F458117

General Info

Members Datasets Scaffolds Average Seq Length
517 276 1034 240

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10283478|Ga0075364_102834781
Length 290
Sequence VSGVLRDAEAVAAGQARPGRRRLFKRGDTAVSEKARFLVCEAMSGHSKWASIKHKKAATDARRGQLFTKLARAITVAAREGGGDPEANYTLAAAVQKARDYSMPKDSIQRAIDRGTGAAGGETIDRIVYEGYGPAGVAVLVEALTDNRNRTSADMRHVFDKHGGSLGEPGSVAWVFEKRGVVMVGADRYSEDDLIVAIDAGAEDVSREGDSLKVVSAAEDLAAVRKALEEAGVDIESAELTMEPKNVVEVKGADAAAVMRLMDALDDEDDVEAVHANFDIPAEVLEEIAA

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
166 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
270 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 0
Rhizoplane 6
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10283478 3300006051 Bacteria 1127
2 JGI24740J21852_10019188 3300001979 Bacteria 2413
3 JGI25404J52841_10002165 3300003659 Bacteria 3668
4 Ga0070658_10016785 3300005327 Bacteria 5862
5 Ga0070683_100006889 3300005329 Bacteria 9547
6 Ga0070683_100040821 3300005329 Bacteria 4266
7 Ga0070683_100057003 3300005329 Bacteria 3629
8 Ga0070683_100271123 3300005329 Bacteria 1614
9 Ga0070690_100121529 3300005330 Bacteria 1753
10 Ga0070670_100065738 3300005331 Bacteria 3112
11 Ga0070670_100582657 3300005331 Bacteria 1000
12 Ga0070682_100000011 3300005337 Bacteria 266253
13 Ga0070682_100043711 3300005337 Bacteria 2771
14 Ga0070660_100027788 3300005339 Bacteria 4226
15 Ga0070689_100006918 3300005340 Bacteria 7896
16 Ga0070689_100169154 3300005340 Bacteria 1770
17 Ga0070691_10000138 3300005341 Bacteria 22836
18 Ga0070691_10032793 3300005341 Bacteria 2442
19 Ga0070691_10237279 3300005341 Bacteria 973
20 Ga0070661_100000058 3300005344 Bacteria 87363
21 Ga0070661_100036531 3300005344 Bacteria 3572
22 Ga0070692_10035562 3300005345 Bacteria 2523
23 Ga0070668_100011596 3300005347 Bacteria 6561
24 Ga0070668_100053864 3300005347 Bacteria 3102
25 Ga0070668_100160683 3300005347 Bacteria 1823
26 Ga0070675_100000036 3300005354 Bacteria 85959
27 Ga0070675_100194850 3300005354 Bacteria 1757
28 Ga0070674_100019638 3300005356 Bacteria 4297
29 Ga0070688_100000360 3300005365 Bacteria 23047
30 Ga0070688_100129950 3300005365 Bacteria 1698
31 Ga0070659_100019249 3300005366 Bacteria 5169
32 Ga0070659_100259950 3300005366 Bacteria 1440
33 Ga0070667_100001076 3300005367 Bacteria 24988
34 Ga0070667_100041329 3300005367 Bacteria 3869
35 Ga0070667_100453369 3300005367 Bacteria 1172
36 Ga0070714_100050426 3300005435 Bacteria 3546
37 Ga0070713_100000047 3300005436 Bacteria 76760
38 Ga0070700_100026150 3300005441 Bacteria 3443
39 Ga0070694_100484201 3300005444 Bacteria 982
40 Ga0070663_100001923 3300005455 Bacteria 11604
41 Ga0070663_100353116 3300005455 Bacteria 1191
42 Ga0068867_100399500 3300005459 Bacteria 1159
43 Ga0070685_10000019 3300005466 Bacteria 105881
44 Ga0070685_10000020 3300005466 Bacteria 104332
45 Ga0070685_10031452 3300005466 Bacteria 2965
46 Ga0070685_10047925 3300005466 Bacteria 2459
47 Ga0070679_100012803 3300005530 Bacteria 8026
48 Ga0070684_100212156 3300005535 Bacteria 1764
49 Ga0070684_100217809 3300005535 Bacteria 1741
50 Ga0070684_100347584 3300005535 Bacteria 1364
51 Ga0070697_100122493 3300005536 Bacteria 2176
52 Ga0068853_100099356 3300005539 Bacteria 2571
53 Ga0070672_100000001 3300005543 Bacteria 204624
54 Ga0070686_100062261 3300005544 Bacteria 2414
55 Ga0070695_100133859 3300005545 Bacteria 1711
56 Ga0070665_100028178 3300005548 Bacteria 5656
57 Ga0070665_100045460 3300005548 Bacteria 4409
58 Ga0070665_100072288 3300005548 Bacteria 3457
59 Ga0070665_100242923 3300005548 Bacteria 1801
60 Ga0070704_100224779 3300005549 Bacteria 1528
61 Ga0068854_100000097 3300005578 Bacteria 61139
62 Ga0068854_100240986 3300005578 Bacteria 1440
63 Ga0068856_100002498 3300005614 Bacteria 18913
64 Ga0068856_100013571 3300005614 Bacteria 7887
65 Ga0070702_100028208 3300005615 Bacteria 3041
66 Ga0068852_100000002 3300005616 Bacteria 268221
67 Ga0068864_100036710 3300005618 Bacteria 4179
68 Ga0068866_10257342 3300005718 Bacteria 1071
69 Ga0068861_100111353 3300005719 Bacteria 2194
70 Ga0068851_10000730 3300005834 Bacteria 14041
71 Ga0068851_10063187 3300005834 Bacteria 1901
72 Ga0068858_100215249 3300005842 Bacteria 1819
73 Ga0068858_100475426 3300005842 Bacteria 1206
74 Ga0068860_100030106 3300005843 Bacteria 5221
75 Ga0068862_100023531 3300005844 Bacteria 5163
76 Ga0081455_10019712 3300005937 Bacteria 6370
77 Ga0081455_10041657 3300005937 Bacteria 4036
78 Ga0081538_10066111 3300005981 Bacteria 2030
79 Ga0081540_1000100 3300005983 Bacteria 91640
80 Ga0081539_10002227 3300005985 Bacteria 28283
81 Ga0075365_10009351 3300006038 Bacteria 5627
82 Ga0075365_10126579 3300006038 Bacteria 1766
83 Ga0075368_10032143 3300006042 Bacteria 2037
84 Ga0075363_100096258 3300006048 Bacteria 1634
85 Ga0075364_10009348 3300006051 Bacteria 5875
86 Ga0075364_10011967 3300006051 Bacteria 5288
87 Ga0075364_10048289 3300006051 Bacteria 2773
