F458048

General Info

Members Datasets Scaffolds Average Seq Length
516 269 1032 196

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0305522|Ga0495645_0305522_224_901
Length 225
Sequence VDHRARVDGTRTSSLSLLNRGQEQIMRSDIAPGGTFPDYELPDHESVSRKLSEIQGDDPLILTLARGHYCPKEHQQHLELAANYPKIAVAYTNVATISTDTHHTNQEFRASTGAQWPFLSDPERTVQKDLEIQEYTDPEHDPMIPHTLVLKPGLVIYAIYNGYWFWGRPSFADLWRDLRAVTREIRPDWDLSKPGLHEAWDAGDYSPFHGWNKRSPDSMPSSYHS

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 14.34
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0305522 3300046543 Bacteria 1038
2 JGI24743J22301_10043659 3300001991 Bacteria 904
3 Ga0070658_10184480 3300005327 Bacteria 1757
4 Ga0070683_100068190 3300005329 Bacteria 3314
5 Ga0070683_100177218 3300005329 Bacteria 2024
6 Ga0070690_100107055 3300005330 Bacteria 1861
7 Ga0070690_100391212 3300005330 Bacteria 1019
8 Ga0068869_100052024 3300005334 Bacteria 2972
9 Ga0070680_100008147 3300005336 Bacteria 8007
10 Ga0070680_100292959 3300005336 Bacteria 1379
11 Ga0070682_100030232 3300005337 Bacteria 3268
12 Ga0068868_100166387 3300005338 Bacteria 1824
13 Ga0068868_100563374 3300005338 Bacteria 1005
14 Ga0068868_101022953 3300005338 Bacteria 757
15 Ga0070660_100147145 3300005339 Bacteria 1893
16 Ga0070660_100184783 3300005339 Bacteria 1687
17 Ga0070689_100285315 3300005340 Bacteria 1370
18 Ga0070689_100422125 3300005340 Bacteria 1130
19 Ga0070687_100008908 3300005343 Bacteria 4270
20 Ga0070687_100039359 3300005343 Bacteria 2376
21 Ga0070687_100155795 3300005343 Bacteria 1346
22 Ga0070661_100014263 3300005344 Bacteria 5598
23 Ga0070668_100539568 3300005347 Bacteria 1014
24 Ga0070669_100768593 3300005353 Bacteria 817
25 Ga0070671_100286127 3300005355 Bacteria 1402
26 Ga0070674_100152368 3300005356 Bacteria 1746
27 Ga0070673_100459547 3300005364 Bacteria 1146
28 Ga0070673_100870175 3300005364 Bacteria 835
29 Ga0070688_100827390 3300005365 Bacteria 726
30 Ga0070659_100086344 3300005366 Bacteria 2510
31 Ga0070709_10085903 3300005434 Bacteria 2064
32 Ga0070709_10124257 3300005434 Bacteria 1753
33 Ga0070709_10125003 3300005434 Bacteria 1749
34 Ga0070714_100008631 3300005435 Bacteria 7971
35 Ga0070714_100041603 3300005435 Bacteria 3879
36 Ga0070714_100150997 3300005435 Bacteria 2093
37 Ga0070714_100404864 3300005435 Bacteria 1290
38 Ga0070713_100022543 3300005436 Bacteria 4868
39 Ga0070713_100041523 3300005436 Bacteria 3748
40 Ga0070713_100079828 3300005436 Bacteria 2788
41 Ga0070713_100228864 3300005436 Bacteria 1689
42 Ga0070713_100315857 3300005436 Bacteria 1442
43 Ga0070713_100460114 3300005436 Bacteria 1196
44 Ga0070713_100536991 3300005436 Unclassified 1106
45 Ga0070713_100879952 3300005436 Bacteria 861
46 Ga0070710_10001852 3300005437 Bacteria 9960
47 Ga0070710_10003005 3300005437 Bacteria 8022
48 Ga0070710_10269323 3300005437 Bacteria 1101
49 Ga0070710_10799246 3300005437 Bacteria 674
50 Ga0070711_100010929 3300005439 Bacteria 5629
51 Ga0070711_100046060 3300005439 Bacteria 2969
52 Ga0070711_100190325 3300005439 Bacteria 1576
53 Ga0070711_100684347 3300005439 Bacteria 862
54 Ga0070705_100021162 3300005440 Bacteria 3455
55 Ga0070705_100089980 3300005440 Bacteria 1909
56 Ga0070694_100657888 3300005444 Bacteria 848
57 Ga0070708_101228598 3300005445 Bacteria 701
58 Ga0070663_100027319 3300005455 Bacteria 3874
59 Ga0070663_100120335 3300005455 Bacteria 1982
60 Ga0070663_101129022 3300005455 Bacteria 686
61 Ga0070678_100026364 3300005456 Bacteria 3928
62 Ga0070662_100008052 3300005457 Bacteria 6859
63 Ga0070662_100780119 3300005457 Bacteria 812
64 Ga0070681_10017524 3300005458 Bacteria 7159
65 Ga0068867_100044086 3300005459 Bacteria 3266
66 Ga0068867_100417471 3300005459 Bacteria 1136
67 Ga0070685_10282605 3300005466 Bacteria 1112
68 Ga0070685_10805868 3300005466 Bacteria 693
69 Ga0070706_100684292 3300005467 Bacteria 952
70 Ga0070706_101230331 3300005467 Bacteria 688
71 Ga0070707_100400451 3300005468 Bacteria 1333
72 Ga0070698_100027404 3300005471 Bacteria 5925
73 Ga0070679_100023785 3300005530 Bacteria 6002
74 Ga0070679_100100435 3300005530 Bacteria 2879
75 Ga0070679_100225629 3300005530 Bacteria 1834
76 Ga0070684_100167683 3300005535 Bacteria 1994
77 Ga0070684_100431122 3300005535 Bacteria 1217
78 Ga0070684_100649729 3300005535 Bacteria 982
79 Ga0068853_100389720 3300005539 Bacteria 1302
80 Ga0070696_100407854 3300005546 Bacteria 1064
81 Ga0070693_100098370 3300005547 Bacteria 1778
82 Ga0070693_100648457 3300005547 Bacteria 768
83 Ga0070665_100213829 3300005548 Bacteria 1929
84 Ga0070665_101226172 3300005548 Bacteria 761
85 Ga0070704_100217500 3300005549 Bacteria 1551
86 Ga0070664_100055919 3300005564 Bacteria 3352
87 Ga0070664_100069130 3300005564 Bacteria 3021
88 Ga0068857_100091403 3300005577 Bacteria 2724
89 Ga0068857_100843214 3300005577 Bacteria 877
