F458102

General Info

Members Datasets Scaffolds Average Seq Length
517 242 1034 350

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100030365|Ga0070708_1000303655
Length 404
Sequence MVANRWLDGEGFASIPATHARQACSAPRRRLHWGRSEEGANSTMPDELRRRRQNDEHLPAAHEDPYTAYHDFDLPAYVGSTSFQKLPLLTDAAALRERRPDVAIIGAPFDDAVSHRPGARFGPRAIRTATYHSGSLNSLQLGIEPFEWLDCVDAGDAPVTPADLERGHEVIRRKVLEVASTGAIPIILGGDHSITFPAASAVAEAIGSRRLGVVHFDAHADAANSTWGVLRSHGTPMRRLIESGVVEGRNFVQVGLRGYWPPAETLAWMGEQQMRWHLMTEIESRGAEAVVADAIAEALDGPEAIYLSVDIDVLDPGLAPGTGTPEPGGLLPRELLRAIRQVVSVVDLAAMDVVEVSPPYDHGEVTSTTAHRCVMEAISALAAQRRERGEAANPTRLVRDRSGA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
139 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
140 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 4.84
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100030365 3300005445 Bacteria 4671
2 JGI24751J29686_10000889 3300002459 Bacteria 6837
3 Ga0070683_100085179 3300005329 Bacteria 2962
4 Ga0070690_100353566 3300005330 Bacteria 1067
5 Ga0070670_100016625 3300005331 Bacteria 6313
6 Ga0070670_100029956 3300005331 Bacteria 4686
7 Ga0070680_100160895 3300005336 Bacteria 1887
8 Ga0068868_100245085 3300005338 Bacteria 1507
9 Ga0070661_100024800 3300005344 Bacteria 4304
10 Ga0070692_10031450 3300005345 Bacteria 2661
11 Ga0070675_100362240 3300005354 Bacteria 1288
12 Ga0070674_100018100 3300005356 Bacteria 4446
13 Ga0070674_100070074 3300005356 Bacteria 2476
14 Ga0070659_100088543 3300005366 Bacteria 2479
15 Ga0070703_10000026 3300005406 Bacteria 71473
16 Ga0070703_10003052 3300005406 Bacteria 4789
17 Ga0070705_100022607 3300005440 Bacteria 3363
18 Ga0070700_100012794 3300005441 Bacteria 4698
19 Ga0070700_100046236 3300005441 Bacteria 2688
20 Ga0070700_100103165 3300005441 Bacteria 1883
21 Ga0070694_100041269 3300005444 Bacteria 3077
22 Ga0070694_100070526 3300005444 Bacteria 2406
23 Ga0070708_100000120 3300005445 Bacteria 52583
24 Ga0070708_100034914 3300005445 Bacteria 4378
25 Ga0070708_100344393 3300005445 Bacteria 1404
26 Ga0070663_100019958 3300005455 Bacteria 4427
27 Ga0070678_100032088 3300005456 Bacteria 3631
28 Ga0070681_10057785 3300005458 Bacteria 3859
29 Ga0068867_100016271 3300005459 Bacteria 5282
30 Ga0070706_100001624 3300005467 Bacteria 23449
31 Ga0070706_100124987 3300005467 Bacteria 2398
32 Ga0070706_100363725 3300005467 Bacteria 1348
33 Ga0070707_100004774 3300005468 Bacteria 12685
34 Ga0070707_100098916 3300005468 Bacteria 2826
35 Ga0070698_100003152 3300005471 Bacteria 18173
36 Ga0070698_100069293 3300005471 Bacteria 3542
37 Ga0070698_100088761 3300005471 Bacteria 3076
38 Ga0070698_100216052 3300005471 Bacteria 1851
39 Ga0070699_100049684 3300005518 Bacteria 3630
40 Ga0070697_100112154 3300005536 Bacteria 2274
41 Ga0070686_100189632 3300005544 Bacteria 1466
42 Ga0070695_100035757 3300005545 Bacteria 3121
43 Ga0070696_100000846 3300005546 Bacteria 19736
44 Ga0070696_100018069 3300005546 Bacteria 4763
45 Ga0070696_100023487 3300005546 Bacteria 4191
46 Ga0070696_100039791 3300005546 Bacteria 3246
47 Ga0070696_100127629 3300005546 Bacteria 1847
48 Ga0070704_100008209 3300005549 Bacteria 6246
49 Ga0070704_100008774 3300005549 Bacteria 6082
50 Ga0070704_100091121 3300005549 Bacteria 2272
51 Ga0070704_100276729 3300005549 Bacteria 1389
52 Ga0070664_100039634 3300005564 Bacteria 3970
53 Ga0070664_100159119 3300005564 Bacteria 1997
54 Ga0068854_100121202 3300005578 Bacteria 1986
55 Ga0070702_100042704 3300005615 Bacteria 2550
56 Ga0068859_100566576 3300005617 Bacteria 1230
57 Ga0068866_10011818 3300005718 Bacteria 3790
58 Ga0068866_10017313 3300005718 Bacteria 3240
59 Ga0068861_100038633 3300005719 Bacteria 3557
60 Ga0068861_100111228 3300005719 Bacteria 2195
61 Ga0068870_10000948 3300005840 Bacteria 11383
62 Ga0068863_100007731 3300005841 Bacteria 10513
63 Ga0068860_100007735 3300005843 Bacteria 10739
64 Ga0068862_100084684 3300005844 Bacteria 2755
65 Ga0068862_100198520 3300005844 Bacteria 1808
66 Ga0068862_100251430 3300005844 Bacteria 1611
67 Ga0081455_10000975 3300005937 Bacteria 36516
68 Ga0081455_10026728 3300005937 Bacteria 5299
69 Ga0081455_10112468 3300005937 Bacteria 2161
70 Ga0081455_10189661 3300005937 Bacteria 1549
71 Ga0081539_10026282 3300005985 Bacteria 3720
72 Ga0075365_10027892 3300006038 Bacteria 3596
73 Ga0070712_100004268 3300006175 Bacteria 8796
74 Ga0068871_100018498 3300006358 Bacteria 5296
75 Ga0075428_100005544 3300006844 Bacteria 14035
76 Ga0075430_100033318 3300006846 Bacteria 4372
77 Ga0075431_100217900 3300006847 Bacteria 1948
78 Ga0075431_100244984 3300006847 Bacteria 1822
79 Ga0075433_10004834 3300006852 Bacteria 10529
80 Ga0075433_10038342 3300006852 Bacteria 4138
81 Ga0075433_10147238 3300006852 Bacteria 2094
82 Ga0075433_10155308 3300006852 Bacteria 2036
83 Ga0075434_100002647 3300006871 Bacteria 15798
84 Ga0075434_100056825 3300006871 Bacteria 3889