88 Ga0075364_10221552 3300006051 Bacteria 1284
89 Ga0075432_10018411 3300006058 Bacteria 2383
90 Ga0070716_100028893 3300006173 Bacteria 2992
91 Ga0070712_100079139 3300006175 Bacteria 2375
92 Ga0075367_10208046 3300006178 Bacteria 1223
93 Ga0075367_10240808 3300006178 Bacteria 1134
94 Ga0097621_100174435 3300006237 Bacteria 1855
95 Ga0075428_100000660 3300006844 Bacteria 35436
96 Ga0075428_100151561 3300006844 Bacteria 2519
97 Ga0075428_100824111 3300006844 Bacteria 986
98 Ga0075430_100001548 3300006846 Bacteria 18796
99 Ga0075430_100324701 3300006846 Bacteria 1272
100 Ga0075431_100000197 3300006847 Bacteria 44284
101 Ga0075431_100040949 3300006847 Bacteria 4776
102 Ga0075433_10013700 3300006852 Bacteria 6602
103 Ga0075433_10060052 3300006852 Bacteria 3328
104 Ga0075434_100024155 3300006871 Bacteria 5939
105 Ga0075429_100001353 3300006880 Bacteria 20029
106 Ga0068865_100000013 3300006881 Bacteria 141352
107 Ga0068865_100015130 3300006881 Bacteria 4916
108 Ga0111539_10012209 3300009094 Bacteria 10774
109 Ga0111539_10042802 3300009094 Bacteria 5434
110 Ga0111539_10048618 3300009094 Bacteria 5063
111 Ga0111539_10362641 3300009094 Bacteria 1687
112 Ga0105245_10000125 3300009098 Bacteria 73764
113 Ga0105245_10006331 3300009098 Bacteria 10415
114 Ga0105245_10296165 3300009098 Bacteria 1586
115 Ga0105245_10309431 3300009098 Bacteria 1553
116 Ga0105247_10001978 3300009101 Bacteria 14224
117 Ga0105247_10147831 3300009101 Bacteria 1546
118 Ga0114129_10003535 3300009147 Bacteria 21988
119 Ga0114129_10022808 3300009147 Bacteria 8875
120 Ga0114129_10026568 3300009147 Bacteria 8199
121 Ga0105243_10028685 3300009148 Bacteria 4274
122 Ga0105243_10029327 3300009148 Bacteria 4230
123 Ga0105242_10000908 3300009176 Bacteria 23020
124 Ga0105242_10493606 3300009176 Bacteria 1163
125 Ga0105248_10000020 3300009177 Bacteria 284637
126 Ga0105248_10292474 3300009177 Bacteria 1834
127 Ga0105237_10215793 3300009545 Bacteria 1919
128 Ga0105238_10165299 3300009551 Bacteria 2188
129 Ga0105249_10003509 3300009553 Bacteria 13564
130 Ga0105249_10059287 3300009553 Bacteria 3510
131 Ga0105249_10101411 3300009553 Bacteria 2707
132 Ga0105239_10029010 3300010375 Bacteria 6082
133 Ga0105239_10098069 3300010375 Bacteria 3239
134 Ga0105239_10577039 3300010375 Bacteria 1282
135 Ga0105246_10036885 3300011119 Bacteria 3277
136 Ga0157371_10001577 3300013102 Bacteria 23401
137 Ga0157370_10002971 3300013104 Bacteria 20162
138 Ga0157370_10114257 3300013104 Bacteria 2522
139 Ga0157369_10000307 3300013105 Bacteria 65486
140 Ga0157374_10842737 3300013296 Bacteria 933
141 Ga0157378_10027515 3300013297 Bacteria 5017
142 Ga0157378_10057890 3300013297 Bacteria 3455
143 Ga0157378_10073549 3300013297 Bacteria 3073
144 Ga0163162_10308767 3300013306 Bacteria 1714
145 Ga0163162_10324673 3300013306 Bacteria 1671
146 Ga0157372_10000053 3300013307 Bacteria 128824
147 Ga0157375_10291123 3300013308 Unclassified 1796
148 Ga0163163_10257223 3300014325 Bacteria 1797
149 Ga0163163_10431936 3300014325 Bacteria 1376
150 Ga0157380_10000016 3300014326 Bacteria 126029
151 Ga0157380_10092052 3300014326 Bacteria 2504
152 Ga0157377_10164762 3300014745 Bacteria 1381
153 Ga0157379_10059769 3300014968 Bacteria 3408
154 Ga0157376_10020564 3300014969 Bacteria 5109
155 Ga0157376_10056242 3300014969 Bacteria 3286
156 Ga0163161_10047839 3300017792 Bacteria 3088
157 Ga0206353_11016966 3300020082 Bacteria 2209
158 Ga0207656_10000211 3300025321 Bacteria 20768
159 Ga0207656_10052159 3300025321 Bacteria 1771
160 Ga0207710_10000821 3300025900 Bacteria 16775
161 Ga0207688_10022385 3300025901 Bacteria 3458
162 Ga0207695_10188274 3300025913 Bacteria 1982
163 Ga0207693_10069081 3300025915 Bacteria 2765
164 Ga0207693_10666446 3300025915 Bacteria 807
165 Ga0207663_10033961 3300025916 Bacteria 3045
166 Ga0207662_10052373 3300025918 Bacteria 2429
167 Ga0207657_10001009 3300025919 Bacteria 29964
168 Ga0207657_10359148 3300025919 Bacteria 1148
169 Ga0207649_10000283 3300025920 Bacteria 39628
170 Ga0207649_10245901 3300025920 Bacteria 1286
171 Ga0207652_10008840 3300025921 Bacteria 8115
172 Ga0207652_10901154 3300025921 Bacteria 781
173 Ga0207650_10187297 3300025925 Bacteria 1652
174 Ga0207650_10479609 3300025925 Bacteria 1038
175 Ga0207659_10000013 3300025926 Bacteria 172742
176 Ga0207659_10392604 3300025926 Bacteria 1159
177 Ga0207687_10000017 3300025927 Bacteria 237310
178 Ga0207687_10001648 3300025927 Bacteria 15405
179 Ga0207687_10282521 3300025927 Bacteria 1331
180 Ga0207700_10000033 3300025928 Bacteria 123113
181 Ga0207706_10189641 3300025933 Bacteria 1805
182 Ga0207686_10098091 3300025934 Bacteria 1950
183 Ga0207709_10019598 3300025935 Bacteria 3808
184 Ga0207670_10005811 3300025936 Bacteria 6811
185 Ga0207669_10390272 3300025937 Bacteria 1087
186 Ga0207704_10000040 3300025938 Bacteria 90178
187 Ga0207665_10041758 3300025939 Bacteria 3065
188 Ga0207691_10000017 3300025940 Bacteria 134441