90 Ga0068854_100024776 3300005578 Bacteria 4111
91 Ga0068854_100116107 3300005578 Bacteria 2025
92 Ga0068856_100036893 3300005614 Bacteria 4794
93 Ga0068856_100061948 3300005614 Bacteria 3695
94 Ga0068856_100099286 3300005614 Bacteria 2902
95 Ga0068856_100210045 3300005614 Bacteria 1962
96 Ga0068856_100538753 3300005614 Bacteria 1188
97 Ga0070702_100026814 3300005615 Bacteria 3101
98 Ga0070702_100032219 3300005615 Bacteria 2875
99 Ga0070702_100142867 3300005615 Bacteria 1527
100 Ga0070702_100261490 3300005615 Bacteria 1178
101 Ga0068852_100136709 3300005616 Bacteria 2263
102 Ga0068859_100055663 3300005617 Bacteria 3979
103 Ga0068859_100647306 3300005617 Bacteria 1149
104 Ga0068864_100320168 3300005618 Bacteria 1456
105 Ga0068864_100832441 3300005618 Bacteria 908
106 Ga0068866_10205218 3300005718 Bacteria 1180
107 Ga0068861_100004717 3300005719 Bacteria 9162
108 Ga0068870_10031738 3300005840 Bacteria 2678
109 Ga0068863_100840088 3300005841 Bacteria 917
110 Ga0068860_100170349 3300005843 Bacteria 2103
111 Ga0068860_100174806 3300005843 Bacteria 2075
112 Ga0068862_100096171 3300005844 Bacteria 2585
113 Ga0068862_100123426 3300005844 Bacteria 2285
114 Ga0068862_100232885 3300005844 Bacteria 1672
115 Ga0081540_1000155 3300005983 Bacteria 70266
116 Ga0070717_10006152 3300006028 Bacteria 8813
117 Ga0070717_10018509 3300006028 Bacteria 5440
118 Ga0070717_10057462 3300006028 Bacteria 3216
119 Ga0070717_10256431 3300006028 Bacteria 1546
120 Ga0070717_10286230 3300006028 Bacteria 1462
121 Ga0070717_10354448 3300006028 Bacteria 1312
122 Ga0070717_10396704 3300006028 Bacteria 1239
123 Ga0070717_10474302 3300006028 Bacteria 1129
124 Ga0070715_10088627 3300006163 Bacteria 1419
125 Ga0070715_10275817 3300006163 Bacteria 889
126 Ga0070716_100060065 3300006173 Bacteria 2194
127 Ga0070716_100289320 3300006173 Bacteria 1134
128 Ga0070712_100018324 3300006175 Bacteria 4546
129 Ga0070712_100046123 3300006175 Bacteria 3012
130 Ga0097621_100011694 3300006237 Bacteria 6478
131 Ga0097621_100095618 3300006237 Bacteria 2492
132 Ga0068871_100034118 3300006358 Bacteria 4035
133 Ga0075434_100140985 3300006871 Bacteria 2430
134 Ga0068865_100016279 3300006881 Bacteria 4755
135 Ga0068865_100105924 3300006881 Bacteria 2066
136 Ga0068865_100244109 3300006881 Bacteria 1414
137 Ga0075436_100245861 3300006914 Bacteria 1273
138 Ga0075436_100551733 3300006914 Bacteria 846
139 Ga0097620_100055663 3300006931 Bacteria 3979
140 Ga0097620_100647348 3300006931 Bacteria 1149
141 Ga0075435_100212985 3300007076 Bacteria 1640
142 Ga0075435_100287394 3300007076 Bacteria 1404
143 Ga0075435_100915758 3300007076 Bacteria 765
144 Ga0105251_10109446 3300009011 Bacteria 1260
145 Ga0105244_10316240 3300009036 Bacteria 721
146 Ga0111539_10813394 3300009094 Bacteria 1087
147 Ga0105245_10019275 3300009098 Bacteria 5973
148 Ga0105245_10416401 3300009098 Bacteria 1346
149 Ga0105247_10010794 3300009101 Bacteria 5516
150 Ga0105247_10060623 3300009101 Bacteria 2345
151 Ga0105247_10357736 3300009101 Bacteria 1028
152 Ga0105243_10003338 3300009148 Bacteria 13022
153 Ga0105243_10006526 3300009148 Bacteria 9012
154 Ga0105241_10133548 3300009174 Bacteria 2012
155 Ga0105242_10024226 3300009176 Bacteria 4791
156 Ga0105242_11416227 3300009176 Bacteria 723
157 Ga0105248_10239798 3300009177 Bacteria 2041
158 Ga0105248_10554443 3300009177 Bacteria 1297
159 Ga0105237_10198262 3300009545 Bacteria 2007
160 Ga0105237_10479737 3300009545 Bacteria 1250
161 Ga0105237_10512588 3300009545 Bacteria 1206
162 Ga0105249_10008068 3300009553 Bacteria 9179
163 Ga0105249_10102885 3300009553 Bacteria 2689
164 Ga0105239_10257243 3300010375 Bacteria 1962
165 Ga0105246_10060409 3300011119 Bacteria 2634
166 Ga0105246_10527794 3300011119 Bacteria 1007
167 Ga0105246_10560788 3300011119 Bacteria 980
168 Ga0157371_10074024 3300013102 Bacteria 2412
169 Ga0157370_10133643 3300013104 Bacteria 2314
170 Ga0157369_10034883 3300013105 Bacteria 5518
171 Ga0157374_10020987 3300013296 Bacteria 5803
172 Ga0163162_10026062 3300013306 Bacteria 5778
173 Ga0157375_10384223 3300013308 Bacteria 1571
174 Ga0157375_11307911 3300013308 Bacteria 852
175 Ga0163163_10026205 3300014325 Bacteria 5569
176 Ga0163163_10082414 3300014325 Bacteria 3220
177 Ga0163163_10226542 3300014325 Bacteria 1918
178 Ga0157380_10744794 3300014326 Bacteria 990
179 Ga0157377_10174524 3300014745 Bacteria 1347
180 Ga0157379_10036635 3300014968 Bacteria 4373
181 Ga0157379_10111410 3300014968 Bacteria 2458
182 Ga0157376_10233714 3300014969 Bacteria 1709
183 Ga0163161_10322452 3300017792 Bacteria 1222
184 Ga0206349_1371509 3300020075 Bacteria 947
185 Ga0206351_10286276 3300020077 Bacteria 1546
186 Ga0206350_10511148 3300020080 Bacteria 738
187 Ga0206354_10396415 3300020081 Bacteria 2237
188 Ga0206354_11490029 3300020081 Unclassified 937