85 Ga0075434_100092391 3300006871 Bacteria 3029
86 Ga0068865_100127978 3300006881 Bacteria 1899
87 Ga0068865_100134854 3300006881 Bacteria 1854
88 Ga0097620_100566586 3300006931 Bacteria 1230
89 Ga0075435_100070485 3300007076 Bacteria 2853
90 Ga0111539_10021109 3300009094 Bacteria 8019
91 Ga0111539_10209449 3300009094 Bacteria 2272
92 Ga0111539_10307665 3300009094 Bacteria 1844
93 Ga0105245_10293009 3300009098 Bacteria 1594
94 Ga0114129_10016681 3300009147 Bacteria 10459
95 Ga0114129_10136909 3300009147 Bacteria 3360
96 Ga0114129_10215343 3300009147 Bacteria 2594
97 Ga0114129_10317344 3300009147 Bacteria 2072
98 Ga0105243_10011013 3300009148 Bacteria 6838
99 Ga0105243_10029126 3300009148 Bacteria 4245
100 Ga0105243_10154389 3300009148 Bacteria 1972
101 Ga0105241_10423925 3300009174 Bacteria 1172
102 Ga0105242_10001608 3300009176 Bacteria 17792
103 Ga0105242_10225013 3300009176 Bacteria 1679
104 Ga0105242_10276885 3300009176 Bacteria 1522
105 Ga0105248_10122624 3300009177 Bacteria 2932
106 Ga0105249_10029085 3300009553 Bacteria 4990
107 Ga0105249_10071434 3300009553 Bacteria 3206
108 Ga0105249_10192081 3300009553 Bacteria 1993
109 Ga0157374_10040187 3300013296 Bacteria 4306
110 Ga0157378_10017467 3300013297 Bacteria 6297
111 Ga0157378_10027559 3300013297 Bacteria 5012
112 Ga0163162_10158276 3300013306 Bacteria 2386
113 Ga0163162_10571029 3300013306 Bacteria 1258
114 Ga0157375_10060561 3300013308 Bacteria 3755
115 Ga0157375_10088886 3300013308 Bacteria 3145
116 Ga0163163_10023549 3300014325 Bacteria 5845
117 Ga0163163_10114666 3300014325 Bacteria 2726
118 Ga0163163_10256975 3300014325 Bacteria 1798
119 Ga0157380_10018192 3300014326 Bacteria 5214
120 Ga0157380_10179801 3300014326 Bacteria 1857
121 Ga0157377_10022463 3300014745 Bacteria 3331
122 Ga0157377_10035361 3300014745 Bacteria 2741
123 Ga0157377_10055677 3300014745 Bacteria 2243
124 Ga0157379_10039444 3300014968 Bacteria 4213
125 Ga0163161_10174563 3300017792 Bacteria 1645
126 Ga0207653_10000009 3300025885 Bacteria 197279
127 Ga0207688_10009143 3300025901 Bacteria 5396
128 Ga0207685_10001387 3300025905 Bacteria 5030
129 Ga0207643_10008641 3300025908 Bacteria 5462
130 Ga0207643_10104302 3300025908 Bacteria 1665
131 Ga0207684_10000058 3300025910 Bacteria 211166
132 Ga0207684_10000839 3300025910 Bacteria 35443
133 Ga0207684_10013206 3300025910 Bacteria 7148
134 Ga0207707_10055726 3300025912 Bacteria 3438
135 Ga0207707_10076100 3300025912 Bacteria 2929
136 Ga0207693_10000707 3300025915 Bacteria 30016
137 Ga0207660_10075735 3300025917 Bacteria 2459
138 Ga0207662_10000078 3300025918 Bacteria 44345
139 Ga0207646_10008172 3300025922 Bacteria 10519
140 Ga0207646_10009587 3300025922 Bacteria 9552
141 Ga0207646_10019536 3300025922 Bacteria 6294
142 Ga0207646_10052678 3300025922 Bacteria 3642
143 Ga0207646_10087068 3300025922 Bacteria 2795
144 Ga0207646_10097799 3300025922 Bacteria 2629
145 Ga0207646_10168360 3300025922 Bacteria 1978
146 Ga0207694_10180994 3300025924 Bacteria 1709
147 Ga0207650_10009562 3300025925 Bacteria 6629
148 Ga0207659_10130163 3300025926 Bacteria 1941
149 Ga0207659_10139989 3300025926 Bacteria 1877
150 Ga0207644_10181877 3300025931 Bacteria 1648
151 Ga0207690_10249401 3300025932 Bacteria 1371
152 Ga0207706_10015736 3300025933 Bacteria 6838
153 Ga0207686_10013650 3300025934 Bacteria 4500
154 Ga0207686_10017530 3300025934 Bacteria 4037
155 Ga0207709_10050198 3300025935 Bacteria 2550
156 Ga0207709_10070613 3300025935 Bacteria 2215
157 Ga0207670_10020230 3300025936 Bacteria 4085
158 Ga0207669_10003317 3300025937 Bacteria 6965
159 Ga0207704_10016169 3300025938 Bacteria 3826
160 Ga0207665_10129461 3300025939 Bacteria 1790
161 Ga0207689_10023568 3300025942 Bacteria 5163
162 Ga0207661_10160006 3300025944 Bacteria 1953
163 Ga0207679_10048156 3300025945 Bacteria 3101
164 Ga0207679_10290130 3300025945 Bacteria 1406
165 Ga0207712_10042878 3300025961 Bacteria 3119
166 Ga0207712_10079992 3300025961 Bacteria 2376
167 Ga0207668_10398030 3300025972 Bacteria 1164
168 Ga0207640_10136679 3300025981 Bacteria 1780
169 Ga0207703_10116827 3300026035 Bacteria 2284
170 Ga0207678_10022060 3300026067 Bacteria 5579
171 Ga0207678_10025319 3300026067 Bacteria 5180
172 Ga0207708_10021501 3300026075 Bacteria 4866
173 Ga0207708_10030051 3300026075 Bacteria 4121
174 Ga0207641_10101084 3300026088 Bacteria 2540
175 Ga0207648_10000305 3300026089 Bacteria 53670
176 Ga0207676_10014990 3300026095 Bacteria 5585
177 Ga0207676_10240871 3300026095 Bacteria 1623
178 Ga0207674_10004254 3300026116 Bacteria 17270
179 Ga0207674_10018061 3300026116 Bacteria 7681
180 Ga0207674_10092634 3300026116 Bacteria 3011
181 Ga0207674_10164095 3300026116 Bacteria 2176
182 Ga0207675_100027889 3300026118 Bacteria 5259
183 Ga0207675_100062074 3300026118 Bacteria 3489
184 Ga0207675_100088781 3300026118 Bacteria 2904
185 Ga0207683_10052178 3300026121 Bacteria 3583
