207698_10233203 3300026142 Bacteria 1672
354 Ga0268266_10045782 3300028379 Bacteria 3744
355 Ga0268266_10514070 3300028379 Bacteria 1144
356 Ga0268265_10000003 3300028380 Bacteria 949201
357 Ga0268265_10000074 3300028380 Bacteria 127599
358 Ga0268265_10540090 3300028380 Bacteria 1105
359 Ga0268264_10000076 3300028381 Bacteria 255518
360 Ga0268264_10000215 3300028381 Bacteria 113994
361 Ga0268264_10000234 3300028381 Bacteria 105863
362 Ga0268264_10004464 3300028381 Bacteria 11937
363 Ga0307408_100030673 3300031548 Bacteria 3736
364 Ga0307408_100075951 3300031548 Bacteria 2497
365 Ga0307408_100075952 3300031548 Bacteria 2497
366 Ga0307405_10642447 3300031731 Bacteria 871
367 Ga0307413_10301563 3300031824 Bacteria 1215
368 Ga0307410_10339699 3300031852 Bacteria 1196
369 Ga0307407_10084953 3300031903 Bacteria 1925
370 Ga0307412_10008795 3300031911 Bacteria 5782
371 Ga0307412_10015491 3300031911 Bacteria 4523
372 Ga0307416_100156640 3300032002 Bacteria 2098
373 Ga0307416_100277726 3300032002 Bacteria 1649
374 Ga0307414_10007988 3300032004 Bacteria 5978
375 Ga0307414_10014236 3300032004 Bacteria 4760
376 Ga0307411_10567923 3300032005 Bacteria 970
377 Ga0373932_0096052 3300035112 Bacteria 958
378 Ga0395899_0008923 3300037312 Bacteria 7717
379 Ga0395900_0088897 3300037418 Bacteria 3176
380 Ga0395900_0219188 3300037418 Bacteria 1919
381 Ga0395898_0161258 3300037466 Bacteria 2145
382 Ga0395905_0062888 3300037471 Bacteria 3472
383 Ga0395905_0151490 3300037471 Bacteria 2182
384 Ga0395901_0207131 3300038443 Bacteria 2054
385 Ga0436365_0470828 3300039437 Bacteria 1204
386 Ga0436363_1006313 3300039450 Bacteria 2458
387 Ga0451793_0134365 3300041452 Bacteria 1501
388 Ga0451795_1205378 3300041456 Bacteria 1051
389 Ga0439448_0003009 3300042005 Bacteria 4627
390 Ga0439448_0008880 3300042005 Bacteria 2950
391 Ga0439455_0000374 3300042012 Bacteria 5863
392 Ga0439455_0001137 3300042012 Bacteria 4282
393 Ga0439458_0001462 3300042157 Bacteria 5953
394 Ga0439458_0049836 3300042157 Bacteria 1031
395 Ga0466972_0000763 3300044658 Bacteria 15353
396 Ga0466966_0032522 3300044684 Bacteria 3380
397 Ga0466961_0005830 3300044693 Bacteria 7807
398 Ga0466963_0150189 3300044694 Bacteria 1617
399 Ga0466964_0003769 3300044706 Bacteria 5558
400 Ga0466971_0227775 3300044719 Bacteria 884
401 Ga0466968_0005214 3300044735 Bacteria 4866
402 Ga0466970_0454284 3300044765 Bacteria 735
403 Ga0466970_0512751 3300044765 Bacteria 691
404 Ga0466970_0819581 3300044765 Bacteria 545
405 Ga0466959_0003329 3300045049 Bacteria 10498
406 Ga0466959_0139861 3300045049 Bacteria 1712
407 Ga0466958_0126097 3300045836 Bacteria 1605
408 Ga0466958_0161368 3300045836 Bacteria 1416
409 Ga0466967_0010561 3300045976 Bacteria 6935
410 Ga0495638_0088755 3300046460 Bacteria 1866
411 Ga0495650_0001110 3300046471 Bacteria 29443
412 Ga0495607_0013553 3300046501 Bacteria 5339
413 Ga0495583_0000201 3300046506 Bacteria 100380
414 Ga0495606_0000842 3300046507 Bacteria 46207
415 Ga0495606_0531614 3300046507 Bacteria 588
416 Ga0495616_0000013 3300046513 Bacteria 202334