189 Ga0206353_10188655 3300020082 Bacteria 1740
190 Ga0206353_11241250 3300020082 Bacteria 1531
191 Ga0213874_10045115 3300021377 Bacteria 1333
192 Ga0213874_10078672 3300021377 Bacteria 1064
193 Ga0213875_10000581 3300021388 Bacteria 29658
194 Ga0224712_10002280 3300022467 Bacteria 4697
195 Ga0224712_10039169 3300022467 Bacteria 1775
196 Ga0207713_1125194 3300025735 Bacteria 857
197 Ga0207692_10100447 3300025898 Bacteria 1587
198 Ga0207692_10199829 3300025898 Bacteria 1175
199 Ga0207642_10018985 3300025899 Bacteria 2651
200 Ga0207710_10031824 3300025900 Bacteria 2309
201 Ga0207688_10001763 3300025901 Bacteria 11500
202 Ga0207688_10024319 3300025901 Bacteria 3321
203 Ga0207688_10075786 3300025901 Bacteria 1915
204 Ga0207680_10683313 3300025903 Bacteria 735
205 Ga0207647_10212461 3300025904 Bacteria 1117
206 Ga0207685_10300657 3300025905 Bacteria 794
207 Ga0207699_10060659 3300025906 Bacteria 2272
208 Ga0207699_10112114 3300025906 Bacteria 1750
209 Ga0207699_10216361 3300025906 Bacteria 1305
210 Ga0207643_10059166 3300025908 Bacteria 2185
211 Ga0207705_10451460 3300025909 Bacteria 997
212 Ga0207684_10298564 3300025910 Unclassified 1389
213 Ga0207684_10366573 3300025910 Bacteria 1240
214 Ga0207654_10041444 3300025911 Bacteria 2600
215 Ga0207707_10003354 3300025912 Bacteria 14219
216 Ga0207695_10292742 3300025913 Bacteria 1520
217 Ga0207671_10632168 3300025914 Bacteria 853
218 Ga0207693_10002545 3300025915 Bacteria 15854
219 Ga0207693_10034182 3300025915 Bacteria 4010
220 Ga0207693_10091167 3300025915 Bacteria 2390
221 Ga0207693_10203373 3300025915 Bacteria 1557
222 Ga0207663_10009308 3300025916 Bacteria 5184
223 Ga0207663_10040938 3300025916 Bacteria 2820
224 Ga0207663_10111272 3300025916 Bacteria 1858
225 Ga0207663_10129896 3300025916 Bacteria 1739
226 Ga0207663_10199350 3300025916 Bacteria 1443
227 Ga0207663_10230691 3300025916 Bacteria 1352
228 Ga0207660_10011731 3300025917 Bacteria 5714
229 Ga0207660_10583500 3300025917 Bacteria 910
230 Ga0207662_10052586 3300025918 Bacteria 2424
231 Ga0207657_10301502 3300025919 Bacteria 1269
232 Ga0207657_10421680 3300025919 Bacteria 1049
233 Ga0207652_10087635 3300025921 Bacteria 2730
234 Ga0207681_10241254 3300025923 Bacteria 1407
235 Ga0207681_10426068 3300025923 Bacteria 1076
236 Ga0207687_10132454 3300025927 Bacteria 1881
237 Ga0207687_10158801 3300025927 Bacteria 1733
238 Ga0207700_10030548 3300025928 Bacteria 3817
239 Ga0207700_10065225 3300025928 Bacteria 2777
240 Ga0207700_10224437 3300025928 Bacteria 1594
241 Ga0207700_10288705 3300025928 Bacteria 1413
242 Ga0207700_10739946 3300025928 Unclassified 879
243 Ga0207664_10028327 3300025929 Bacteria 4256
244 Ga0207664_10076818 3300025929 Bacteria 2704
245 Ga0207664_10117783 3300025929 Bacteria 2218
246 Ga0207664_10325271 3300025929 Bacteria 1357
247 Ga0207664_10341843 3300025929 Bacteria 1323
248 Ga0207664_10553240 3300025929 Bacteria 1032
249 Ga0207644_10205540 3300025931 Bacteria 1555
250 Ga0207644_10576581 3300025931 Bacteria 933
251 Ga0207706_10074190 3300025933 Bacteria 2992
252 Ga0207686_10048358 3300025934 Bacteria 2634
253 Ga0207686_10162520 3300025934 Bacteria 1566
254 Ga0207686_10878974 3300025934 Bacteria 722
255 Ga0207670_10085359 3300025936 Bacteria 2218
256 Ga0207670_10293389 3300025936 Bacteria 1271
257 Ga0207670_10328408 3300025936 Bacteria 1205
258 Ga0207669_10074133 3300025937 Bacteria 2151
259 Ga0207704_10309183 3300025938 Bacteria 1214
260 Ga0207665_10001167 3300025939 Bacteria 17663
261 Ga0207665_10009662 3300025939 Bacteria 6337
262 Ga0207665_10259136 3300025939 Bacteria 1288
263 Ga0207689_10083275 3300025942 Bacteria 2630
264 Ga0207689_10107028 3300025942 Bacteria 2298
265 Ga0207679_10121409 3300025945 Bacteria 2081
266 Ga0207667_10769228 3300025949 Bacteria 961
267 Ga0207651_10375060 3300025960 Bacteria 1204
268 Ga0207712_10084125 3300025961 Bacteria 2324
269 Ga0207640_10077134 3300025981 Bacteria 2264
270 Ga0207658_10476275 3300025986 Bacteria 1109
271 Ga0207677_10556873 3300026023 Bacteria 1000
272 Ga0207703_10243974 3300026035 Bacteria 1616
273 Ga0207639_10779660 3300026041 Bacteria 890
274 Ga0207678_10006778 3300026067 Bacteria 10154
275 Ga0207678_10006823 3300026067 Bacteria 10124
276 Ga0207678_10051592 3300026067 Bacteria 3551
277 Ga0207708_10194245 3300026075 Bacteria 1617
278 Ga0207702_10148955 3300026078 Bacteria 2127
279 Ga0207702_10162221 3300026078 Bacteria 2042
280 Ga0207702_10167204 3300026078 Bacteria 2013
281 Ga0207702_10179183 3300026078 Bacteria 1950
282 Ga0207702_10258585 3300026078 Bacteria 1638
283 Ga0207702_10264261 3300026078 Bacteria 1621
284 Ga0207702_10395299 3300026078 Bacteria 1332
285 Ga0207648_10059809 3300026089 Bacteria 3323
286 Ga0207674_10010463 3300026116 Bacteria 10504
287 Ga0207674_10342990 3300026116 Bacteria 1444
288 Ga0207675_101112332 3300026118 Bacteria 810