189 Ga0207711_10000006 3300025941 Bacteria 792692
190 Ga0207689_10211509 3300025942 Bacteria 1602
191 Ga0207661_10000198 3300025944 Bacteria 39018
192 Ga0207661_10029396 3300025944 Bacteria 4220
193 Ga0207661_10039828 3300025944 Bacteria 3691
194 Ga0207661_10058813 3300025944 Bacteria 3095
195 Ga0207661_10115700 3300025944 Bacteria 2275
196 Ga0207679_10347264 3300025945 Bacteria 1292
197 Ga0207651_10384453 3300025960 Bacteria 1190
198 Ga0207712_10007734 3300025961 Bacteria 6796
199 Ga0207712_10109368 3300025961 Bacteria 2070
200 Ga0207668_10005384 3300025972 Bacteria 7532
201 Ga0207668_10062039 3300025972 Bacteria 2631
202 Ga0207640_10000370 3300025981 Bacteria 29030
203 Ga0207640_10092120 3300025981 Bacteria 2102
204 Ga0207658_10003877 3300025986 Bacteria 10532
205 Ga0207658_10103056 3300025986 Bacteria 2239
206 Ga0207703_10620207 3300026035 Bacteria 1024
207 Ga0207639_10015804 3300026041 Bacteria 5329
208 Ga0207678_10002796 3300026067 Bacteria 15837
209 Ga0207678_10039573 3300026067 Bacteria 4092
210 Ga0207678_10335426 3300026067 Bacteria 1302
211 Ga0207708_10002157 3300026075 Bacteria 14531
212 Ga0207708_10136947 3300026075 Bacteria 1918
213 Ga0207702_10000637 3300026078 Bacteria 38379
214 Ga0207702_10018008 3300026078 Bacteria 5847
215 Ga0207648_10149355 3300026089 Bacteria 2061
216 Ga0207674_10601725 3300026116 Bacteria 1062
217 Ga0207675_100059424 3300026118 Bacteria 3567
218 Ga0207675_100200268 3300026118 Bacteria 1918
219 Ga0207683_10092425 3300026121 Bacteria 2696
220 Ga0207698_10000004 3300026142 Bacteria 313614
221 Ga0207698_10035678 3300026142 Bacteria 3641
222 Ga0209970_1024300 3300027614 Bacteria 1035
223 Ga0209813_10062724 3300027866 Bacteria 1190
224 Ga0209974_10043444 3300027876 Bacteria 1498
225 Ga0207428_10021603 3300027907 Bacteria 5447
226 Ga0207428_10086741 3300027907 Bacteria 2436
227 Ga0268266_10000601 3300028379 Bacteria 49250
228 Ga0268266_10001254 3300028379 Bacteria 31003
229 Ga0268266_10030794 3300028379 Bacteria 4557
230 Ga0268266_10265674 3300028379 Bacteria 1591
231 Ga0268266_10765493 3300028379 Bacteria 932
232 Ga0268265_10004453 3300028380 Bacteria 9721
233 Ga0268265_10740380 3300028380 Bacteria 953
234 Ga0268264_10127452 3300028381 Bacteria 2252
235 Ga0265326_10045819 3300028558 Bacteria 1240
236 Ga0265319_1000469 3300028563 Bacteria 28589
237 Ga0265338_10000244 3300028800 Bacteria 100528
238 Ga0265324_10058844 3300029957 Bacteria 1314
239 Ga0265330_10001216 3300031235 Bacteria 15196
240 Ga0265329_10098654 3300031242 Unclassified 929
241 Ga0265331_10011583 3300031250 Bacteria 4824
242 Ga0316576_10021234 3300031727 Bacteria 4487
243 Ga0316576_10151726 3300031727 Bacteria 1746
244 Ga0316576_10165139 3300031727 Bacteria 1670
245 Ga0316576_10195675 3300031727 Bacteria 1523
246 Ga0316578_10038561 3300031728 Bacteria 2756
247 Ga0316578_10341398 3300031728 Bacteria 892
248 Ga0307405_10057575 3300031731 Bacteria 2442
249 Ga0316577_10006155 3300031733 Bacteria 6326
250 Ga0307410_10738513 3300031852 Bacteria 833
251 Ga0307406_10154365 3300031901 Bacteria 1642
252 Ga0307406_10211857 3300031901 Bacteria 1434
253 Ga0307412_10589741 3300031911 Bacteria 940
254 Ga0307409_100387424 3300031995 Bacteria 1331
255 Ga0307416_100108171 3300032002 Bacteria 2442
256 Ga0307416_100284449 3300032002 Bacteria 1633
257 Ga0307415_100017498 3300032126 Bacteria 4301
258 Ga0316574_0041126 3300035398 Bacteria 2848
259 Ga0316574_0066259 3300035398 Bacteria 2275
260 Ga0316582_0008641 3300036647 Bacteria 5482
261 Ga0316582_0349919 3300036647 Bacteria 1016
262 Ga0316584_0039168 3300036712 Bacteria 3528
263 Ga0316584_0224878 3300036712 Bacteria 1377
264 Ga0395900_0196537 3300037418 Bacteria 2043
265 Ga0395898_0023305 3300037466 Bacteria 6257
266 Ga0395905_0058891 3300037471 Bacteria 3591
267 Ga0395901_0003004 3300038443 Bacteria 17017
268 Ga0395901_0012097 3300038443 Bacteria 8755
269 Ga0400489_21700 3300039093 Bacteria 31915
270 Ga0400489_65553 3300039093 Bacteria 1073
271 Ga0439463_030490 3300042016 Bacteria 1360
272 Ga0439464_0003310 3300042439 Bacteria 4053
273 Ga0466957_0004293 3300044842 Bacteria 7908
274 Ga0451576_0000648 3300045051 Bacteria 71828
275 Ga0451576_0019602 3300045051 Bacteria 7382
276 Ga0466967_0000001 3300045976 Bacteria 229823
277 Ga0495592_0265964 3300046454 Bacteria 1127
278 Ga0495629_0000487 3300046459 Bacteria 33176
279 Ga0495629_0197629 3300046459 Bacteria 1391
280 Ga0495641_0010781 3300046461 Bacteria 5260
281 Ga0495639_0071034 3300046475 Bacteria 1608
282 Ga0495594_0000089 3300046499 Bacteria 41876
283 Ga0495594_0294678 3300046499 Bacteria 924
284 Ga0495606_0000040 3300046507 Bacteria 223500
285 Ga0495608_0000007 3300046511 Bacteria 313495
286 Ga0495610_0122938 3300046512 Bacteria 1135
287 Ga0495620_0192558 3300046515 Bacteria 786
288 Ga0495630_0000014 3300046517 Bacteria 217229
289 Ga0495630_0109519 3300046517 Bacteria 2092