417 Ga0495631_0149103 3300046518 Bacteria 1004
418 Ga0495597_0119210 3300046542 Bacteria 1101
419 Ga0495668_0012949 3300046616 Bacteria 4937
420 Ga0495668_0037013 3300046616 Bacteria 2732
421 Ga0495611_0059081 3300046648 Bacteria 1740
422 Ga0495625_0013101 3300046660 Bacteria 6680
423 Ga0495670_0045223 3300046691 Bacteria 2198
424 Ga0495671_0421637 3300046692 Bacteria 638
425 Ga0495673_0008417 3300047469 Bacteria 5811
426 Ga0495686_0001904 3300047472 Bacteria 20835
427 Ga0496100_0129814 3300048903 Bacteria 1774
428 Ga0496102_0000143 3300048905 Bacteria 96813
429 Ga0496102_0269558 3300048905 Bacteria 1605
430 Ga0496102_0641250 3300048905 Bacteria 985
431 Ga0496102_0798518 3300048905 Bacteria 866
432 Ga0496103_0000098 3300048906 Bacteria 96109
433 Ga0496103_0097653 3300048906 Bacteria 1857
434 Ga0496104_0544359 3300048907 Bacteria 1072
435 Ga0496105_0383760 3300048908 Bacteria 1118
436 Ga0496106_0801536 3300048909 Bacteria 747
437 Ga0496108_0000981 3300048911 Bacteria 22216
438 Ga0496108_0514070 3300048911 Bacteria 1046
439 Ga0496109_0049365 3300048912 Bacteria 3831
440 Ga0496110_0595291 3300048913 Bacteria 1003
441 Ga0496110_1081476 3300048913 Bacteria 710
442 Ga0496111_0572558 3300048914 Bacteria 828
443 Ga0496114_0105506 3300048917 Bacteria 2410
444 Ga0496115_0000390 3300048918 Bacteria 36134
445 Ga0496116_0001473 3300048919 Bacteria 26338
446 Ga0496117_0000121 3300048920 Bacteria 171532
447 Ga0496117_0011238 3300048920 Bacteria 8037
448 Ga0496117_0035779 3300048920 Bacteria 3723
449 Ga0496118_0000095 3300048921 Bacteria 164850
450 Ga0496118_0000332 3300048921 Bacteria 80480
451 Ga0496118_0025168 3300048921 Bacteria 5113
452 Ga0496118_0097297 3300048921 Bacteria 2003
453 Ga0496119_0017196 3300048922 Bacteria 5456
454 Ga0496119_0175708 3300048922 Bacteria 1127
455 Ga0496120_0071943 3300048923 Bacteria 1897
456 Ga0496120_0254284 3300048923 Bacteria 823
457 Ga0496121_0000065 3300048924 Bacteria 269310
458 Ga0496121_0000374 3300048924 Bacteria 92048
459 Ga0496121_0109082 3300048924 Bacteria 2116
460 Ga0496121_0143235 3300048924 Bacteria 1770
461 Ga0496122_0005310 3300048925 Bacteria 15411
462 Ga0496122_0011601 3300048925 Bacteria 8895
463 Ga0496122_0027245 3300048925 Bacteria 4891
464 Ga0496123_0000542 3300048926 Bacteria 64858
465 Ga0496123_0001988 3300048926 Bacteria 26435
466 Ga0496123_0007768 3300048926 Bacteria 9998
467 Ga0496123_0058582 3300048926 Bacteria 2497
468 Ga0496124_0000119 3300048927 Bacteria 163996
469 Ga0496124_0018990 3300048927 Bacteria 6416
470 Ga0496124_0140227 3300048927 Bacteria 1909
471 Ga0496125_0035768 3300048928 Bacteria 4349
472 Ga0496125_0056731 3300048928 Bacteria 3178
473 Ga0496125_0061061 3300048928 Bacteria 3026
474 Ga0496125_0102512 3300048928 Bacteria 2103
475 Ga0496125_0361157 3300048928 Bacteria 863
476 Ga0496126_0001546 3300048929 Bacteria 35366
477 Ga0496126_0006880 3300048929 Bacteria 12599
478 Ga0496126_0044827 3300048929 Bacteria 4070
479 Ga0496126_0172937 3300048929 Bacteria 1839
480 Ga0496126_0202687 3300048929 Bacteria 1674