289 Ga0207683_10022680 3300026121 Bacteria 5391
290 Ga0207698_10233205 3300026142 Bacteria 1672
291 Ga0207698_10648987 3300026142 Bacteria 1045
292 Ga0265356_1015315 3300028017 Bacteria 832
293 Ga0268265_10096918 3300028380 Bacteria 2372
294 Ga0268264_10074862 3300028381 Bacteria 2877
295 Ga0265338_10014071 3300028800 Bacteria 8957
296 Ga0265338_10233861 3300028800 Bacteria 1365
297 Ga0265327_10025965 3300031251 Bacteria 3402
298 Ga0307416_100946354 3300032002 Bacteria 963
299 Ga0307411_10303374 3300032005 Bacteria 1282
300 Ga0373930_0041406 3300034816 Bacteria 983
301 Ga0373932_0009779 3300035112 Bacteria 2313
302 Ga0373936_0018062 3300035113 Bacteria 2720
303 Ga0373939_0069789 3300035114 Bacteria 1141
304 Ga0373953_0024394 3300035117 Bacteria 2299
305 Ga0373953_0047229 3300035117 Bacteria 1731
306 Ga0373953_0096576 3300035117 Bacteria 1240
307 Ga0373954_0107017 3300035118 Bacteria 1351
308 Ga0373957_0051177 3300035120 Bacteria 1580
309 Ga0373960_0158732 3300035121 Bacteria 777
310 Ga0373943_0004155 3300035170 Bacteria 6570
311 Ga0373943_0170205 3300035170 Unclassified 1192
312 Ga0373955_0020192 3300035172 Bacteria 3345
313 Ga0373955_0444940 3300035172 Bacteria 789
314 Ga0373931_0071224 3300035691 Bacteria 1898
315 Ga0373935_0011714 3300035692 Bacteria 5267
316 Ga0373947_0214660 3300035725 Bacteria 1263
317 Ga0373937_0089656 3300036401 Bacteria 2847
318 Ga0373937_0667235 3300036401 Bacteria 985
319 Ga0373925_0000031 3300037068 Bacteria 145734
320 Ga0373925_0259363 3300037068 Unclassified 1396
321 Ga0395900_0930295 3300037418 Bacteria 792
322 Ga0436364_0658848 3300037853 Bacteria 108122
323 Ga0436364_0779593 3300037853 Bacteria 1589
324 Ga0395901_0362652 3300038443 Bacteria 1494
325 Ga0395901_0608402 3300038443 Bacteria 1101
326 Ga0395901_0611232 3300038443 Bacteria 1098
327 Ga0242420_006106 3300038996 Bacteria 1894
328 Ga0436365_0089185 3300039437 Bacteria 1487
329 Ga0436365_1211938 3300039437 Bacteria 1072
330 Ga0436365_1698198 3300039437 Bacteria 961
331 Ga0436360_0109872 3300039438 Bacteria 1005
332 Ga0436360_0434720 3300039438 Bacteria 1051
333 Ga0436360_0482887 3300039438 Bacteria 731
334 Ga0436361_0234220 3300039447 Bacteria 995
335 Ga0436363_0098848 3300039450 Bacteria 790
336 Ga0436363_0460823 3300039450 Bacteria 1091
337 Ga0436363_0649174 3300039450 Bacteria 1550
338 Ga0436363_0889628 3300039450 Bacteria 1983
339 Ga0436363_1234031 3300039450 Unclassified 983
340 Ga0436363_1521038 3300039450 Bacteria 1003
341 Ga0436363_1589465 3300039450 Bacteria 1200
342 Ga0466963_0104028 3300044694 Bacteria 1945
343 Ga0466960_0145689 3300044901 Bacteria 1261
344 Ga0466960_0337670 3300044901 Bacteria 857
345 Ga0466967_0016920 3300045976 Bacteria 5767
346 Ga0466967_0143004 3300045976 Bacteria 2229
347 Ga0466967_0220797 3300045976 Bacteria 1801
348 Ga0466967_0236691 3300045976 Bacteria 1740
349 Ga0495617_028467 3300046452 Bacteria 1877
350 Ga0495603_0094826 3300046455 Unclassified 1743
351 Ga0495603_0105249 3300046455 Bacteria 1646
352 Ga0495603_0197082 3300046455 Bacteria 1164
353 Ga0495629_0033655 3300046459 Bacteria 3625
354 Ga0495629_0049359 3300046459 Bacteria 2949
355 Ga0495641_0031185 3300046461 Bacteria 2549
356 Ga0495651_0029076 3300046462 Bacteria 4310
357 Ga0495651_0295688 3300046462 Bacteria 1088
358 Ga0495651_0433234 3300046462 Bacteria 852
359 Ga0495653_0017221 3300046463 Bacteria 5876
360 Ga0495653_0157358 3300046463 Bacteria 1581
361 Ga0495653_0232340 3300046463 Unclassified 1233
362 Ga0495582_0263336 3300046473 Bacteria 989
363 Ga0495605_0003627 3300046474 Bacteria 9160
364 Ga0495639_0000246 3300046475 Bacteria 26891
365 Ga0495662_0000456 3300046476 Bacteria 18422
366 Ga0495664_0123858 3300046477 Bacteria 1563
367 Ga0495664_0193253 3300046477 Unclassified 1233
368 Ga0495594_0048299 3300046499 Bacteria 2338
369 Ga0495594_0096803 3300046499 Bacteria 1658
370 Ga0495607_0128863 3300046501 Bacteria 1319
371 Ga0495583_0012221 3300046506 Bacteria 4874
372 Ga0495606_0013188 3300046507 Bacteria 6556
373 Ga0495608_0130384 3300046511 Bacteria 1609
374 Ga0495608_0153610 3300046511 Bacteria 1466
375 Ga0495616_0008268 3300046513 Bacteria 6176
376 Ga0495620_0012500 3300046515 Bacteria 4380
377 Ga0495628_0028810 3300046516 Bacteria 4509
378 Ga0495628_0271118 3300046516 Bacteria 1262
379 Ga0495628_0385107 3300046516 Bacteria 1026
380 Ga0495628_0431290 3300046516 Bacteria 959
381 Ga0495630_0090208 3300046517 Unclassified 2315
382 Ga0495630_0281677 3300046517 Bacteria 1270
383 Ga0495631_0004466 3300046518 Bacteria 7448
384 Ga0495666_0005173 3300046526 Bacteria 6587
385 Ga0495666_0074711 3300046526 Bacteria 1607
386 Ga0495652_0085929 3300046529 Bacteria 2584
387 Ga0495665_0096579 3300046531 Bacteria 1552
388 Ga0495640_0060769 3300046533 Bacteria 2569
389 Ga0495640_0104397 3300046533 Bacteria 1857