290 Ga0495652_0000010 3300046529 Bacteria 261584
291 Ga0495621_0010706 3300046539 Bacteria 2816
292 Ga0495622_0000218 3300046557 Bacteria 45469
293 Ga0495634_0006737 3300046642 Bacteria 8702
294 Ga0495625_0000688 3300046660 Bacteria 48233
295 Ga0495588_0000338 3300046674 Bacteria 30480
296 Ga0495657_0000001 3300046675 Bacteria 445641
297 Ga0495647_0006447 3300046681 Bacteria 3885
298 Ga0495658_0003808 3300046683 Bacteria 7472
299 Ga0495658_0118032 3300046683 Bacteria 1601
300 Ga0495613_0000041 3300046689 Bacteria 130784
301 Ga0495613_0365295 3300046689 Bacteria 989
302 Ga0495624_0000286 3300046690 Bacteria 39940
303 Ga0495604_0000239 3300047317 Bacteria 49113
304 Ga0495604_0022899 3300047317 Bacteria 4985
305 Ga0495674_0002248 3300047319 Bacteria 18976
306 Ga0495672_0003023 3300047320 Bacteria 14795
307 Ga0495672_0023161 3300047320 Bacteria 4026
308 Ga0495672_0072101 3300047320 Bacteria 1952
309 Ga0495675_0000300 3300047444 Bacteria 35530
310 Ga0495675_0045416 3300047444 Bacteria 2797
311 Ga0495602_0000007 3300048088 Bacteria 273212
312 Ga0495602_0295807 3300048088 Bacteria 1187
313 Ga0495602_0444644 3300048088 Bacteria 916
314 Ga0495614_0038329 3300048089 Bacteria 2057
315 Ga0496101_0516655 3300048904 Bacteria 944
316 Ga0496102_0058427 3300048905 Bacteria 3524
317 Ga0496102_0237671 3300048905 Bacteria 1718
318 Ga0496102_0488183 3300048905 Bacteria 1153
319 Ga0496103_0012572 3300048906 Bacteria 5020
320 Ga0496104_0000015 3300048907 Bacteria 374530
321 Ga0496104_0141520 3300048907 Bacteria 2311
322 Ga0496104_0189754 3300048907 Bacteria 1966
323 Ga0496105_0000004 3300048908 Bacteria 475798
324 Ga0496106_0048073 3300048909 Bacteria 3212
325 Ga0496108_0000063 3300048911 Bacteria 118950
326 Ga0496108_0018667 3300048911 Bacteria 5682
327 Ga0496108_0283719 3300048911 Bacteria 1441
328 Ga0496109_0000012 3300048912 Bacteria 229699
329 Ga0496109_0000173 3300048912 Bacteria 63867
330 Ga0496109_0003225 3300048912 Bacteria 13583
331 Ga0496109_0458371 3300048912 Unclassified 1204
332 Ga0496110_0003674 3300048913 Bacteria 11801
333 Ga0496110_0025375 3300048913 Bacteria 5064
334 Ga0496110_0125339 3300048913 Bacteria 2317
335 Ga0496111_0000035 3300048914 Bacteria 54459
336 Ga0496111_0043971 3300048914 Bacteria 3211
337 Ga0496111_0353965 3300048914 Bacteria 1087
338 Ga0496112_0002208 3300048915 Bacteria 15521
339 Ga0496113_0000026 3300048916 Bacteria 63999
340 Ga0496114_0000039 3300048917 Bacteria 138486
341 Ga0496114_0167511 3300048917 Bacteria 1913
342 Ga0496114_0715743 3300048917 Bacteria 877
343 Ga0496115_0000011 3300048918 Bacteria 222529
344 Ga0496115_0003457 3300048918 Bacteria 11348
345 Ga0496115_0461472 3300048918 Bacteria 1025
346 Ga0496117_0005451 3300048920 Bacteria 13352
347 Ga0496118_0002916 3300048921 Bacteria 22218
348 Ga0496118_0234026 3300048921 Bacteria 1057
349 Ga0496119_0029247 3300048922 Bacteria 3742
350 Ga0496119_0251747 3300048922 Bacteria 890
351 Ga0496120_0001336 3300048923 Bacteria 30395
352 Ga0496121_0201649 3300048924 Bacteria 1417
353 Ga0496121_0308173 3300048924 Bacteria 1071
354 Ga0496124_0346660 3300048927 Bacteria 1052
355 Ga0496125_0023403 3300048928 Bacteria 5702
356 Ga0496125_0036182 3300048928 Bacteria 4316
357 Ga0496126_0261911 3300048929 Bacteria 1437
358 Ga0501031_0000188 3300049568 Bacteria 34790
359 Ga0501031_0048387 3300049568 Bacteria 2771
360 Ga0501031_0240540 3300049568 Bacteria 1177
361 Ga0501032_0000746 3300049569 Bacteria 26453
362 Ga0501032_0001031 3300049569 Bacteria 22377
363 Ga0501032_0100920 3300049569 Bacteria 1912
364 Ga0501032_0443226 3300049569 Bacteria 832
365 Ga0501033_0000554 3300049570 Bacteria 34825
366 Ga0501033_0002121 3300049570 Bacteria 17164
367 Ga0501033_0024164 3300049570 Bacteria 4585
368 Ga0501034_0014519 3300049571 Bacteria 8110
369 Ga0501034_0021453 3300049571 Bacteria 6584
370 Ga0501034_0719803 3300049571 Bacteria 895
371 Ga0501036_0000336 3300049572 Bacteria 32902
372 Ga0501036_0003957 3300049572 Bacteria 11908
373 Ga0501036_0069240 3300049572 Bacteria 2985
374 Ga0501036_0224099 3300049572 Bacteria 1578
375 Ga0501036_0434816 3300049572 Bacteria 1094
376 Ga0501036_0681333 3300049572 Bacteria 850
377 Ga0501037_0000425 3300049573 Bacteria 34779
378 Ga0501037_0029348 3300049573 Bacteria 4063
379 Ga0501038_0001384 3300049574 Bacteria 22160
380 Ga0501038_0021255 3300049574 Bacteria 5827
381 Ga0501038_0061779 3300049574 Bacteria 3203
382 Ga0501038_0286997 3300049574 Bacteria 1294
383 Ga0501038_0426645 3300049574 Bacteria 1022
384 Ga0501039_0003198 3300049575 Bacteria 12247
385 Ga0501039_0017405 3300049575 Bacteria 5512
386 Ga0501039_0033891 3300049575 Bacteria 3940
387 Ga0501039_0451028 3300049575 Bacteria 1010
388 Ga0501040_0003991 3300049576 Bacteria 9587
389 Ga0501040_0004387 3300049576 Bacteria 9172
390 Ga0501040_0108012 3300049576 Bacteria 1945
391 Ga0501040_0168346 3300049576 Bacteria 1551
392 Ga0501041_0008370 3300049577 Bacteria 6082