481 Ga0496126_0399045 3300048929 Bacteria 1116
482 Ga0495682_0007900 3300049460 Bacteria 4209
483 Ga0501314_005309 3300049530 Bacteria 1093
484 Ga0501223_000119 3300049663 Bacteria 22652
485 Ga0501224_000022 3300049664 Bacteria 64882
486 Ga0501233_012795 3300049668 Bacteria 1690
487 Ga0501235_001874 3300049669 Bacteria 4496
488 Ga0501225_0000156 3300049705 Bacteria 20857
489 Ga0501234_003096 3300049707 Bacteria 2614
490 Ga0501241_074334 3300049758 Bacteria 699
491 Ga0501226_000086 3300049853 Bacteria 26253
492 Ga0500643_002288 3300053087 Bacteria 10045
493 Ga0500643_002495 3300053087 Bacteria 9439
494 Ga0500643_005735 3300053087 Bacteria 5298
495 Ga0500650_0035724 3300053098 Bacteria 2278
496 Ga0500555_000576 3300053103 Bacteria 14497
497 Ga0500556_0000053 3300053104 Bacteria 117389
498 Ga0500562_031703 3300053108 Bacteria 1395
499 Ga0500594_0000851 3300053118 Bacteria 6532
500 Ga0500618_012015 3300053125 Bacteria 2279
501 Ga0500642_0000001 3300053130 Bacteria 1468402
502 Ga0500559_0074987 3300053136 Bacteria 1529
503 Ga0500574_152801 3300053141 Bacteria 673
504 Ga0500577_0025420 3300053142 Bacteria 2004
505 Ga0500624_000060 3300053157 Bacteria 68534
506 Ga0500627_0037321 3300053158 Bacteria 2074
507 Ga0500636_0018272 3300053177 Bacteria 4145
508 Ga0500636_0055301 3300053177 Bacteria 2326
509 Ga0500645_001607 3300053730 Bacteria 11206
510 Ga0500587_041376 3300053739 Bacteria 661
511 Ga0466962_0017953 3300061719 Bacteria 3404
512 2885430418 2885429604 Bacteria 3642894
513 2928028727 2928027323 Bacteria 4382488
514 2946787898 2946787523 Bacteria 4366789
515 2984555446 2984555340 Bacteria 4247089
516 2984566417 2984564862 Bacteria 4339992
517 2993357456 2993356040 Bacteria 4247105
518 Ga0495671_0023369
519 SwRhRL2b_contig_1141627
520 JGI24741J21665_1000059
521 JGI24741J21665_1007304
522 JGI24752J21851_1001321
523 JGI24752J21851_1009789
524 JGI24740J21852_10019680
525 JGI24740J21852_10026617
526 JGI24740J21852_10045940
527 JGI24739J22299_10001746
528 JGI24739J22299_10001909
529 JGI24739J22299_10007878
530 JGI24739J22299_10011810
531 JGI24737J22298_10004672
532 JGI24737J22298_10009590
533 JGI24737J22298_10011532
534 JGI24737J22298_10013167
535 JGI24743J22301_10082024
536 JGI24735J21928_10001274
537 JGI24735J21928_10010421
538 JGI24735J21928_10017800
539 JGI24735J21928_10032985
540 JGI24735J21928_10036532
541 JGI24738J21930_10000046
542 JGI24738J21930_10016807
543 JGI24738J21930_10024487
544 JGI24738J21930_10088782
545 JGI24738J21930_10103909
546 JGI24744J21845_10000962
547 JGI24751J29686_10023928
548 JGI25150J39212_1000082
549 JGI25151J46595_10017607
550 JGI25165J46597_1000124
551 JGI25153J46596_10000029
552 rootH1_10114615
553 rootL2_10121722
554 Ga0055529_1009077
555 Ga0055526_1005229
556 Ga0055537_1003772
557 Ga0055536_1023316
558 Ga0055530_10012993
559 Ga0055540_1001389
560 Ga0065704_10082659
561 Ga0070658_10000057
562 Ga0070658_10000240
563 Ga0070658_10108683
564 Ga0070658_10229766
565 Ga0070658_10556648
566 Ga0070676_10035721
567 Ga0070676_10201159
568 Ga0070670_100000016