186 Ga0207683_10054034 3300026121 Bacteria 3522
187 Ga0207683_10092033 3300026121 Bacteria 2702
188 Ga0207698_10080173 3300026142 Bacteria 2628
189 Ga0209966_1006856 3300027695 Bacteria 1987
190 Ga0209998_10000055 3300027717 Bacteria 46896
191 Ga0209974_10016892 3300027876 Bacteria 2422
192 Ga0207428_10003022 3300027907 Bacteria 16573
193 Ga0207428_10025649 3300027907 Bacteria 4932
194 Ga0268265_10257186 3300028380 Bacteria 1550
195 Ga0265318_10012110 3300028577 Bacteria 3682
196 Ga0307408_100084263 3300031548 Bacteria 2384
197 Ga0265314_10080020 3300031711 Bacteria 2159
198 Ga0316577_10062474 3300031733 Bacteria 2080
199 Ga0307409_100062570 3300031995 Bacteria 2914
200 Ga0307416_100008524 3300032002 Bacteria 6625
201 Ga0307416_100037445 3300032002 Bacteria 3733
202 Ga0307415_100001473 3300032126 Bacteria 11266
203 Ga0307415_100098787 3300032126 Bacteria 2135
204 Ga0373926_0000015 3300035083 Bacteria 29103
205 Ga0373944_0001402 3300035089 Bacteria 6077
206 Ga0373923_0048566 3300035111 Bacteria 1772
207 Ga0373936_0003885 3300035113 Bacteria 5630
208 Ga0373945_0000009 3300035116 Bacteria 42918
209 Ga0373943_0010887 3300035170 Bacteria 4085
210 Ga0373943_0095522 3300035170 Bacteria 1546
211 Ga0373946_0000046 3300035171 Bacteria 32382
212 Ga0373931_0010106 3300035691 Bacteria 4527
213 Ga0373935_0010658 3300035692 Bacteria 5518
214 Ga0373947_0000352 3300035725 Bacteria 26025
215 Ga0373947_0140905 3300035725 Bacteria 1546
216 Ga0316584_0078915 3300036712 Bacteria 2466
217 Ga0373925_0041882 3300037068 Bacteria 3396
218 Ga0373925_0119454 3300037068 Bacteria 2045
219 Ga0373925_0127256 3300037068 Bacteria 1983
220 Ga0395899_0018833 3300037312 Bacteria 5246
221 Ga0395900_0003033 3300037418 Bacteria 18282
222 Ga0395900_0012277 3300037418 Bacteria 8760
223 Ga0395900_0275648 3300037418 Bacteria 1676
224 Ga0395898_0194268 3300037466 Bacteria 1939
225 Ga0395905_0007852 3300037471 Bacteria 10568
226 Ga0395905_0125186 3300037471 Bacteria 2417
227 Ga0395901_0003103 3300038443 Bacteria 16712
228 Ga0395901_0027449 3300038443 Bacteria 5849
229 Ga0451853_2066302 3300041512 Bacteria 2792
230 Ga0450920_020532 3300042122 Bacteria 1272
231 Ga0450923_000625 3300042125 Bacteria 4076
232 Ga0450910_000283 3300042147 Bacteria 5872
233 Ga0439460_0023699 3300042461 Bacteria 1695
234 Ga0453684_0233835 3300044712 Bacteria 2120
235 Ga0495603_0003311 3300046455 Bacteria 9588
236 Ga0495603_0009311 3300046455 Bacteria 5939
237 Ga0495603_0047343 3300046455 Bacteria 2561
238 Ga0495629_0000415 3300046459 Bacteria 35795
239 Ga0495629_0240485 3300046459 Bacteria 1247
240 Ga0495641_0011004 3300046461 Bacteria 5189
241 Ga0495580_0027422 3300046472 Bacteria 4144
242 Ga0495582_0008195 3300046473 Bacteria 5768
243 Ga0495605_0068900 3300046474 Bacteria 1676
244 Ga0495639_0000237 3300046475 Bacteria 27553
245 Ga0495662_0008364 3300046476 Bacteria 5088
246 Ga0495662_0027744 3300046476 Bacteria 2735
247 Ga0495608_0111731 3300046511 Bacteria 1757
248 Ga0495630_0000320 3300046517 Bacteria 38423
249 Ga0495631_0012562 3300046518 Bacteria 4133
250 Ga0495644_0006965 3300046523 Bacteria 4375
251 Ga0495663_0042939 3300046525 Bacteria 1379
252 Ga0495666_0000471 3300046526 Bacteria 17921
253 Ga0495666_0073147 3300046526 Bacteria 1627
254 Ga0495665_0008674 3300046531 Bacteria 5518
255 Ga0495640_0008494 3300046533 Bacteria 8050
256 Ga0495586_0009673 3300046535 Bacteria 5133
257 Ga0495598_0000947 3300046537 Bacteria 5603
258 Ga0495621_0003340 3300046539 Bacteria 4423
259 Ga0495633_0069518 3300046558 Bacteria 1644
260 Ga0495667_0104123 3300046559 Bacteria 1835
261 Ga0495656_0003498 3300046615 Bacteria 5312
262 Ga0495656_0101672 3300046615 Bacteria 1330
263 Ga0495634_0017508 3300046642 Bacteria 5110
264 Ga0495634_0141026 3300046642 Bacteria 1530
265 Ga0495659_0008582 3300046664 Bacteria 3252
266 Ga0495588_0000558 3300046674 Bacteria 17914
267 Ga0495647_0000573 3300046681 Bacteria 10853
268 Ga0495647_0041937 3300046681 Bacteria 1745
269 Ga0495658_0008042 3300046683 Bacteria 5221
270 Ga0495613_0000822 3300046689 Bacteria 24037
271 Ga0495613_0083360 3300046689 Bacteria 2322
272 Ga0495624_0003512 3300046690 Bacteria 11623
273 Ga0495670_0003052 3300046691 Bacteria 8259
274 Ga0495670_0041629 3300046691 Bacteria 2292
275 Ga0495636_0025739 3300047318 Bacteria 2390
276 Ga0495636_0055229 3300047318 Bacteria 1670
277 Ga0495674_0000995 3300047319 Bacteria 27252
278 Ga0495674_0080142 3300047319 Bacteria 2802
279 Ga0495676_0071221 3300047321 Bacteria 2673
280 Ga0495676_0098258 3300047321 Bacteria 2172
281 Ga0495676_0116352 3300047321 Bacteria 1953
282 Ga0495676_0129742 3300047321 Bacteria 1822
283 Ga0495676_0218092 3300047321 Bacteria 1316
284 Ga0495680_0006428 3300047322 Bacteria 10922
285 Ga0495680_0120055 3300047322 Bacteria 1942
286 Ga0495677_0065383 3300047445 Bacteria 1352
287 Ga0495677_0078583 3300047445 Bacteria 1235