390 Ga0495587_0043656 3300046536 Bacteria 2669
391 Ga0495609_0183151 3300046538 Unclassified 881
392 Ga0495645_0084332 3300046543 Bacteria 2275
393 Ga0495622_0022928 3300046557 Bacteria 2909
394 Ga0495667_0198193 3300046559 Bacteria 1285
395 Ga0495668_0003417 3300046616 Bacteria 11922
396 Ga0495625_0012658 3300046660 Bacteria 6828
397 Ga0495635_0010294 3300046663 Bacteria 6540
398 Ga0495657_0123900 3300046675 Bacteria 1625
399 Ga0495657_0273331 3300046675 Bacteria 1013
400 Ga0495599_0082653 3300046678 Bacteria 2006
401 Ga0495623_0410342 3300046679 Bacteria 727
402 Ga0495646_0007464 3300046680 Bacteria 6949
403 Ga0495646_0090111 3300046680 Bacteria 1773
404 Ga0495658_0000809 3300046683 Bacteria 16781
405 Ga0495613_0027207 3300046689 Bacteria 4255
406 Ga0495624_0047778 3300046690 Bacteria 2718
407 Ga0495649_0276542 3300046694 Bacteria 858
408 Ga0495589_0042932 3300046794 Bacteria 2252
409 Ga0495600_0212472 3300046809 Bacteria 1239
410 Ga0495660_0054732 3300046810 Bacteria 2161
411 Ga0495674_0035425 3300047319 Bacteria 4503
412 Ga0495674_0098000 3300047319 Bacteria 2497
413 Ga0495674_0122656 3300047319 Bacteria 2194
414 Ga0495674_0160925 3300047319 Bacteria 1878
415 Ga0495676_0009527 3300047321 Bacteria 8842
416 Ga0495680_0036021 3300047322 Bacteria 3978
417 Ga0495680_0099155 3300047322 Bacteria 2172
418 Ga0495680_0168801 3300047322 Bacteria 1585
419 Ga0495680_0263936 3300047322 Bacteria 1217
420 Ga0495687_018518 3300047443 Bacteria 3441
421 Ga0495675_0000634 3300047444 Bacteria 22338
422 Ga0495685_008757 3300047447 Bacteria 3369
423 Ga0495684_0037230 3300047471 Bacteria 3731
424 Ga0495686_0182293 3300047472 Bacteria 1216
425 Ga0495602_0310257 3300048088 Bacteria 1151
426 Ga0496100_0246914 3300048903 Bacteria 1319
427 Ga0496100_0276940 3300048903 Bacteria 1249
428 Ga0496100_0669662 3300048903 Bacteria 809
429 Ga0496101_0025508 3300048904 Bacteria 4103
430 Ga0496101_0163289 3300048904 Bacteria 1709
431 Ga0496101_0173169 3300048904 Bacteria 1659
432 Ga0496101_0296267 3300048904 Bacteria 1266
433 Ga0496101_0578353 3300048904 Bacteria 888
434 Ga0496102_0209801 3300048905 Bacteria 1836
435 Ga0496102_0347484 3300048905 Bacteria 1397
436 Ga0496102_0666637 3300048905 Bacteria 963
437 Ga0496102_0863714 3300048905 Bacteria 827
438 Ga0496103_0551632 3300048906 Bacteria 736
439 Ga0496104_0004391 3300048907 Bacteria 12278
440 Ga0496104_0081192 3300048907 Bacteria 3092
441 Ga0496104_0084769 3300048907 Bacteria 3024
442 Ga0496104_0232307 3300048907 Bacteria 1756
443 Ga0496104_0672646 3300048907 Bacteria 944
444 Ga0496105_0022972 3300048908 Bacteria 5056
445 Ga0496105_0122838 3300048908 Bacteria 2141
446 Ga0496105_0168325 3300048908 Bacteria 1797
447 Ga0496105_0425197 3300048908 Bacteria 1051
448 Ga0496106_0012868 3300048909 Bacteria 6175
449 Ga0496106_0117038 3300048909 Bacteria 2079
450 Ga0496107_0119326 3300048910 Bacteria 1942
451 Ga0496107_0243487 3300048910 Bacteria 1338
452 Ga0496107_0365997 3300048910 Bacteria 1072
453 Ga0496108_0002876 3300048911 Bacteria 13811
454 Ga0496108_0014437 3300048911 Bacteria 6449
455 Ga0496108_0131097 3300048911 Bacteria 2155
456 Ga0496108_0146597 3300048911 Bacteria 2035
457 Ga0496108_0201001 3300048911 Bacteria 1729
458 Ga0496108_0386571 3300048911 Bacteria 1222
459 Ga0496108_0574604 3300048911 Bacteria 983
460 Ga0496109_0003875 3300048912 Bacteria 12495
461 Ga0496109_0004062 3300048912 Bacteria 12233
462 Ga0496109_0018958 3300048912 Bacteria 6058
463 Ga0496109_0044755 3300048912 Bacteria 4016
464 Ga0496109_0054093 3300048912 Bacteria 3663
465 Ga0496109_0074104 3300048912 Bacteria 3129
466 Ga0496109_0154249 3300048912 Bacteria 2151
467 Ga0496109_0743946 3300048912 Bacteria 918
468 Ga0496109_0876382 3300048912 Bacteria 835
469 Ga0496110_0004412 3300048913 Bacteria 10895
470 Ga0496110_0035557 3300048913 Bacteria 4322
471 Ga0496110_0041373 3300048913 Bacteria 4021
472 Ga0496110_0049985 3300048913 Bacteria 3670
473 Ga0496110_0222923 3300048913 Bacteria 1715
474 Ga0496110_0325308 3300048913 Bacteria 1400
475 Ga0496110_0345647 3300048913 Bacteria 1355
476 Ga0496110_0520047 3300048913 Bacteria 1082
477 Ga0496110_0548276 3300048913 Bacteria 1051
478 Ga0496111_0013754 3300048914 Bacteria 5513
479 Ga0496111_0030043 3300048914 Bacteria 3863
480 Ga0496111_0038840 3300048914 Bacteria 3411
481 Ga0496111_0370558 3300048914 Bacteria 1059
482 Ga0496112_0065727 3300048915 Bacteria 3579
483 Ga0496112_0088159 3300048915 Bacteria 3071
484 Ga0496112_0106425 3300048915 Bacteria 2775
485 Ga0496112_0240633 3300048915 Bacteria 1762
486 Ga0496113_0008813 3300048916 Bacteria 6589
487 Ga0496113_0010741 3300048916 Bacteria 6069
488 Ga0496113_0039854 3300048916 Bacteria 3459
489 Ga0496113_0291981 3300048916 Bacteria 1304
490 Ga0496113_0483398 3300048916 Bacteria 995