569 Ga0070670_100002773
570 Ga0068869_100000304
571 Ga0070666_10000273
572 Ga0070666_10000551
573 Ga0070666_10500080
574 Ga0068868_100000003
575 Ga0070660_100002242
576 Ga0070660_100004311
577 Ga0070660_100019313
578 Ga0070660_100036549
579 Ga0070661_100000001
580 Ga0070661_100396187
581 Ga0070661_100422033
582 Ga0070668_100000003
583 Ga0070668_100000019
584 Ga0070668_100004026
585 Ga0070668_100123970
586 Ga0070669_100000096
587 Ga0070669_100555790
588 Ga0070675_100003521
589 Ga0070671_100000045
590 Ga0070671_100000645
591 Ga0070671_100038715
592 Ga0070671_100241306
593 Ga0070674_100542772
594 Ga0070673_100000008
595 Ga0070659_100006974
596 Ga0070659_100056905
597 Ga0070659_100106332
598 Ga0070659_100135635
599 Ga0070659_100303951
600 Ga0070667_100000035
601 Ga0070667_100000094
602 Ga0070667_100000111
603 Ga0070667_100000425
604 Ga0070667_100041822
605 Ga0070708_100126989
606 Ga0070663_100010688
607 Ga0070663_100078289
608 Ga0070678_100002275
609 Ga0070662_100028203
610 Ga0070662_100039860
611 Ga0070662_100110775
612 Ga0070662_100118443
613 Ga0070662_100245156
614 Ga0068867_100000003
615 Ga0068853_100002796
616 Ga0068853_100018954
617 Ga0068853_100032036
618 Ga0068853_100240549
619 Ga0068853_100240559
620 Ga0070672_100042621
621 Ga0070686_100926854
622 Ga0070693_100018489
623 Ga0070665_100039230
624 Ga0070665_100493225
625 Ga0070665_100665707
626 Ga0068855_100000775
627 Ga0068855_100031119
628 Ga0068855_100114905
629 Ga0068855_100212704
630 Ga0068855_100234617
631 Ga0070664_100168590
632 Ga0070664_100480849
633 Ga0068857_100029421
634 Ga0068857_100056225
635 Ga0068857_100180327
636 Ga0068857_100368764
637 Ga0068857_100616456
638 Ga0068857_100799170
639 Ga0068854_100000580
640 Ga0068854_100037313
641 Ga0068854_101690056
642 Ga0068856_100010236
643 Ga0068856_100017188
644 Ga0068856_100202500
645 Ga0068856_100650946
646 Ga0068856_100682740
647 Ga0068852_100002650
648 Ga0068852_100102624
649 Ga0068852_100736406
650 Ga0068859_100000162
651 Ga0068859_100008180
652 Ga0068859_100015437
653 Ga0068859_100227875
654 Ga0068864_100000017
655 Ga0068864_100045589
656 Ga0068861_100047846
657 Ga0068851_10026055
658 Ga0068851_10126074
659 Ga0068851_10192205
660 Ga0068863_100000018
661 Ga0068863_100000057
662 Ga0068863_100007931
663 Ga0068863_100057980
664 Ga0068863_100183950
665 Ga0068863_100604882
666 Ga0068858_100000954
667 Ga0068858_100009859
668 Ga0068858_100043604
669 Ga0068860_100000143
670 Ga0068860_100000176
671 Ga0068860_100018257
672 Ga0068860_100092476
673 Ga0068862_100000010
674 Ga0068862_100000168
675 Ga0068862_100001062
676 Ga0097621_100002111
677 Ga0075370_10056151
678 Ga0068871_100144562
679 Ga0068865_100000002
680 Ga0097620_100000162
681 Ga0097620_100008180
682 Ga0097620_100015437
683 Ga0097620_100227876
684 Ga0105251_10002120
685 Ga0105240_10212646
686 Ga0105240_10375990
687 Ga0105240_10888461
688 Ga0105245_10000060
689 Ga0105247_10002007
690 Ga0105247_10005739
691 Ga0105243_10000031
692 Ga0105241_10012470
693 Ga0105242_10002064
694 Ga0105248_10000105
695 Ga0105248_10059315