288 Ga0495684_0012374 3300047471 Bacteria 6582
289 Ga0495593_0008836 3300047673 Bacteria 5848
290 Ga0495614_0010142 3300048089 Bacteria 4158
291 Ga0496100_0095139 3300048903 Bacteria 2041
292 Ga0496100_0319296 3300048903 Bacteria 1166
293 Ga0496101_0013318 3300048904 Bacteria 5507
294 Ga0496102_0014511 3300048905 Bacteria 6845
295 Ga0496102_0042856 3300048905 Bacteria 4102
296 Ga0496102_0128316 3300048905 Bacteria 2372
297 Ga0496102_0368195 3300048905 Bacteria 1353
298 Ga0496103_0001845 3300048906 Bacteria 13778
299 Ga0496103_0132250 3300048906 Bacteria 1594
300 Ga0496105_0193181 3300048908 Bacteria 1664
301 Ga0496106_0017777 3300048909 Bacteria 5259
302 Ga0496107_0063258 3300048910 Bacteria 2681
303 Ga0496107_0120629 3300048910 Bacteria 1932
304 Ga0496109_0031280 3300048912 Bacteria 4775
305 Ga0496109_0040626 3300048912 Bacteria 4213
306 Ga0496109_0146886 3300048912 Bacteria 2206
307 Ga0496110_0482232 3300048913 Bacteria 1129
308 Ga0496111_0079161 3300048914 Bacteria 2397
309 Ga0496112_0047807 3300048915 Bacteria 4197
310 Ga0496113_0038441 3300048916 Bacteria 3519
311 Ga0496113_0042979 3300048916 Bacteria 3342
312 Ga0496113_0094091 3300048916 Bacteria 2315
313 Ga0496114_0003081 3300048917 Bacteria 12777
314 Ga0496114_0052327 3300048917 Bacteria 3402
315 Ga0496114_0431171 3300048917 Bacteria 1168
316 Ga0501031_0006450 3300049568 Bacteria 7649
317 Ga0501031_0007574 3300049568 Bacteria 7072
318 Ga0501031_0042412 3300049568 Bacteria 2970
319 Ga0501032_0025594 3300049569 Bacteria 4067
320 Ga0501032_0048666 3300049569 Bacteria 2862
321 Ga0501033_0019302 3300049570 Bacteria 5153
322 Ga0501034_0029872 3300049571 Bacteria 5540
323 Ga0501036_0003453 3300049572 Bacteria 12629
324 Ga0501036_0018033 3300049572 Bacteria 5909
325 Ga0501036_0042129 3300049572 Bacteria 3865
326 Ga0501036_0080499 3300049572 Bacteria 2753
327 Ga0501036_0111855 3300049572 Bacteria 2308
328 Ga0501036_0120249 3300049572 Bacteria 2218
329 Ga0501036_0157133 3300049572 Bacteria 1917
330 Ga0501037_0010310 3300049573 Bacteria 6855
331 Ga0501037_0025467 3300049573 Bacteria 4371
332 Ga0501037_0086154 3300049573 Bacteria 2274
333 Ga0501038_0010125 3300049574 Bacteria 8630
334 Ga0501038_0064766 3300049574 Bacteria 3116
335 Ga0501038_0155867 3300049574 Bacteria 1859
336 Ga0501039_0024362 3300049575 Bacteria 4648
337 Ga0501039_0034212 3300049575 Bacteria 3921
338 Ga0501039_0036457 3300049575 Bacteria 3795
339 Ga0501039_0044036 3300049575 Bacteria 3447
340 Ga0501039_0055605 3300049575 Bacteria 3066
341 Ga0501040_0001406 3300049576 Bacteria 15215
342 Ga0501040_0026464 3300049576 Bacteria 3901
343 Ga0501040_0026870 3300049576 Bacteria 3872
344 Ga0501040_0031857 3300049576 Bacteria 3565
345 Ga0501040_0102741 3300049576 Bacteria 1995
346 Ga0501040_0113655 3300049576 Bacteria 1894
347 Ga0501041_0043736 3300049577 Bacteria 2722
348 Ga0501041_0095937 3300049577 Bacteria 1833
349 Ga0501041_0142519 3300049577 Bacteria 1494
350 Ga0501042_0011988 3300049578 Bacteria 5859
351 Ga0501042_0017868 3300049578 Bacteria 4900
352 Ga0501042_0021093 3300049578 Bacteria 4536
353 Ga0501042_0070052 3300049578 Bacteria 2508
354 Ga0501042_0141239 3300049578 Bacteria 1736
355 Ga0501043_0021607 3300049579 Bacteria 5045
356 Ga0501043_0193957 3300049579 Bacteria 1579
357 Ga0501046_0022940 3300049580 Bacteria 5139
358 Ga0501046_0032418 3300049580 Bacteria 4230
359 Ga0501046_0084898 3300049580 Bacteria 2441
360 Ga0501046_0132435 3300049580 Bacteria 1890
361 Ga0501046_0136397 3300049580 Bacteria 1858
362 Ga0501046_0193347 3300049580 Bacteria 1517
363 Ga0501047_0039517 3300049581 Bacteria 4563
364 Ga0501047_0361757 3300049581 Bacteria 1287
365 Ga0501048_0014965 3300049582 Bacteria 5736
366 Ga0501048_0018337 3300049582 Bacteria 5149
367 Ga0501048_0018571 3300049582 Bacteria 5111
368 Ga0501048_0028639 3300049582 Bacteria 4043
369 Ga0501048_0037831 3300049582 Bacteria 3465
370 Ga0501048_0073259 3300049582 Bacteria 2417
371 Ga0501048_0083560 3300049582 Bacteria 2252
372 Ga0501067_0002078 3300049583 Bacteria 11027
373 Ga0501067_0034800 3300049583 Bacteria 2796
374 Ga0501067_0045188 3300049583 Bacteria 2446
375 Ga0501067_0072487 3300049583 Bacteria 1908
376 Ga0501068_0013966 3300049584 Bacteria 4581
377 Ga0501068_0015113 3300049584 Bacteria 4428
378 Ga0501068_0019777 3300049584 Bacteria 3915
379 Ga0501069_0002383 3300049585 Bacteria 9535
380 Ga0501069_0014387 3300049585 Bacteria 4230
381 Ga0501069_0016602 3300049585 Bacteria 3956
382 Ga0501069_0092141 3300049585 Bacteria 1714
383 Ga0501069_0139997 3300049585 Bacteria 1388
384 Ga0501070_0003871 3300049586 Bacteria 12909
385 Ga0501070_0019137 3300049586 Bacteria 5743
386 Ga0501070_0031253 3300049586 Bacteria 4461
387 Ga0501070_0042380 3300049586 Bacteria 3791
388 Ga0501070_0060317 3300049586 Bacteria 3144
389 Ga0501070_0115055 3300049586 Bacteria 2222
390 Ga0501070_0303937 3300049586 Bacteria 1299