491 Ga0496113_0669171 3300048916 Bacteria 830
492 Ga0496114_0134318 3300048917 Bacteria 2139
493 Ga0496114_0249681 3300048917 Bacteria 1561
494 Ga0496114_0420405 3300048917 Bacteria 1184
495 Ga0496115_0000188 3300048918 Bacteria 57530
496 Ga0496115_0000207 3300048918 Bacteria 54341
497 Ga0496115_0008881 3300048918 Bacteria 7449
498 Ga0496115_0010633 3300048918 Bacteria 6883
499 Ga0496115_0273971 3300048918 Bacteria 1386
500 Ga0496121_0273456 3300048924 Bacteria 1160
501 Ga0496124_0476452 3300048927 Bacteria 844
502 Ga0496126_0013523 3300048929 Bacteria 8294
503 Ga0496126_0022751 3300048929 Bacteria 6088
504 Ga0501069_0364691 3300049585 Bacteria 852
505 nmdc:mga05p37_730915_c1 3300050507 Bacteria 1094
506 nmdc:mga08y16_451862_c1 3300050511 Bacteria 1310
507 nmdc:mga0n895_580601_c1 3300050512 Bacteria 1125
508 nmdc:mga0rr50_439594_c1 3300050513 Bacteria 1105
509 nmdc:mga08x19_462851_c1 3300050514 Bacteria 893
510 Ga0495601_0230430 3300053077 Bacteria 1210
511 Ga0495595_0028919 3300053084 Bacteria 2477
512 Ga0495595_0296538 3300053084 Bacteria 813
513 Ga0495619_0059194 3300053085 Bacteria 2545
514 Ga0495619_0238792 3300053085 Bacteria 1259
515 Ga0500616_0010692 3300053153 Bacteria 5475
516 Ga0587083_0086455 3300059505 Bacteria 757
517 Ga0495645_0305522
518 JGI24743J22301_10043659
519 Ga0070658_10184480
520 Ga0070683_100068190
521 Ga0070683_100177218
522 Ga0070690_100107055
523 Ga0070690_100391212
524 Ga0068869_100052024
525 Ga0070680_100008147
526 Ga0070680_100292959
527 Ga0070682_100030232
528 Ga0068868_100166387
529 Ga0068868_100563374
530 Ga0068868_101022953
531 Ga0070660_100147145
532 Ga0070660_100184783
533 Ga0070689_100285315
534 Ga0070689_100422125
535 Ga0070687_100008908
536 Ga0070687_100039359
537 Ga0070687_100155795
538 Ga0070661_100014263
539 Ga0070668_100539568
540 Ga0070669_100768593
541 Ga0070671_100286127
542 Ga0070674_100152368
543 Ga0070673_100459547
544 Ga0070673_100870175
545 Ga0070688_100827390
546 Ga0070659_100086344
547 Ga0070709_10085903
548 Ga0070709_10124257
549 Ga0070709_10125003
550 Ga0070714_100008631
551 Ga0070714_100041603
552 Ga0070714_100150997
553 Ga0070714_100404864
554 Ga0070713_100022543
555 Ga0070713_100041523
556 Ga0070713_100079828
557 Ga0070713_100228864
558 Ga0070713_100315857
559 Ga0070713_100460114
560 Ga0070713_100536991
561 Ga0070713_100879952
562 Ga0070710_10001852
563 Ga0070710_10003005
564 Ga0070710_10269323
565 Ga0070710_10799246
566 Ga0070711_100010929
567 Ga0070711_100046060
568 Ga0070711_100190325
569 Ga0070711_100684347
570 Ga0070705_100021162
571 Ga0070705_100089980
572 Ga0070694_100657888
573 Ga0070708_101228598
574 Ga0070663_100027319
575 Ga0070663_100120335
576 Ga0070663_101129022
577 Ga0070678_100026364
578 Ga0070662_100008052
579 Ga0070662_100780119
580 Ga0070681_10017524
581 Ga0068867_100044086
582 Ga0068867_100417471
583 Ga0070685_10282605
584 Ga0070685_10805868
585 Ga0070706_100684292
586 Ga0070706_101230331
587 Ga0070707_100400451
588 Ga0070698_100027404
589 Ga0070679_100023785
590 Ga0070679_100100435
591 Ga0070679_100225629
592 Ga0070684_100167683
593 Ga0070684_100431122
594 Ga0070684_100649729
595 Ga0068853_100389720
596 Ga0070696_100407854
597 Ga0070693_100098370
598 Ga0070693_100648457
599 Ga0070665_100213829
600 Ga0070665_101226172
601 Ga0070704_100217500
602 Ga0070664_100055919
603 Ga0070664_100069130
604 Ga0068857_100091403
605 Ga0068857_100843214
606 Ga0068854_100024776
607 Ga0068854_100116107
608 Ga0068856_100036893
609 Ga0068856_100061948
610 Ga0068856_100099286
611 Ga0068856_100210045
612 Ga0068856_100538753
613 Ga0070702_100026814
614 Ga0070702_100032219
615 Ga0070702_100142867
616 Ga0070702_100261490
617 Ga0068852_100136709
618 Ga0068859_100055663
619 Ga0068859_100647306
620 Ga0068864_100320168
621 Ga0068864_100832441
622 Ga0068866_10205218
623 Ga0068861_100004717
624 Ga0068870_10031738
625 Ga0068863_100840088
626 Ga0068860_100170349
627 Ga0068860_100174806
628 Ga0068862_100096171
629 Ga0068862_100123426
630 Ga0068862_100232885
631 Ga0081540_1000155
632 Ga0070717_10006152
633 Ga0070717_10018509
634 Ga0070717_10057462
635 Ga0070717_10256431
636 Ga0070717_10286230
637 Ga0070717_10354448
638 Ga0070717_10396704
639 Ga0070717_10474302
640 Ga0070715_10088627
641 Ga0070715_10275817
642 Ga0070716_100060065
643 Ga0070716_100289320
644 Ga0070712_100018324
645 Ga0070712_100046123
646 Ga0097621_100011694
647 Ga0097621_100095618
648 Ga0068871_100034118
649 Ga0075434_100140985
650 Ga0068865_100016279
651 Ga0068865_100105924
652 Ga0068865_100244109
653 Ga0075436_100245861
654 Ga0075436_100551733
655 Ga0097620_100055663
656 Ga0097620_100647348
657 Ga0075435_100212985
658 Ga0075435_100287394
659 Ga0075435_100915758
660 Ga0105251_10109446
661 Ga0105244_10316240
662 Ga0111539_10813394
663 Ga0105245_10019275
664 Ga0105245_10416401
665 Ga0105247_10010794