393 Ga0501042_0008980 3300049578 Bacteria 6637
394 Ga0501042_0065136 3300049578 Bacteria 2604
395 Ga0501042_0171278 3300049578 Bacteria 1566
396 Ga0501043_0000516 3300049579 Bacteria 34780
397 Ga0501043_0040958 3300049579 Bacteria 3640
398 Ga0501043_0066331 3300049579 Bacteria 2834
399 Ga0501046_0000439 3300049580 Bacteria 41871
400 Ga0501046_0009475 3300049580 Bacteria 8416
401 Ga0501046_0013251 3300049580 Bacteria 6986
402 Ga0501047_0000706 3300049581 Bacteria 34791
403 Ga0501047_0018954 3300049581 Bacteria 6600
404 Ga0501048_0000269 3300049582 Bacteria 34831
405 Ga0501048_0025082 3300049582 Bacteria 4347
406 Ga0501048_0067573 3300049582 Bacteria 2526
407 Ga0501068_0005614 3300049584 Bacteria 6875
408 Ga0501068_0025692 3300049584 Bacteria 3466
409 Ga0501068_0040726 3300049584 Bacteria 2790
410 Ga0501068_0057370 3300049584 Bacteria 2361
411 Ga0501068_0099770 3300049584 Bacteria 1799
412 Ga0501068_0421865 3300049584 Bacteria 861
413 Ga0501069_0044672 3300049585 Bacteria 2453
414 Ga0501070_0000649 3300049586 Bacteria 31969
415 Ga0501070_0005184 3300049586 Bacteria 11101
416 Ga0501070_0007675 3300049586 Bacteria 9151
417 Ga0501070_0034875 3300049586 Bacteria 4205
418 Ga0501070_0075995 3300049586 Bacteria 2780
419 Ga0501070_0166635 3300049586 Bacteria 1815
420 Ga0501070_0202465 3300049586 Bacteria 1630
421 Ga0501070_0257595 3300049586 Bacteria 1426
422 Ga0501071_0010262 3300049587 Bacteria 6269
423 Ga0501071_0295493 3300049587 Bacteria 1227
424 Ga0501072_0002006 3300049588 Bacteria 15165
425 Ga0501072_0002573 3300049588 Bacteria 13592
426 Ga0501072_0081105 3300049588 Bacteria 2571
427 Ga0501072_0275418 3300049588 Bacteria 1339
428 Ga0501073_0001545 3300049589 Bacteria 17056
429 Ga0501074_0044605 3300049590 Bacteria 3209
430 Ga0501074_0050306 3300049590 Bacteria 3008
431 Ga0501074_0052325 3300049590 Bacteria 2948
432 Ga0501074_0083418 3300049590 Bacteria 2291
433 Ga0501074_0374919 3300049590 Bacteria 1009
434 Ga0501075_0004097 3300049591 Bacteria 9847
435 Ga0501075_0010990 3300049591 Bacteria 6387
436 Ga0501076_0005729 3300049592 Bacteria 8957
437 Ga0501076_0193986 3300049592 Bacteria 1658
438 Ga0501076_0520630 3300049592 Bacteria 980
439 Ga0501077_0001108 3300049593 Bacteria 16256
440 Ga0501077_0018144 3300049593 Bacteria 4449
441 Ga0501077_0198512 3300049593 Bacteria 1274
442 Ga0501077_0224990 3300049593 Bacteria 1193
443 Ga0501216_044735 3300049660 Bacteria 856
444 Ga0501079_0001870 3300049741 Bacteria 15098
445 Ga0501079_0012584 3300049741 Bacteria 6462
446 Ga0501079_0016903 3300049741 Bacteria 5572
447 Ga0501079_0513098 3300049741 Bacteria 942
448 Ga0501080_0004448 3300049742 Bacteria 12472
449 Ga0501080_0012172 3300049742 Bacteria 7882
450 Ga0501080_0033969 3300049742 Bacteria 4762
451 Ga0501080_0186530 3300049742 Bacteria 1907
452 Ga0501081_0007212 3300049743 Bacteria 7228
453 Ga0501081_0050593 3300049743 Bacteria 2862
454 Ga0501081_0382673 3300049743 Bacteria 1040
455 Ga0501083_0020251 3300049744 Bacteria 4629
456 Ga0501083_0041306 3300049744 Bacteria 3128
457 Ga0501083_0052947 3300049744 Bacteria 2725
458 Ga0501083_0171166 3300049744 Bacteria 1419
459 Ga0501083_0203532 3300049744 Bacteria 1291
460 Ga0501035_0000754 3300049822 Bacteria 34845
461 Ga0501044_0000947 3300049823 Bacteria 34821
462 Ga0501044_0009956 3300049823 Bacteria 10327
463 Ga0501044_0014304 3300049823 Bacteria 8566
464 Ga0501044_0255002 3300049823 Bacteria 1694
465 Ga0501044_0296397 3300049823 Bacteria 1547
466 Ga0501045_0002857 3300049824 Bacteria 11802
467 Ga0501045_0008450 3300049824 Bacteria 7176
468 Ga0501045_0018675 3300049824 Bacteria 4936
469 nmdc:mga03683_66426_c1 3300050489 Bacteria 1533
470 nmdc:mga00v17_10267_c1 3300050491 Bacteria 5106
471 nmdc:mga00v17_158966_c1 3300050491 Bacteria 1454
472 nmdc:mga00v17_190023_c1 3300050491 Bacteria 1326
473 nmdc:mga00v17_32656_c1 3300050491 Bacteria 3078
474 nmdc:mga0yw44_181139_c1 3300050492 Bacteria 1387
475 nmdc:mga0yw44_218470_c1 3300050492 Bacteria 1262
476 nmdc:mga0yw44_60569_c1 3300050492 Bacteria 2319
477 nmdc:mga06z11_97361_c1 3300050494 Bacteria 1608
478 nmdc:mga04h51_37651_c1 3300050495 Bacteria 1562
479 nmdc:mga05p37_142945_c1 3300050507 Bacteria 2931
480 nmdc:mga05p37_193_c1 3300050507 Bacteria 60583
481 nmdc:mga05p37_30258_c1 3300050507 Bacteria 6605
482 nmdc:mga05p37_61017_c1 3300050507 Bacteria 4642
483 nmdc:mga09592_713_c1 3300050508 Bacteria 25509
484 nmdc:mga0qj67_183762_c1 3300050509 Bacteria 1698
485 nmdc:mga0qj67_47977_c1 3300050509 Bacteria 3374
486 nmdc:mga0qj67_789_c1 3300050509 Bacteria 21551
487 nmdc:mga06r32_12517_c1 3300050510 Bacteria 7657
488 nmdc:mga06r32_1974_c1 3300050510 Bacteria 18315
489 nmdc:mga06r32_2913_c1 3300050510 Bacteria 15350
490 nmdc:mga06r32_752426_c1 3300050510 Bacteria 938
491 nmdc:mga08y16_165851_c1 3300050511 Bacteria 2294
492 nmdc:mga08y16_186715_c1 3300050511 Bacteria 2151
493 nmdc:mga08y16_34091_c1 3300050511 Bacteria 3322