696 Ga0105248_10061601
697 Ga0105237_10012606
698 Ga0105237_10047388
699 Ga0105237_10140995
700 Ga0105237_10341274
701 Ga0105238_10119763
702 Ga0105249_10000726
703 Ga0105249_10006675
704 Ga0105249_10015591
705 Ga0105239_10098456
706 Ga0105239_10334964
707 Ga0105239_11228159
708 Ga0105239_11682002
709 Ga0105246_10016791
710 Ga0157373_10016737
711 Ga0157373_10342218
712 Ga0157371_10320927
713 Ga0157371_10363587
714 Ga0157370_10002244
715 Ga0157370_10067462
716 Ga0157369_10073034
717 Ga0157369_10256159
718 Ga0157369_10287391
719 Ga0157374_10000105
720 Ga0157374_10192124
721 Ga0157378_10001674
722 Ga0163162_10013622
723 Ga0163162_10029572
724 Ga0163162_10087987
725 Ga0157372_10002932
726 Ga0157372_10479842
727 Ga0157372_10821618
728 Ga0157372_11429678
729 Ga0157375_10000564
730 Ga0163163_10256422
731 Ga0163163_10281245
732 Ga0157380_10550172
733 Ga0157379_10161363
734 Ga0157379_10175008
735 Ga0157376_10034714
736 Ga0163161_10095917
737 Ga0206352_10857486
738 Ga0207427_102361
739 Ga0207425_1000020
740 Ga0209026_1005668
741 Ga0209148_1000112
742 Ga0209148_1001678
743 Ga0209129_1006432
744 Ga0209233_1000189
745 Ga0209565_1000054
746 Ga0209455_1002619
747 Ga0209676_1005291
748 Ga0209025_1006842
749 Ga0209564_1000565
750 Ga0209758_1000004
751 Ga0209758_1024667
752 Ga0209050_1000001
753 Ga0209050_1008535
754 Ga0209050_1048181
755 Ga0207426_1024269
756 Ga0209051_1000951
757 Ga0207697_10000413
758 Ga0207697_10052730
759 Ga0207713_1024951
760 Ga0207680_10000535
761 Ga0207680_10026800
762 Ga0207680_10454984
763 Ga0207647_10001317
764 Ga0207647_10003339
765 Ga0207647_10005759
766 Ga0207647_10011008
767 Ga0207647_10017534
768 Ga0207645_10008956
769 Ga0207645_10512159
770 Ga0207705_10000014
771 Ga0207705_10000117
772 Ga0207705_10022977
773 Ga0207705_10212725
774 Ga0207705_10826685
775 Ga0207654_10060951
776 Ga0207695_10296108
777 Ga0207671_10066630
778 Ga0207671_10247681
779 Ga0207657_10000145
780 Ga0207657_10006094
781 Ga0207657_10017393
782 Ga0207657_10027429
783 Ga0207657_10028296
784 Ga0207649_10000018
785 Ga0207649_10346694
786 Ga0207681_10000030
787 Ga0207681_10041066
788 Ga0207694_10100081
789 Ga0207694_10189489
790 Ga0207650_10000057
791 Ga0207650_10001273
792 Ga0207650_10003128
793 Ga0207650_10273268
794 Ga0207659_10002618
795 Ga0207687_10008725
796 Ga0207644_10000017
797 Ga0207644_10000754
798 Ga0207644_10098333
799 Ga0207690_10007306
800 Ga0207690_10077798
801 Ga0207690_10643032
802 Ga0207706_10003424
803 Ga0207706_10003480
804 Ga0207706_10006160
805 Ga0207706_10082272
806 Ga0207706_10091175
807 Ga0207706_10167134
808 Ga0207686_10001447
809 Ga0207709_10000122
810 Ga0207704_10000003
811 Ga0207691_10040717
812 Ga0207711_10000031
813 Ga0207711_10085382
814 Ga0207711_10349868
815 Ga0207689_10062452
816 Ga0207667_10000007
817 Ga0207667_10019916
818 Ga0207667_10608350
819 Ga0207651_10000003
820 Ga0207712_10000565
821 Ga0207712_10002695
822 Ga0207712_10265741
823 Ga0207668_10000006
824 Ga0207668_10000296
825 Ga0207668_10001238
826 Ga0207668_10007041
827 Ga0207668_10109505
828 Ga0207640_10000106