666 Ga0105247_10060623
667 Ga0105247_10357736
668 Ga0105243_10003338
669 Ga0105243_10006526
670 Ga0105241_10133548
671 Ga0105242_10024226
672 Ga0105242_11416227
673 Ga0105248_10239798
674 Ga0105248_10554443
675 Ga0105237_10198262
676 Ga0105237_10479737
677 Ga0105237_10512588
678 Ga0105249_10008068
679 Ga0105249_10102885
680 Ga0105239_10257243
681 Ga0105246_10060409
682 Ga0105246_10527794
683 Ga0105246_10560788
684 Ga0157371_10074024
685 Ga0157370_10133643
686 Ga0157369_10034883
687 Ga0157374_10020987
688 Ga0163162_10026062
689 Ga0157375_10384223
690 Ga0157375_11307911
691 Ga0163163_10026205
692 Ga0163163_10082414
693 Ga0163163_10226542
694 Ga0157380_10744794
695 Ga0157377_10174524
696 Ga0157379_10036635
697 Ga0157379_10111410
698 Ga0157376_10233714
699 Ga0163161_10322452
700 Ga0206349_1371509
701 Ga0206351_10286276
702 Ga0206350_10511148
703 Ga0206354_10396415
704 Ga0206354_11490029
705 Ga0206353_10188655
706 Ga0206353_11241250
707 Ga0213874_10045115
708 Ga0213874_10078672
709 Ga0213875_10000581
710 Ga0224712_10002280
711 Ga0224712_10039169
712 Ga0207713_1125194
713 Ga0207692_10100447
714 Ga0207692_10199829
715 Ga0207642_10018985
716 Ga0207710_10031824
717 Ga0207688_10001763
718 Ga0207688_10024319
719 Ga0207688_10075786
720 Ga0207680_10683313
721 Ga0207647_10212461
722 Ga0207685_10300657
723 Ga0207699_10060659
724 Ga0207699_10112114
725 Ga0207699_10216361
726 Ga0207643_10059166
727 Ga0207705_10451460
728 Ga0207684_10298564
729 Ga0207684_10366573
730 Ga0207654_10041444
731 Ga0207707_10003354
732 Ga0207695_10292742
733 Ga0207671_10632168
734 Ga0207693_10002545
735 Ga0207693_10034182
736 Ga0207693_10091167
737 Ga0207693_10203373
738 Ga0207663_10009308
739 Ga0207663_10040938
740 Ga0207663_10111272
741 Ga0207663_10129896
742 Ga0207663_10199350
743 Ga0207663_10230691
744 Ga0207660_10011731
745 Ga0207660_10583500
746 Ga0207662_10052586
747 Ga0207657_10301502
748 Ga0207657_10421680
749 Ga0207652_10087635
750 Ga0207681_10241254
751 Ga0207681_10426068
752 Ga0207687_10132454
753 Ga0207687_10158801
754 Ga0207700_10030548
755 Ga0207700_10065225
756 Ga0207700_10224437
757 Ga0207700_10288705
758 Ga0207700_10739946
759 Ga0207664_10028327
760 Ga0207664_10076818
761 Ga0207664_10117783
762 Ga0207664_10325271
763 Ga0207664_10341843
764 Ga0207664_10553240
765 Ga0207644_10205540
766 Ga0207644_10576581
767 Ga0207706_10074190
768 Ga0207686_10048358
769 Ga0207686_10162520
770 Ga0207686_10878974
771 Ga0207670_10085359
772 Ga0207670_10293389
773 Ga0207670_10328408
774 Ga0207669_10074133
775 Ga0207704_10309183
776 Ga0207665_10001167
777 Ga0207665_10009662
778 Ga0207665_10259136
779 Ga0207689_10083275
780 Ga0207689_10107028
781 Ga0207679_10121409
782 Ga0207667_10769228
783 Ga0207651_10375060
784 Ga0207712_10084125
785 Ga0207640_10077134
786 Ga0207658_10476275
787 Ga0207677_10556873
788 Ga0207703_10243974
789 Ga0207639_10779660
790 Ga0207678_10006778
791 Ga0207678_10006823
792 Ga0207678_10051592
793 Ga0207708_10194245
794 Ga0207702_10148955
795 Ga0207702_10162221
796 Ga0207702_10167204
797 Ga0207702_10179183
798 Ga0207702_10258585
799 Ga0207702_10264261
800 Ga0207702_10395299
801 Ga0207648_10059809
802 Ga0207674_10010463
803 Ga0207674_10342990
804 Ga0207675_101112332
805 Ga0207683_10022680
806 Ga0207698_10233205
807 Ga0207698_10648987
808 Ga0265356_1015315
809 Ga0268265_10096918
810 Ga0268264_10074862
811 Ga0265338_10014071
812 Ga0265338_10233861
813 Ga0265327_10025965
814 Ga0307416_100946354
815 Ga0307411_10303374
816 Ga0373930_0041406
817 Ga0373932_0009779
818 Ga0373936_0018062
819 Ga0373939_0069789
820 Ga0373953_0024394
821 Ga0373953_0047229
822 Ga0373953_0096576
823 Ga0373954_0107017
824 Ga0373957_0051177
825 Ga0373960_0158732
826 Ga0373943_0004155
827 Ga0373943_0170205
828 Ga0373955_0020192
829 Ga0373955_0444940
830 Ga0373931_0071224
831 Ga0373935_0011714
832 Ga0373947_0214660
833 Ga0373937_0089656
834 Ga0373937_0667235
835 Ga0373925_0000031
836 Ga0373925_0259363
837 Ga0395900_0930295
838 Ga0436364_0658848
839 Ga0436364_0779593
840 Ga0395901_0362652
841 Ga0395901_0608402
842 Ga0395901_0611232
843 Ga0242420_006106
844 Ga0436365_0089185
845 Ga0436365_1211938
846 Ga0436365_1698198
847 Ga0436360_0109872
848 Ga0436360_0434720
849 Ga0436360_0482887
850 Ga0436361_0234220
851 Ga0436363_0098848
852 Ga0436363_0460823
853 Ga0436363_0649174
854 Ga0436363_0889628
855 Ga0436363_1234031
856 Ga0436363_1521038
857 Ga0436363_1589465
858 Ga0466963_0104028
859 Ga0466960_0145689
860 Ga0466960_0337670
861 Ga0466967_0016920
862 Ga0466967_0143004
863 Ga0466967_0220797
864 Ga0466967_0236691
865 Ga0495617_028467
866 Ga0495603_0094826
867 Ga0495603_0105249
868 Ga0495603_0197082
869 Ga0495629_0033655
870 Ga0495629_0049359
871 Ga0495641_0031185
872 Ga0495651_0029076
873 Ga0495651_0295688
874 Ga0495651_0433234
875 Ga0495653_0017221