494 nmdc:mga08y16_4152_c1 3300050511 Bacteria 15123
495 nmdc:mga0n895_15854_c1 3300050512 Bacteria 6891
496 nmdc:mga0n895_49089_c1 3300050512 Bacteria 4133
497 nmdc:mga0a205_71199_c1 3300050515 Bacteria 3358
498 Ga0495601_0001218 3300053077 Bacteria 14090
499 Ga0495655_0007306 3300053083 Bacteria 2047
500 Ga0495595_0000002 3300053084 Bacteria 445641
501 Ga0495619_0000102 3300053085 Bacteria 64345
502 Ga0495619_0000268 3300053085 Bacteria 37980
503 Ga0500583_0091787 3300053092 Bacteria 1479
504 Ga0500566_0166823 3300053094 Bacteria 1142
505 Ga0500641_0000831 3300053096 Bacteria 11108
506 Ga0500604_0109278 3300053151 Bacteria 917
507 Ga0501084_0069168 3300054114 Bacteria 2955
508 Ga0501084_0091646 3300054114 Bacteria 2551
509 Ga0501082_0005083 3300060353 Bacteria 11460
510 Ga0501082_0180767 3300060353 Bacteria 1834
511 Ga0501082_0203961 3300060353 Bacteria 1720
512 Ga0501082_0660727 3300060353 Bacteria 915
513 Ga0530510_0004318 3300061734 Bacteria 9837
514 Ga0530510_0016048 3300061734 Bacteria 5294
515 Ga0530510_0140359 3300061734 Bacteria 1780
516 Ga0530510_0309431 3300061734 Bacteria 1183
517 8054359962 8054357960 Bacteria 2867777
518 Ga0075364_10283478
519 JGI24740J21852_10019188
520 JGI25404J52841_10002165
521 Ga0070658_10016785
522 Ga0070683_100006889
523 Ga0070683_100040821
524 Ga0070683_100057003
525 Ga0070683_100271123
526 Ga0070690_100121529
527 Ga0070670_100065738
528 Ga0070670_100582657
529 Ga0070682_100000011
530 Ga0070682_100043711
531 Ga0070660_100027788
532 Ga0070689_100006918
533 Ga0070689_100169154
534 Ga0070691_10000138
535 Ga0070691_10032793
536 Ga0070691_10237279
537 Ga0070661_100000058
538 Ga0070661_100036531
539 Ga0070692_10035562
540 Ga0070668_100011596
541 Ga0070668_100053864
542 Ga0070668_100160683
543 Ga0070675_100000036
544 Ga0070675_100194850
545 Ga0070674_100019638
546 Ga0070688_100000360
547 Ga0070688_100129950
548 Ga0070659_100019249
549 Ga0070659_100259950
550 Ga0070667_100001076
551 Ga0070667_100041329
552 Ga0070667_100453369
553 Ga0070714_100050426
554 Ga0070713_100000047
555 Ga0070700_100026150
556 Ga0070694_100484201
557 Ga0070663_100001923
558 Ga0070663_100353116
559 Ga0068867_100399500
560 Ga0070685_10000019
561 Ga0070685_10000020
562 Ga0070685_10031452
563 Ga0070685_10047925
564 Ga0070679_100012803
565 Ga0070684_100212156
566 Ga0070684_100217809
567 Ga0070684_100347584
568 Ga0070697_100122493
569 Ga0068853_100099356
570 Ga0070672_100000001
571 Ga0070686_100062261
572 Ga0070695_100133859
573 Ga0070665_100028178
574 Ga0070665_100045460
575 Ga0070665_100072288
576 Ga0070665_100242923
577 Ga0070704_100224779
578 Ga0068854_100000097
579 Ga0068854_100240986
580 Ga0068856_100002498
581 Ga0068856_100013571
582 Ga0070702_100028208
583 Ga0068852_100000002
584 Ga0068864_100036710
585 Ga0068866_10257342
586 Ga0068861_100111353
587 Ga0068851_10000730
588 Ga0068851_10063187
589 Ga0068858_100215249
590 Ga0068858_100475426
591 Ga0068860_100030106
592 Ga0068862_100023531
593 Ga0081455_10019712
594 Ga0081455_10041657
595 Ga0081538_10066111
596 Ga0081540_1000100
597 Ga0081539_10002227
598 Ga0075365_10009351
599 Ga0075365_10126579
600 Ga0075368_10032143
601 Ga0075363_100096258
602 Ga0075364_10009348
603 Ga0075364_10011967
604 Ga0075364_10048289
605 Ga0075364_10221552
606 Ga0075432_10018411
607 Ga0070716_100028893
608 Ga0070712_100079139
609 Ga0075367_10208046
610 Ga0075367_10240808
611 Ga0097621_100174435
612 Ga0075428_100000660
613 Ga0075428_100151561
614 Ga0075428_100824111
615 Ga0075430_100001548
616 Ga0075430_100324701
617 Ga0075431_100000197
618 Ga0075431_100040949
619 Ga0075433_10013700
620 Ga0075433_10060052
621 Ga0075434_100024155
622 Ga0075429_100001353
623 Ga0068865_100000013
624 Ga0068865_100015130
625 Ga0111539_10012209
626 Ga0111539_10042802
627 Ga0111539_10048618
628 Ga0111539_10362641
629 Ga0105245_10000125
630 Ga0105245_10006331
631 Ga0105245_10296165
632 Ga0105245_10309431
633 Ga0105247_10001978
634 Ga0105247_10147831
635 Ga0114129_10003535
636 Ga0114129_10022808
637 Ga0114129_10026568
638 Ga0105243_10028685
639 Ga0105243_10029327
640 Ga0105242_10000908
641 Ga0105242_10493606
642 Ga0105248_10000020
643 Ga0105248_10292474
644 Ga0105237_10215793
645 Ga0105238_10165299
646 Ga0105249_10003509
647 Ga0105249_10059287
648 Ga0105249_10101411
649 Ga0105239_10029010
650 Ga0105239_10098069
651 Ga0105239_10577039
652 Ga0105246_10036885
653 Ga0157371_10001577
654 Ga0157370_10002971
655 Ga0157370_10114257
656 Ga0157369_10000307
657 Ga0157374_10842737
658 Ga0157378_10027515
659 Ga0157378_10057890
660 Ga0157378_10073549
661 Ga0163162_10308767
662 Ga0163162_10324673
663 Ga0157372_10000053
664 Ga0157375_10291123
665 Ga0163163_10257223
666 Ga0163163_10431936
667 Ga0157380_10000016
668 Ga0157380_10092052
669 Ga0157377_10164762
670 Ga0157379_10059769
671 Ga0157376_10020564
672 Ga0157376_10056242
673 Ga0163161_10047839
674 Ga0206353_11016966