391 Ga0501071_0004985 3300049587 Bacteria 8485
392 Ga0501071_0017667 3300049587 Bacteria 4924
393 Ga0501071_0031499 3300049587 Bacteria 3759
394 Ga0501071_0049054 3300049587 Bacteria 3038
395 Ga0501071_0098974 3300049587 Bacteria 2148
396 Ga0501071_0100108 3300049587 Bacteria 2136
397 Ga0501072_0004207 3300049588 Bacteria 10913
398 Ga0501072_0004458 3300049588 Bacteria 10639
399 Ga0501072_0012066 3300049588 Bacteria 6602
400 Ga0501072_0012466 3300049588 Bacteria 6499
401 Ga0501072_0019898 3300049588 Bacteria 5195
402 Ga0501072_0024686 3300049588 Bacteria 4679
403 Ga0501072_0024867 3300049588 Bacteria 4662
404 Ga0501072_0076094 3300049588 Bacteria 2655
405 Ga0501073_0005352 3300049589 Bacteria 9623
406 Ga0501073_0040854 3300049589 Bacteria 3280
407 Ga0501073_0095593 3300049589 Bacteria 2063
408 Ga0501073_0126270 3300049589 Bacteria 1773
409 Ga0501074_0000522 3300049590 Bacteria 23620
410 Ga0501074_0009705 3300049590 Bacteria 6991
411 Ga0501074_0011816 3300049590 Bacteria 6346
412 Ga0501074_0014778 3300049590 Bacteria 5680
413 Ga0501074_0023064 3300049590 Bacteria 4526
414 Ga0501074_0174072 3300049590 Bacteria 1536
415 Ga0501075_0001004 3300049591 Bacteria 18034
416 Ga0501075_0003709 3300049591 Bacteria 10260
417 Ga0501075_0007233 3300049591 Bacteria 7694
418 Ga0501075_0010363 3300049591 Bacteria 6549
419 Ga0501075_0011027 3300049591 Bacteria 6378
420 Ga0501075_0102306 3300049591 Bacteria 2176
421 Ga0501075_0131968 3300049591 Bacteria 1903
422 Ga0501076_0006926 3300049592 Bacteria 8235
423 Ga0501076_0007812 3300049592 Bacteria 7796
424 Ga0501076_0012160 3300049592 Bacteria 6434
425 Ga0501076_0037246 3300049592 Bacteria 3813
426 Ga0501076_0114173 3300049592 Bacteria 2185
427 Ga0501077_0008773 3300049593 Bacteria 6273
428 Ga0501077_0028235 3300049593 Bacteria 3565
429 Ga0501077_0040044 3300049593 Bacteria 2985
430 Ga0501077_0048855 3300049593 Bacteria 2689
431 Ga0501079_0007853 3300049741 Bacteria 8079
432 Ga0501079_0012227 3300049741 Bacteria 6556
433 Ga0501079_0024083 3300049741 Bacteria 4671
434 Ga0501079_0036230 3300049741 Bacteria 3800
435 Ga0501079_0055803 3300049741 Bacteria 3048
436 Ga0501079_0055861 3300049741 Bacteria 3046
437 Ga0501079_0060743 3300049741 Bacteria 2915
438 Ga0501079_0064815 3300049741 Bacteria 2818
439 Ga0501079_0081615 3300049741 Bacteria 2500
440 Ga0501080_0009771 3300049742 Bacteria 8764
441 Ga0501080_0013854 3300049742 Bacteria 7421
442 Ga0501080_0022640 3300049742 Bacteria 5820
443 Ga0501080_0035073 3300049742 Bacteria 4683
444 Ga0501080_0073941 3300049742 Bacteria 3171
445 Ga0501081_0006024 3300049743 Bacteria 7847
446 Ga0501081_0008878 3300049743 Bacteria 6533
447 Ga0501081_0013135 3300049743 Bacteria 5447
448 Ga0501081_0022570 3300049743 Bacteria 4212
449 Ga0501081_0028175 3300049743 Bacteria 3789
450 Ga0501081_0043422 3300049743 Bacteria 3084
451 Ga0501081_0058824 3300049743 Bacteria 2660
452 Ga0501081_0082926 3300049743 Bacteria 2246
453 Ga0501081_0084996 3300049743 Bacteria 2220
454 Ga0501081_0086366 3300049743 Bacteria 2202
455 Ga0501083_0004160 3300049744 Bacteria 10189
456 Ga0501083_0038943 3300049744 Bacteria 3230
457 Ga0501083_0042749 3300049744 Bacteria 3071
458 Ga0501083_0046107 3300049744 Bacteria 2948
459 Ga0501035_0014265 3300049822 Bacteria 7335
460 Ga0501035_0029585 3300049822 Bacteria 4995
461 Ga0501035_0101734 3300049822 Bacteria 2521
462 Ga0501044_0018858 3300049823 Bacteria 7387
463 Ga0501044_0150033 3300049823 Bacteria 2314
464 Ga0501044_0394217 3300049823 Bacteria 1298
465 Ga0501045_0013737 3300049824 Bacteria 5725
466 Ga0501045_0014723 3300049824 Bacteria 5545
467 Ga0501045_0027504 3300049824 Bacteria 4099
468 Ga0501045_0032083 3300049824 Bacteria 3805
469 Ga0501045_0043599 3300049824 Bacteria 3267
470 Ga0501045_0097705 3300049824 Bacteria 2173
471 Ga0501045_0130411 3300049824 Bacteria 1868
472 nmdc:mga05p37_150_c1 3300050507 Bacteria 65679
473 nmdc:mga09592_51108_c1 3300050508 Bacteria 3486
474 nmdc:mga06r32_128662_c1 3300050510 Bacteria 2502
475 nmdc:mga08y16_112838_c1 3300050511 Bacteria 2830
476 nmdc:mga08y16_32239_c1 3300050511 Bacteria 5510
477 nmdc:mga08y16_6621_c1 3300050511 Bacteria 12148
478 nmdc:mga0n895_140753_c1 3300050512 Bacteria 2441
479 nmdc:mga0n895_14909_c1 3300050512 Bacteria 7077
480 nmdc:mga0rr50_59201_c1 3300050513 Bacteria 2875
481 nmdc:mga08x19_151910_c1 3300050514 Bacteria 1568
482 nmdc:mga0a205_126889_c1 3300050515 Bacteria 2451
483 nmdc:mga0a205_27090_c1 3300050515 Bacteria 5472
484 Ga0495612_0005928 3300053078 Bacteria 5036
485 Ga0495595_0027424 3300053084 Bacteria 2538
486 Ga0495619_0002777 3300053085 Bacteria 11421
487 Ga0501084_0013831 3300054114 Bacteria 6680
488 Ga0501084_0019730 3300054114 Bacteria 5618
489 Ga0501084_0021051 3300054114 Bacteria 5440
490 Ga0501084_0023939 3300054114 Bacteria 5094
491 Ga0501084_0028942 3300054114 Bacteria 4631
492 Ga0501084_0038204 3300054114 Bacteria 4013