829 Ga0207640_10011715
830 Ga0207640_10041728
831 Ga0207658_10000026
832 Ga0207658_10000072
833 Ga0207658_10000901
834 Ga0207658_10063456
835 Ga0207677_10000364
836 Ga0207703_10000234
837 Ga0207703_10008520
838 Ga0207703_10010614
839 Ga0207639_10003148
840 Ga0207639_10003539
841 Ga0207639_10017177
842 Ga0207639_10134163
843 Ga0207639_10147065
844 Ga0207639_10327863
845 Ga0207678_10000239
846 Ga0207678_10004809
847 Ga0207702_10001635
848 Ga0207702_10012845
849 Ga0207702_10041044
850 Ga0207702_10399984
851 Ga0207702_10601626
852 Ga0207641_10000002
853 Ga0207641_10000096
854 Ga0207641_10000660
855 Ga0207641_10003011
856 Ga0207641_10045531
857 Ga0207641_10268033
858 Ga0207648_10000007
859 Ga0207676_10000005
860 Ga0207676_10033271
861 Ga0207674_10000748
862 Ga0207674_10011216
863 Ga0207674_10193095
864 Ga0207674_10581891
865 Ga0207675_100003556
866 Ga0207683_10008189
867 Ga0207698_10001842
868 Ga0207698_10002847
869 Ga0207698_10221031
870 Ga0207698_10233203
871 Ga0268266_10045782
872 Ga0268266_10514070
873 Ga0268265_10000003
874 Ga0268265_10000074
875 Ga0268265_10540090
876 Ga0268264_10000076
877 Ga0268264_10000215
878 Ga0268264_10000234
879 Ga0268264_10004464
880 Ga0307408_100030673
881 Ga0307408_100075951
882 Ga0307408_100075952
883 Ga0307405_10642447
884 Ga0307413_10301563
885 Ga0307410_10339699
886 Ga0307407_10084953
887 Ga0307412_10008795
888 Ga0307412_10015491
889 Ga0307416_100156640
890 Ga0307416_100277726
891 Ga0307414_10007988
892 Ga0307414_10014236
893 Ga0307411_10567923
894 Ga0373932_0096052
895 Ga0395899_0008923
896 Ga0395900_0088897
897 Ga0395900_0219188
898 Ga0395898_0161258
899 Ga0395905_0062888
900 Ga0395905_0151490
901 Ga0395901_0207131
902 Ga0436365_0470828
903 Ga0436363_1006313
904 Ga0451793_0134365
905 Ga0451795_1205378
906 Ga0439448_0003009
907 Ga0439448_0008880
908 Ga0439455_0000374
909 Ga0439455_0001137
910 Ga0439458_0001462
911 Ga0439458_0049836
912 Ga0466972_0000763
913 Ga0466966_0032522
914 Ga0466961_0005830
915 Ga0466963_0150189
916 Ga0466964_0003769
917 Ga0466971_0227775
918 Ga0466968_0005214
919 Ga0466970_0454284
920 Ga0466970_0512751
921 Ga0466970_0819581
922 Ga0466959_0003329
923 Ga0466959_0139861
924 Ga0466958_0126097
925 Ga0466958_0161368
926 Ga0466967_0010561
927 Ga0495638_0088755
928 Ga0495650_0001110
929 Ga0495607_0013553
930 Ga0495583_0000201
931 Ga0495606_0000842
932 Ga0495606_0531614
933 Ga0495616_0000013
934 Ga0495631_0149103
935 Ga0495597_0119210
936 Ga0495668_0012949
937 Ga0495668_0037013
938 Ga0495611_0059081
939 Ga0495625_0013101
940 Ga0495670_0045223
941 Ga0495671_0421637
942 Ga0495673_0008417
943 Ga0495686_0001904
944 Ga0496100_0129814
945 Ga0496102_0000143
946 Ga0496102_0269558
947 Ga0496102_0641250
948 Ga0496102_0798518
949 Ga0496103_0000098
950 Ga0496103_0097653
951 Ga0496104_0544359
952 Ga0496105_0383760
953 Ga0496106_0801536
954 Ga0496108_0000981
955 Ga0496108_0514070
956 Ga0496109_0049365
957 Ga0496110_0595291
958 Ga0496110_1081476
959 Ga0496111_0572558
960 Ga0496114_0105506
961 Ga0496115_0000390
962 Ga0496116_0001473