675 Ga0207656_10000211
676 Ga0207656_10052159
677 Ga0207710_10000821
678 Ga0207688_10022385
679 Ga0207695_10188274
680 Ga0207693_10069081
681 Ga0207693_10666446
682 Ga0207663_10033961
683 Ga0207662_10052373
684 Ga0207657_10001009
685 Ga0207657_10359148
686 Ga0207649_10000283
687 Ga0207649_10245901
688 Ga0207652_10008840
689 Ga0207652_10901154
690 Ga0207650_10187297
691 Ga0207650_10479609
692 Ga0207659_10000013
693 Ga0207659_10392604
694 Ga0207687_10000017
695 Ga0207687_10001648
696 Ga0207687_10282521
697 Ga0207700_10000033
698 Ga0207706_10189641
699 Ga0207686_10098091
700 Ga0207709_10019598
701 Ga0207670_10005811
702 Ga0207669_10390272
703 Ga0207704_10000040
704 Ga0207665_10041758
705 Ga0207691_10000017
706 Ga0207711_10000006
707 Ga0207689_10211509
708 Ga0207661_10000198
709 Ga0207661_10029396
710 Ga0207661_10039828
711 Ga0207661_10058813
712 Ga0207661_10115700
713 Ga0207679_10347264
714 Ga0207651_10384453
715 Ga0207712_10007734
716 Ga0207712_10109368
717 Ga0207668_10005384
718 Ga0207668_10062039
719 Ga0207640_10000370
720 Ga0207640_10092120
721 Ga0207658_10003877
722 Ga0207658_10103056
723 Ga0207703_10620207
724 Ga0207639_10015804
725 Ga0207678_10002796
726 Ga0207678_10039573
727 Ga0207678_10335426
728 Ga0207708_10002157
729 Ga0207708_10136947
730 Ga0207702_10000637
731 Ga0207702_10018008
732 Ga0207648_10149355
733 Ga0207674_10601725
734 Ga0207675_100059424
735 Ga0207675_100200268
736 Ga0207683_10092425
737 Ga0207698_10000004
738 Ga0207698_10035678
739 Ga0209970_1024300
740 Ga0209813_10062724
741 Ga0209974_10043444
742 Ga0207428_10021603
743 Ga0207428_10086741
744 Ga0268266_10000601
745 Ga0268266_10001254
746 Ga0268266_10030794
747 Ga0268266_10265674
748 Ga0268266_10765493
749 Ga0268265_10004453
750 Ga0268265_10740380
751 Ga0268264_10127452
752 Ga0265326_10045819
753 Ga0265319_1000469
754 Ga0265338_10000244
755 Ga0265324_10058844
756 Ga0265330_10001216
757 Ga0265329_10098654
758 Ga0265331_10011583
759 Ga0316576_10021234
760 Ga0316576_10151726
761 Ga0316576_10165139
762 Ga0316576_10195675
763 Ga0316578_10038561
764 Ga0316578_10341398
765 Ga0307405_10057575
766 Ga0316577_10006155
767 Ga0307410_10738513
768 Ga0307406_10154365
769 Ga0307406_10211857
770 Ga0307412_10589741
771 Ga0307409_100387424
772 Ga0307416_100108171
773 Ga0307416_100284449
774 Ga0307415_100017498
775 Ga0316574_0041126
776 Ga0316574_0066259
777 Ga0316582_0008641
778 Ga0316582_0349919
779 Ga0316584_0039168
780 Ga0316584_0224878
781 Ga0395900_0196537
782 Ga0395898_0023305
783 Ga0395905_0058891
784 Ga0395901_0003004
785 Ga0395901_0012097
786 Ga0400489_21700
787 Ga0400489_65553
788 Ga0439463_030490
789 Ga0439464_0003310
790 Ga0466957_0004293
791 Ga0451576_0000648
792 Ga0451576_0019602
793 Ga0466967_0000001
794 Ga0495592_0265964
795 Ga0495629_0000487
796 Ga0495629_0197629
797 Ga0495641_0010781
798 Ga0495639_0071034
799 Ga0495594_0000089
800 Ga0495594_0294678
801 Ga0495606_0000040
802 Ga0495608_0000007
803 Ga0495610_0122938
804 Ga0495620_0192558
805 Ga0495630_0000014
806 Ga0495630_0109519
807 Ga0495652_0000010
808 Ga0495621_0010706
809 Ga0495622_0000218
810 Ga0495634_0006737
811 Ga0495625_0000688
812 Ga0495588_0000338
813 Ga0495657_0000001
814 Ga0495647_0006447
815 Ga0495658_0003808
816 Ga0495658_0118032
817 Ga0495613_0000041
818 Ga0495613_0365295
819 Ga0495624_0000286
820 Ga0495604_0000239
821 Ga0495604_0022899
822 Ga0495674_0002248
823 Ga0495672_0003023
824 Ga0495672_0023161
825 Ga0495672_0072101
826 Ga0495675_0000300
827 Ga0495675_0045416
828 Ga0495602_0000007
829 Ga0495602_0295807
830 Ga0495602_0444644
831 Ga0495614_0038329
832 Ga0496101_0516655
833 Ga0496102_0058427
834 Ga0496102_0237671
835 Ga0496102_0488183
836 Ga0496103_0012572
837 Ga0496104_0000015
838 Ga0496104_0141520
839 Ga0496104_0189754
840 Ga0496105_0000004
841 Ga0496106_0048073
842 Ga0496108_0000063
843 Ga0496108_0018667
844 Ga0496108_0283719
845 Ga0496109_0000012
846 Ga0496109_0000173
847 Ga0496109_0003225
848 Ga0496109_0458371
849 Ga0496110_0003674
850 Ga0496110_0025375
851 Ga0496110_0125339
852 Ga0496111_0000035
853 Ga0496111_0043971
854 Ga0496111_0353965
855 Ga0496112_0002208
856 Ga0496113_0000026
857 Ga0496114_0000039
858 Ga0496114_0167511
859 Ga0496114_0715743
860 Ga0496115_0000011
861 Ga0496115_0003457
862 Ga0496115_0461472
863 Ga0496117_0005451
864 Ga0496118_0002916
865 Ga0496118_0234026
866 Ga0496119_0029247
867 Ga0496119_0251747
868 Ga0496120_0001336
869 Ga0496121_0201649
870 Ga0496121_0308173
871 Ga0496124_0346660
872 Ga0496125_0023403
873 Ga0496125_0036182
874 Ga0496126_0261911
875 Ga0501031_0000188
876 Ga0501031_0048387
877 Ga0501031_0240540
878 Ga0501032_0000746
879 Ga0501032_0001031
880 Ga0501032_0100920
881 Ga0501032_0443226
882 Ga0501033_0000554
883 Ga0501033_0002121
884 Ga0501033_0024164
885 Ga0501034_0014519
886 Ga0501034_0021453
887 Ga0501034_0719803
888 Ga0501036_0000336
889 Ga0501036_0003957
890 Ga0501036_0069240
891 Ga0501036_0224099