493 Ga0501084_0052345 3300054114 Bacteria 3416
494 Ga0501084_0135703 3300054114 Bacteria 2071
495 Ga0501084_0141071 3300054114 Bacteria 2029
496 Ga0501084_0364919 3300054114 Bacteria 1220
497 Ga0501084_0366149 3300054114 Bacteria 1218
498 Ga0590071_003679 3300059421 Bacteria 3765
499 Ga0590077_012034 3300059426 Bacteria 1789
500 Ga0501082_0003188 3300060353 Bacteria 14303
501 Ga0501082_0013918 3300060353 Bacteria 6918
502 Ga0501082_0050134 3300060353 Bacteria 3600
503 Ga0501082_0051520 3300060353 Bacteria 3548
504 Ga0501082_0059162 3300060353 Bacteria 3302
505 Ga0501082_0071788 3300060353 Bacteria 2981
506 Ga0501082_0075896 3300060353 Bacteria 2896
507 Ga0501082_0133234 3300060353 Bacteria 2156
508 Ga0501082_0135698 3300060353 Bacteria 2135
509 Ga0530510_0007472 3300061734 Bacteria 7609
510 Ga0530510_0014779 3300061734 Bacteria 5511
511 Ga0530510_0017491 3300061734 Bacteria 5081
512 Ga0530510_0021899 3300061734 Bacteria 4549
513 Ga0530510_0095330 3300061734 Bacteria 2173
514 Ga0530510_0096358 3300061734 Bacteria 2162
515 Ga0530510_0135875 3300061734 Bacteria 1810
516 Ga0530510_0164646 3300061734 Bacteria 1641
517 Ga0530510_0222435 3300061734 Bacteria 1403
518 Ga0070708_100030365
519 JGI24751J29686_10000889
520 Ga0070683_100085179
521 Ga0070690_100353566
522 Ga0070670_100016625
523 Ga0070670_100029956
524 Ga0070680_100160895
525 Ga0068868_100245085
526 Ga0070661_100024800
527 Ga0070692_10031450
528 Ga0070675_100362240
529 Ga0070674_100018100
530 Ga0070674_100070074
531 Ga0070659_100088543
532 Ga0070703_10000026
533 Ga0070703_10003052
534 Ga0070705_100022607
535 Ga0070700_100012794
536 Ga0070700_100046236
537 Ga0070700_100103165
538 Ga0070694_100041269
539 Ga0070694_100070526
540 Ga0070708_100000120
541 Ga0070708_100034914
542 Ga0070708_100344393
543 Ga0070663_100019958
544 Ga0070678_100032088
545 Ga0070681_10057785
546 Ga0068867_100016271
547 Ga0070706_100001624
548 Ga0070706_100124987
549 Ga0070706_100363725
550 Ga0070707_100004774
551 Ga0070707_100098916
552 Ga0070698_100003152
553 Ga0070698_100069293
554 Ga0070698_100088761
555 Ga0070698_100216052
556 Ga0070699_100049684
557 Ga0070697_100112154
558 Ga0070686_100189632
559 Ga0070695_100035757
560 Ga0070696_100000846
561 Ga0070696_100018069
562 Ga0070696_100023487
563 Ga0070696_100039791
564 Ga0070696_100127629
565 Ga0070704_100008209
566 Ga0070704_100008774
567 Ga0070704_100091121
568 Ga0070704_100276729
569 Ga0070664_100039634
570 Ga0070664_100159119
571 Ga0068854_100121202
572 Ga0070702_100042704
573 Ga0068859_100566576
574 Ga0068866_10011818
575 Ga0068866_10017313
576 Ga0068861_100038633
577 Ga0068861_100111228
578 Ga0068870_10000948
579 Ga0068863_100007731
580 Ga0068860_100007735
581 Ga0068862_100084684
582 Ga0068862_100198520
583 Ga0068862_100251430
584 Ga0081455_10000975
585 Ga0081455_10026728
586 Ga0081455_10112468
587 Ga0081455_10189661
588 Ga0081539_10026282
589 Ga0075365_10027892
590 Ga0070712_100004268
591 Ga0068871_100018498
592 Ga0075428_100005544
593 Ga0075430_100033318
594 Ga0075431_100217900
595 Ga0075431_100244984
596 Ga0075433_10004834
597 Ga0075433_10038342
598 Ga0075433_10147238
599 Ga0075433_10155308
600 Ga0075434_100002647
601 Ga0075434_100056825
602 Ga0075434_100092391
603 Ga0068865_100127978
604 Ga0068865_100134854
605 Ga0097620_100566586
606 Ga0075435_100070485
607 Ga0111539_10021109
608 Ga0111539_10209449
609 Ga0111539_10307665
610 Ga0105245_10293009
611 Ga0114129_10016681
612 Ga0114129_10136909
613 Ga0114129_10215343
614 Ga0114129_10317344
615 Ga0105243_10011013
616 Ga0105243_10029126
617 Ga0105243_10154389
618 Ga0105241_10423925
619 Ga0105242_10001608
620 Ga0105242_10225013
621 Ga0105242_10276885
622 Ga0105248_10122624
623 Ga0105249_10029085
624 Ga0105249_10071434
625 Ga0105249_10192081
626 Ga0157374_10040187
627 Ga0157378_10017467
628 Ga0157378_10027559
629 Ga0163162_10158276
630 Ga0163162_10571029
631 Ga0157375_10060561
632 Ga0157375_10088886
633 Ga0163163_10023549
634 Ga0163163_10114666
635 Ga0163163_10256975
636 Ga0157380_10018192
637 Ga0157380_10179801
638 Ga0157377_10022463
639 Ga0157377_10035361
640 Ga0157377_10055677
641 Ga0157379_10039444
642 Ga0163161_10174563
643 Ga0207653_10000009
644 Ga0207688_10009143
645 Ga0207685_10001387
646 Ga0207643_10008641
647 Ga0207643_10104302
648 Ga0207684_10000058
649 Ga0207684_10000839
650 Ga0207684_10013206
651 Ga0207707_10055726
652 Ga0207707_10076100
653 Ga0207693_10000707
654 Ga0207660_10075735
655 Ga0207662_10000078
656 Ga0207646_10008172
657 Ga0207646_10009587
658 Ga0207646_10019536
659 Ga0207646_10052678
660 Ga0207646_10087068
661 Ga0207646_10097799
662 Ga0207646_10168360
663 Ga0207694_10180994
664 Ga0207650_10009562
665 Ga0207659_10130163
666 Ga0207659_10139989
667 Ga0207644_10181877
668 Ga0207690_10249401
669 Ga0207706_10015736
670 Ga0207686_10013650
671 Ga0207686_10017530
672 Ga0207709_10050198
673 Ga0207709_10070613