876 Ga0495653_0157358
877 Ga0495653_0232340
878 Ga0495582_0263336
879 Ga0495605_0003627
880 Ga0495639_0000246
881 Ga0495662_0000456
882 Ga0495664_0123858
883 Ga0495664_0193253
884 Ga0495594_0048299
885 Ga0495594_0096803
886 Ga0495607_0128863
887 Ga0495583_0012221
888 Ga0495606_0013188
889 Ga0495608_0130384
890 Ga0495608_0153610
891 Ga0495616_0008268
892 Ga0495620_0012500
893 Ga0495628_0028810
894 Ga0495628_0271118
895 Ga0495628_0385107
896 Ga0495628_0431290
897 Ga0495630_0090208
898 Ga0495630_0281677
899 Ga0495631_0004466
900 Ga0495666_0005173
901 Ga0495666_0074711
902 Ga0495652_0085929
903 Ga0495665_0096579
904 Ga0495640_0060769
905 Ga0495640_0104397
906 Ga0495587_0043656
907 Ga0495609_0183151
908 Ga0495645_0084332
909 Ga0495622_0022928
910 Ga0495667_0198193
911 Ga0495668_0003417
912 Ga0495625_0012658
913 Ga0495635_0010294
914 Ga0495657_0123900
915 Ga0495657_0273331
916 Ga0495599_0082653
917 Ga0495623_0410342
918 Ga0495646_0007464
919 Ga0495646_0090111
920 Ga0495658_0000809
921 Ga0495613_0027207
922 Ga0495624_0047778
923 Ga0495649_0276542
924 Ga0495589_0042932
925 Ga0495600_0212472
926 Ga0495660_0054732
927 Ga0495674_0035425
928 Ga0495674_0098000
929 Ga0495674_0122656
930 Ga0495674_0160925
931 Ga0495676_0009527
932 Ga0495680_0036021
933 Ga0495680_0099155
934 Ga0495680_0168801
935 Ga0495680_0263936
936 Ga0495687_018518
937 Ga0495675_0000634
938 Ga0495685_008757
939 Ga0495684_0037230
940 Ga0495686_0182293
941 Ga0495602_0310257
942 Ga0496100_0246914
943 Ga0496100_0276940
944 Ga0496100_0669662
945 Ga0496101_0025508
946 Ga0496101_0163289
947 Ga0496101_0173169
948 Ga0496101_0296267
949 Ga0496101_0578353
950 Ga0496102_0209801
951 Ga0496102_0347484
952 Ga0496102_0666637
953 Ga0496102_0863714
954 Ga0496103_0551632
955 Ga0496104_0004391
956 Ga0496104_0081192
957 Ga0496104_0084769
958 Ga0496104_0232307
959 Ga0496104_0672646
960 Ga0496105_0022972
961 Ga0496105_0122838
962 Ga0496105_0168325
963 Ga0496105_0425197
964 Ga0496106_0012868
965 Ga0496106_0117038
966 Ga0496107_0119326
967 Ga0496107_0243487
968 Ga0496107_0365997
969 Ga0496108_0002876
970 Ga0496108_0014437
971 Ga0496108_0131097
972 Ga0496108_0146597
973 Ga0496108_0201001
974 Ga0496108_0386571
975 Ga0496108_0574604
976 Ga0496109_0003875
977 Ga0496109_0004062
978 Ga0496109_0018958
979 Ga0496109_0044755
980 Ga0496109_0054093
981 Ga0496109_0074104
982 Ga0496109_0154249
983 Ga0496109_0743946
984 Ga0496109_0876382
985 Ga0496110_0004412
986 Ga0496110_0035557
987 Ga0496110_0041373
988 Ga0496110_0049985
989 Ga0496110_0222923
990 Ga0496110_0325308
991 Ga0496110_0345647
992 Ga0496110_0520047
993 Ga0496110_0548276
994 Ga0496111_0013754
995 Ga0496111_0030043
996 Ga0496111_0038840
997 Ga0496111_0370558
998 Ga0496112_0065727
999 Ga0496112_0088159
1000 Ga0496112_0106425
1001 Ga0496112_0240633
1002 Ga0496113_0008813
1003 Ga0496113_0010741
1004 Ga0496113_0039854
1005 Ga0496113_0291981
1006 Ga0496113_0483398
1007 Ga0496113_0669171
1008 Ga0496114_0134318
1009 Ga0496114_0249681
1010 Ga0496114_0420405
1011 Ga0496115_0000188
1012 Ga0496115_0000207
1013 Ga0496115_0008881
1014 Ga0496115_0010633
1015 Ga0496115_0273971
1016 Ga0496121_0273456
1017 Ga0496124_0476452
1018 Ga0496126_0013523
1019 Ga0496126_0022751
1020 Ga0501069_0364691
1021 nmdc:mga05p37_730915_c1
1022 nmdc:mga08y16_451862_c1
1023 nmdc:mga0n895_580601_c1
1024 nmdc:mga0rr50_439594_c1
1025 nmdc:mga08x19_462851_c1
1026 Ga0495601_0230430
1027 Ga0495595_0028919
1028 Ga0495595_0296538
1029 Ga0495619_0059194
1030 Ga0495619_0238792
1031 Ga0500616_0010692
1032 Ga0587083_0086455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

32

159

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9035 5 157
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9016 5 159
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8904 5 159
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.8797 5 160
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8764 9 156
ID Description Score Start End Superfamily
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9016 5 159 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8904 5 159 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8806 8 156 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8772 7 139 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8738 5 160 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538NGE8-F1-model_v4 Redoxin domain-containing protein 0.994 1 133 GO:0016209
GO:0016491
AF-A0A538NGE8-F1-model_v4 Redoxin domain-containing protein 0.9793 1 133 GO:0016209
GO:0016491
AF-A0A2N9LK95-F1-model_v4 Antioxidant, AhpC/TSA family (EC 1.11.1.15) 0.9518 1 184 GO:0004601
AF-A0A535FQQ0-F1-model_v4 Redoxin domain-containing protein 0.9366 22 187 GO:0016209
GO:0016491
AF-A0A0K8Q3V0-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.9307 35 184

Map