892 Ga0501036_0434816
893 Ga0501036_0681333
894 Ga0501037_0000425
895 Ga0501037_0029348
896 Ga0501038_0001384
897 Ga0501038_0021255
898 Ga0501038_0061779
899 Ga0501038_0286997
900 Ga0501038_0426645
901 Ga0501039_0003198
902 Ga0501039_0017405
903 Ga0501039_0033891
904 Ga0501039_0451028
905 Ga0501040_0003991
906 Ga0501040_0004387
907 Ga0501040_0108012
908 Ga0501040_0168346
909 Ga0501041_0008370
910 Ga0501042_0008980
911 Ga0501042_0065136
912 Ga0501042_0171278
913 Ga0501043_0000516
914 Ga0501043_0040958
915 Ga0501043_0066331
916 Ga0501046_0000439
917 Ga0501046_0009475
918 Ga0501046_0013251
919 Ga0501047_0000706
920 Ga0501047_0018954
921 Ga0501048_0000269
922 Ga0501048_0025082
923 Ga0501048_0067573
924 Ga0501068_0005614
925 Ga0501068_0025692
926 Ga0501068_0040726
927 Ga0501068_0057370
928 Ga0501068_0099770
929 Ga0501068_0421865
930 Ga0501069_0044672
931 Ga0501070_0000649
932 Ga0501070_0005184
933 Ga0501070_0007675
934 Ga0501070_0034875
935 Ga0501070_0075995
936 Ga0501070_0166635
937 Ga0501070_0202465
938 Ga0501070_0257595
939 Ga0501071_0010262
940 Ga0501071_0295493
941 Ga0501072_0002006
942 Ga0501072_0002573
943 Ga0501072_0081105
944 Ga0501072_0275418
945 Ga0501073_0001545
946 Ga0501074_0044605
947 Ga0501074_0050306
948 Ga0501074_0052325
949 Ga0501074_0083418
950 Ga0501074_0374919
951 Ga0501075_0004097
952 Ga0501075_0010990
953 Ga0501076_0005729
954 Ga0501076_0193986
955 Ga0501076_0520630
956 Ga0501077_0001108
957 Ga0501077_0018144
958 Ga0501077_0198512
959 Ga0501077_0224990
960 Ga0501216_044735
961 Ga0501079_0001870
962 Ga0501079_0012584
963 Ga0501079_0016903
964 Ga0501079_0513098
965 Ga0501080_0004448
966 Ga0501080_0012172
967 Ga0501080_0033969
968 Ga0501080_0186530
969 Ga0501081_0007212
970 Ga0501081_0050593
971 Ga0501081_0382673
972 Ga0501083_0020251
973 Ga0501083_0041306
974 Ga0501083_0052947
975 Ga0501083_0171166
976 Ga0501083_0203532
977 Ga0501035_0000754
978 Ga0501044_0000947
979 Ga0501044_0009956
980 Ga0501044_0014304
981 Ga0501044_0255002
982 Ga0501044_0296397
983 Ga0501045_0002857
984 Ga0501045_0008450
985 Ga0501045_0018675
986 nmdc:mga03683_66426_c1
987 nmdc:mga00v17_10267_c1
988 nmdc:mga00v17_158966_c1
989 nmdc:mga00v17_190023_c1
990 nmdc:mga00v17_32656_c1
991 nmdc:mga0yw44_181139_c1
992 nmdc:mga0yw44_218470_c1
993 nmdc:mga0yw44_60569_c1
994 nmdc:mga06z11_97361_c1
995 nmdc:mga04h51_37651_c1
996 nmdc:mga05p37_142945_c1
997 nmdc:mga05p37_193_c1
998 nmdc:mga05p37_30258_c1
999 nmdc:mga05p37_61017_c1
1000 nmdc:mga09592_713_c1
1001 nmdc:mga0qj67_183762_c1
1002 nmdc:mga0qj67_47977_c1
1003 nmdc:mga0qj67_789_c1
1004 nmdc:mga06r32_12517_c1
1005 nmdc:mga06r32_1974_c1
1006 nmdc:mga06r32_2913_c1
1007 nmdc:mga06r32_752426_c1
1008 nmdc:mga08y16_165851_c1
1009 nmdc:mga08y16_186715_c1
1010 nmdc:mga08y16_34091_c1
1011 nmdc:mga08y16_4152_c1
1012 nmdc:mga0n895_15854_c1
1013 nmdc:mga0n895_49089_c1
1014 nmdc:mga0a205_71199_c1
1015 Ga0495601_0001218
1016 Ga0495655_0007306
1017 Ga0495595_0000002
1018 Ga0495619_0000102
1019 Ga0495619_0000268
1020 Ga0500583_0091787
1021 Ga0500566_0166823
1022 Ga0500641_0000831
1023 Ga0500604_0109278
1024 Ga0501084_0069168
1025 Ga0501084_0091646
1026 Ga0501082_0005083
1027 Ga0501082_0180767
1028 Ga0501082_0203961
1029 Ga0501082_0660727
1030 Ga0530510_0004318
1031 Ga0530510_0016048
1032 Ga0530510_0140359
1033 Ga0530510_0309431
1034 8054359962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

47

118

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

124

278

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b9p-assembly1.cif.gz_A-2 structure of ribonucleotide reductase from rhodobacter sphaeroides 0.8519 7 76
2nxj-assembly1.cif.gz_A t.thermophilus ribosomal protein l11 methyltransferase (prma) in space group p 21 21 2 0.8044 139 175
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.7463 139 177
3cjs-assembly1.cif.gz_A minimal recognition complex between prma and ribosomal protein l11 0.7382 139 177
5mbd-assembly1.cif.gz_B structure of a bacterial light-regulated adenylyl cylcase 0.7382 135 190
ID Description Score Start End Superfamily
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9663 19 75 1.10.10.200
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.922 24 79 1.10.10.200
1mw7A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9002 137 200 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.8967 5 79 1.10.10.200
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.8926 9 79 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A2M7UZY6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9325 84 218 GO:0003677
AF-T0ZIX8-F1-model_v4 Protein containing DUF28 0.8741 78 217 GO:0005829
AF-A0A2N6A8I0-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.8715 77 217
AF-A0A3D2RMF8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.8611 76 234 GO:0003677
GO:0005829
AF-A0A7R9W367-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.8582 78 218

Map