674 Ga0207670_10020230
675 Ga0207669_10003317
676 Ga0207704_10016169
677 Ga0207665_10129461
678 Ga0207689_10023568
679 Ga0207661_10160006
680 Ga0207679_10048156
681 Ga0207679_10290130
682 Ga0207712_10042878
683 Ga0207712_10079992
684 Ga0207668_10398030
685 Ga0207640_10136679
686 Ga0207703_10116827
687 Ga0207678_10022060
688 Ga0207678_10025319
689 Ga0207708_10021501
690 Ga0207708_10030051
691 Ga0207641_10101084
692 Ga0207648_10000305
693 Ga0207676_10014990
694 Ga0207676_10240871
695 Ga0207674_10004254
696 Ga0207674_10018061
697 Ga0207674_10092634
698 Ga0207674_10164095
699 Ga0207675_100027889
700 Ga0207675_100062074
701 Ga0207675_100088781
702 Ga0207683_10052178
703 Ga0207683_10054034
704 Ga0207683_10092033
705 Ga0207698_10080173
706 Ga0209966_1006856
707 Ga0209998_10000055
708 Ga0209974_10016892
709 Ga0207428_10003022
710 Ga0207428_10025649
711 Ga0268265_10257186
712 Ga0265318_10012110
713 Ga0307408_100084263
714 Ga0265314_10080020
715 Ga0316577_10062474
716 Ga0307409_100062570
717 Ga0307416_100008524
718 Ga0307416_100037445
719 Ga0307415_100001473
720 Ga0307415_100098787
721 Ga0373926_0000015
722 Ga0373944_0001402
723 Ga0373923_0048566
724 Ga0373936_0003885
725 Ga0373945_0000009
726 Ga0373943_0010887
727 Ga0373943_0095522
728 Ga0373946_0000046
729 Ga0373931_0010106
730 Ga0373935_0010658
731 Ga0373947_0000352
732 Ga0373947_0140905
733 Ga0316584_0078915
734 Ga0373925_0041882
735 Ga0373925_0119454
736 Ga0373925_0127256
737 Ga0395899_0018833
738 Ga0395900_0003033
739 Ga0395900_0012277
740 Ga0395900_0275648
741 Ga0395898_0194268
742 Ga0395905_0007852
743 Ga0395905_0125186
744 Ga0395901_0003103
745 Ga0395901_0027449
746 Ga0451853_2066302
747 Ga0450920_020532
748 Ga0450923_000625
749 Ga0450910_000283
750 Ga0439460_0023699
751 Ga0453684_0233835
752 Ga0495603_0003311
753 Ga0495603_0009311
754 Ga0495603_0047343
755 Ga0495629_0000415
756 Ga0495629_0240485
757 Ga0495641_0011004
758 Ga0495580_0027422
759 Ga0495582_0008195
760 Ga0495605_0068900
761 Ga0495639_0000237
762 Ga0495662_0008364
763 Ga0495662_0027744
764 Ga0495608_0111731
765 Ga0495630_0000320
766 Ga0495631_0012562
767 Ga0495644_0006965
768 Ga0495663_0042939
769 Ga0495666_0000471
770 Ga0495666_0073147
771 Ga0495665_0008674
772 Ga0495640_0008494
773 Ga0495586_0009673
774 Ga0495598_0000947
775 Ga0495621_0003340
776 Ga0495633_0069518
777 Ga0495667_0104123
778 Ga0495656_0003498
779 Ga0495656_0101672
780 Ga0495634_0017508
781 Ga0495634_0141026
782 Ga0495659_0008582
783 Ga0495588_0000558
784 Ga0495647_0000573
785 Ga0495647_0041937
786 Ga0495658_0008042
787 Ga0495613_0000822
788 Ga0495613_0083360
789 Ga0495624_0003512
790 Ga0495670_0003052
791 Ga0495670_0041629
792 Ga0495636_0025739
793 Ga0495636_0055229
794 Ga0495674_0000995
795 Ga0495674_0080142
796 Ga0495676_0071221
797 Ga0495676_0098258
798 Ga0495676_0116352
799 Ga0495676_0129742
800 Ga0495676_0218092
801 Ga0495680_0006428
802 Ga0495680_0120055
803 Ga0495677_0065383
804 Ga0495677_0078583
805 Ga0495684_0012374
806 Ga0495593_0008836
807 Ga0495614_0010142
808 Ga0496100_0095139
809 Ga0496100_0319296
810 Ga0496101_0013318
811 Ga0496102_0014511
812 Ga0496102_0042856
813 Ga0496102_0128316
814 Ga0496102_0368195
815 Ga0496103_0001845
816 Ga0496103_0132250
817 Ga0496105_0193181
818 Ga0496106_0017777
819 Ga0496107_0063258
820 Ga0496107_0120629
821 Ga0496109_0031280
822 Ga0496109_0040626
823 Ga0496109_0146886
824 Ga0496110_0482232
825 Ga0496111_0079161
826 Ga0496112_0047807
827 Ga0496113_0038441
828 Ga0496113_0042979
829 Ga0496113_0094091
830 Ga0496114_0003081
831 Ga0496114_0052327
832 Ga0496114_0431171
833 Ga0501031_0006450
834 Ga0501031_0007574
835 Ga0501031_0042412
836 Ga0501032_0025594
837 Ga0501032_0048666
838 Ga0501033_0019302
839 Ga0501034_0029872
840 Ga0501036_0003453
841 Ga0501036_0018033
842 Ga0501036_0042129
843 Ga0501036_0080499
844 Ga0501036_0111855
845 Ga0501036_0120249
846 Ga0501036_0157133
847 Ga0501037_0010310
848 Ga0501037_0025467
849 Ga0501037_0086154
850 Ga0501038_0010125
851 Ga0501038_0064766
852 Ga0501038_0155867
853 Ga0501039_0024362
854 Ga0501039_0034212
855 Ga0501039_0036457
856 Ga0501039_0044036
857 Ga0501039_0055605
858 Ga0501040_0001406
859 Ga0501040_0026464
860 Ga0501040_0026870
861 Ga0501040_0031857
862 Ga0501040_0102741
863 Ga0501040_0113655
864 Ga0501041_0043736
865 Ga0501041_0095937
866 Ga0501041_0142519
867 Ga0501042_0011988
868 Ga0501042_0017868
869 Ga0501042_0021093
870 Ga0501042_0070052
871 Ga0501042_0141239
872 Ga0501043_0021607
873 Ga0501043_0193957
874 Ga0501046_0022940
875 Ga0501046_0032418
876 Ga0501046_0084898
877 Ga0501046_0132435
878 Ga0501046_0136397
879 Ga0501046_0193347
880 Ga0501047_0039517
881 Ga0501047_0361757
882 Ga0501048_0014965
883 Ga0501048_0018337
884 Ga0501048_0018571
885 Ga0501048_0028639
886 Ga0501048_0037831
887 Ga0501048_0073259
888 Ga0501048_0083560
889 Ga0501067_0002078
890 Ga0501067_0034800
891 Ga0501067_0045188