963 Ga0496117_0000121
964 Ga0496117_0011238
965 Ga0496117_0035779
966 Ga0496118_0000095
967 Ga0496118_0000332
968 Ga0496118_0025168
969 Ga0496118_0097297
970 Ga0496119_0017196
971 Ga0496119_0175708
972 Ga0496120_0071943
973 Ga0496120_0254284
974 Ga0496121_0000065
975 Ga0496121_0000374
976 Ga0496121_0109082
977 Ga0496121_0143235
978 Ga0496122_0005310
979 Ga0496122_0011601
980 Ga0496122_0027245
981 Ga0496123_0000542
982 Ga0496123_0001988
983 Ga0496123_0007768
984 Ga0496123_0058582
985 Ga0496124_0000119
986 Ga0496124_0018990
987 Ga0496124_0140227
988 Ga0496125_0035768
989 Ga0496125_0056731
990 Ga0496125_0061061
991 Ga0496125_0102512
992 Ga0496125_0361157
993 Ga0496126_0001546
994 Ga0496126_0006880
995 Ga0496126_0044827
996 Ga0496126_0172937
997 Ga0496126_0202687
998 Ga0496126_0399045
999 Ga0495682_0007900
1000 Ga0501314_005309
1001 Ga0501223_000119
1002 Ga0501224_000022
1003 Ga0501233_012795
1004 Ga0501235_001874
1005 Ga0501225_0000156
1006 Ga0501234_003096
1007 Ga0501241_074334
1008 Ga0501226_000086
1009 Ga0500643_002288
1010 Ga0500643_002495
1011 Ga0500643_005735
1012 Ga0500650_0035724
1013 Ga0500555_000576
1014 Ga0500556_0000053
1015 Ga0500562_031703
1016 Ga0500594_0000851
1017 Ga0500618_012015
1018 Ga0500642_0000001
1019 Ga0500559_0074987
1020 Ga0500574_152801
1021 Ga0500577_0025420
1022 Ga0500624_000060
1023 Ga0500627_0037321
1024 Ga0500636_0018272
1025 Ga0500636_0055301
1026 Ga0500645_001607
1027 Ga0500587_041376
1028 Ga0466962_0017953
1029 2885430418
1030 2928028727
1031 2946787898
1032 2984555446
1033 2984566417
1034 2993357456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02556

SecB

Preprotein translocase subunit SecB

38

178

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.9554 27 156
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.9346 27 156
1ozb-assembly2.cif.gz_G crystal structure of secb complexed with seca c-terminus 0.9325 26 158
1fx3-assembly1.cif.gz_D crystal structure of h. influenzae secb 0.9281 27 158
1ozb-assembly1.cif.gz_A crystal structure of secb complexed with seca c-terminus 0.9195 27 167
ID Description Score Start End Superfamily
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.9372 27 159 3.10.420.10
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.9111 27 159 3.10.420.10
af_Q57803_2_154_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.802 28 165 3.10.420.10
5jtlB00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7862 24 171 3.10.420.10
af_P95257_21_163_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7484 27 148 3.10.420.10
ID Description Score Start End GO Terms
AF-A0A839YP30-F1-model_v4 Protein-export protein SecB 0.9872 20 160 GO:0005737
GO:0006457
GO:0015031
GO:0051082
GO:0051262
AF-A0A7W7AIP9-F1-model_v4 Protein-export protein SecB 0.974 20 172 GO:0005737
GO:0006457
GO:0015031
GO:0051082
GO:0051262
AF-A0A891X7P2-F1-model_v4 deleted 0.9726 21 163
AF-A0A836ZQ31-F1-model_v4 Preprotein translocase subunit SecB 0.9708 22 164 GO:0015031
GO:0051082
GO:0051262
AF-A0A258AF04-F1-model_v4 deleted 0.9702 26 150

Map