892 Ga0501067_0072487
893 Ga0501068_0013966
894 Ga0501068_0015113
895 Ga0501068_0019777
896 Ga0501069_0002383
897 Ga0501069_0014387
898 Ga0501069_0016602
899 Ga0501069_0092141
900 Ga0501069_0139997
901 Ga0501070_0003871
902 Ga0501070_0019137
903 Ga0501070_0031253
904 Ga0501070_0042380
905 Ga0501070_0060317
906 Ga0501070_0115055
907 Ga0501070_0303937
908 Ga0501071_0004985
909 Ga0501071_0017667
910 Ga0501071_0031499
911 Ga0501071_0049054
912 Ga0501071_0098974
913 Ga0501071_0100108
914 Ga0501072_0004207
915 Ga0501072_0004458
916 Ga0501072_0012066
917 Ga0501072_0012466
918 Ga0501072_0019898
919 Ga0501072_0024686
920 Ga0501072_0024867
921 Ga0501072_0076094
922 Ga0501073_0005352
923 Ga0501073_0040854
924 Ga0501073_0095593
925 Ga0501073_0126270
926 Ga0501074_0000522
927 Ga0501074_0009705
928 Ga0501074_0011816
929 Ga0501074_0014778
930 Ga0501074_0023064
931 Ga0501074_0174072
932 Ga0501075_0001004
933 Ga0501075_0003709
934 Ga0501075_0007233
935 Ga0501075_0010363
936 Ga0501075_0011027
937 Ga0501075_0102306
938 Ga0501075_0131968
939 Ga0501076_0006926
940 Ga0501076_0007812
941 Ga0501076_0012160
942 Ga0501076_0037246
943 Ga0501076_0114173
944 Ga0501077_0008773
945 Ga0501077_0028235
946 Ga0501077_0040044
947 Ga0501077_0048855
948 Ga0501079_0007853
949 Ga0501079_0012227
950 Ga0501079_0024083
951 Ga0501079_0036230
952 Ga0501079_0055803
953 Ga0501079_0055861
954 Ga0501079_0060743
955 Ga0501079_0064815
956 Ga0501079_0081615
957 Ga0501080_0009771
958 Ga0501080_0013854
959 Ga0501080_0022640
960 Ga0501080_0035073
961 Ga0501080_0073941
962 Ga0501081_0006024
963 Ga0501081_0008878
964 Ga0501081_0013135
965 Ga0501081_0022570
966 Ga0501081_0028175
967 Ga0501081_0043422
968 Ga0501081_0058824
969 Ga0501081_0082926
970 Ga0501081_0084996
971 Ga0501081_0086366
972 Ga0501083_0004160
973 Ga0501083_0038943
974 Ga0501083_0042749
975 Ga0501083_0046107
976 Ga0501035_0014265
977 Ga0501035_0029585
978 Ga0501035_0101734
979 Ga0501044_0018858
980 Ga0501044_0150033
981 Ga0501044_0394217
982 Ga0501045_0013737
983 Ga0501045_0014723
984 Ga0501045_0027504
985 Ga0501045_0032083
986 Ga0501045_0043599
987 Ga0501045_0097705
988 Ga0501045_0130411
989 nmdc:mga05p37_150_c1
990 nmdc:mga09592_51108_c1
991 nmdc:mga06r32_128662_c1
992 nmdc:mga08y16_112838_c1
993 nmdc:mga08y16_32239_c1
994 nmdc:mga08y16_6621_c1
995 nmdc:mga0n895_140753_c1
996 nmdc:mga0n895_14909_c1
997 nmdc:mga0rr50_59201_c1
998 nmdc:mga08x19_151910_c1
999 nmdc:mga0a205_126889_c1
1000 nmdc:mga0a205_27090_c1
1001 Ga0495612_0005928
1002 Ga0495595_0027424
1003 Ga0495619_0002777
1004 Ga0501084_0013831
1005 Ga0501084_0019730
1006 Ga0501084_0021051
1007 Ga0501084_0023939
1008 Ga0501084_0028942
1009 Ga0501084_0038204
1010 Ga0501084_0052345
1011 Ga0501084_0135703
1012 Ga0501084_0141071
1013 Ga0501084_0364919
1014 Ga0501084_0366149
1015 Ga0590071_003679
1016 Ga0590077_012034
1017 Ga0501082_0003188
1018 Ga0501082_0013918
1019 Ga0501082_0050134
1020 Ga0501082_0051520
1021 Ga0501082_0059162
1022 Ga0501082_0071788
1023 Ga0501082_0075896
1024 Ga0501082_0133234
1025 Ga0501082_0135698
1026 Ga0530510_0007472
1027 Ga0530510_0014779
1028 Ga0530510_0017491
1029 Ga0530510_0021899
1030 Ga0530510_0095330
1031 Ga0530510_0096358
1032 Ga0530510_0135875
1033 Ga0530510_0164646
1034 Ga0530510_0222435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

100

379

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c0h-assembly1.cif.gz_C error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8c0h 0.9301 30 340
7esr-assembly1.cif.gz_A crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) 0.9298 30 340
7lox-assembly1.cif.gz_C-2 the structure of agmatinase from e. coli at 3.2 a displaying guanidine in the active site 0.9117 36 339
7lox-assembly1.cif.gz_A-2 the structure of agmatinase from e. coli at 3.2 a displaying guanidine in the active site 0.9105 36 339
7lba-assembly1.cif.gz_A e. coli agmatinase 0.909 37 342
ID Description Score Start End Superfamily
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9082 31 340 3.40.800.10
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9049 58 337 3.40.800.10
2a0mA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9048 55 340 3.40.800.10
af_P60651_4_305_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9029 31 342 3.40.800.10
3pzlA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8974 55 337 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A7K0UY26-F1-model_v4 Agmatinase 0.9586 192 341 GO:0008783
GO:0033389
GO:0046872
AF-A0A1C3NWI0-F1-model_v4 Agmatinase (EC 3.5.3.11) 0.9585 108 338 GO:0008783
GO:0033389
GO:0046872
AF-A0A1J5PKG1-F1-model_v4 Guanidinobutyrase (EC 3.5.3.7) 0.9559 115 341 GO:0008783
GO:0033389
GO:0046872
GO:0047971
AF-A0A2E3PH01-F1-model_v4 Agmatinase 0.954 202 340 GO:0008783
GO:0033389
GO:0046872
AF-A0A7W0V7J6-F1-model_v4 Arginase family protein 0.9519 202 340 GO:0008783
GO:0033389
GO:0046872

Map