F457865

General Info

Members Datasets Scaffolds Average Seq Length
515 263 503 410

Family's Representative Sequence

Representative Sequence 3300025321|Ga0207656_10021309|Ga0207656_100213092
Length 489
Sequence VGVRFGARLEVWLRTSRRVGSTEPGSDARPRGMAVTGEASQGDSPAQNPAYRLASLFLARPGAGLPITPKRTMNPDASTLWRAPNWALAVLLACLGMLGPFSIDAYLPAFTGIARAIGATPVEMQQTLSAYLFGFAIMNLFHGALADSFGRRPVVLSGLVVFTLASIGCALSQHIGALVFFRAVQGMSAGAGIVVSRAVIRDMFPPADAQRVMSQVTIYFGVAPAVAPMIGGFLFVHAGWHAVFWMLTVLGVILFVANWKLLPETLHETHKQPFNSRNLLRGYWSLASNPRFLMLALASGIPFNGMFLYVLSAPVFLADTLGLEPGQFFWFFALTIAGIMAGAYLSGRMAGRVKATHQIRYGFVIMAGVGAINLLLNLLFVPQAWWALVPIALYAFGWAMMVPVVTLMVLDLVPERRGMASSLQAFVGSSANGLVAGAVAPLVMHSALALAATSLAMLSIGVTSWLWVKPHLRGAAPAAAESVPGAARR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
187 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
227 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
228 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
235 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
236 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
237 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
240 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
241 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
261 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.19
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.84
Nodule 0.58
Rhizoplane 2.91
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001729 3300003215 Bacteria 12958
2 JGI25153J46596_10030419 3300003215 Bacteria 1837
3 rootH1_10026619 3300003316 Bacteria 5191
4 rootL2_10004746 3300003322 Bacteria 12200
5 Ga0055526_1003022 3300003771 Bacteria 10967
6 Ga0055524_1000052 3300003775 Bacteria 144959
7 Ga0055530_10006054 3300003791 Bacteria 5527
8 Ga0055540_1000123 3300003792 Bacteria 80351
9 Ga0055531_10000001 3300003794 Bacteria 543586
10 Ga0055531_10004658 3300003794 Bacteria 8232
11 Ga0065715_10133874 3300005293 Bacteria 1965
12 Ga0070658_10021320 3300005327 Bacteria 5192
13 Ga0070658_10157109 3300005327 Bacteria 1907
14 Ga0070676_10017077 3300005328 Bacteria 4012
15 Ga0070676_10070358 3300005328 Bacteria 2099
16 Ga0070683_100011245 3300005329 Bacteria 7723
17 Ga0070690_100048445 3300005330 Bacteria 2706
18 Ga0070690_100104880 3300005330 Bacteria 1878
19 Ga0070670_100009121 3300005331 Bacteria 8478
20 Ga0070670_100063425 3300005331 Bacteria 3171
21 Ga0070670_100121549 3300005331 Bacteria 2253
22 Ga0070677_10004059 3300005333 Bacteria 4753
23 Ga0070677_10065220 3300005333 Bacteria 1515
24 Ga0068869_100012643 3300005334 Bacteria 5584
25 Ga0068869_100024391 3300005334 Bacteria 4190
26 Ga0068869_100046654 3300005334 Bacteria 3124
27 Ga0070666_10029211 3300005335 Bacteria 3623
28 Ga0070666_10092092 3300005335 Bacteria 2083
29 Ga0070666_10094428 3300005335 Bacteria 2058
30 Ga0070680_100029336 3300005336 Bacteria 4419
31 Ga0068868_100002358 3300005338 Bacteria 13077
32 Ga0068868_100018166 3300005338 Bacteria 5252
33 Ga0068868_100019699 3300005338 Bacteria 5059
34 Ga0070660_100036699 3300005339 Bacteria 3713
35 Ga0070661_100010658 3300005344 Bacteria 6394
36 Ga0070661_100013952 3300005344 Bacteria 5648
37 Ga0070668_100015507 3300005347 Bacteria 5697
38 Ga0070668_100053786 3300005347 Bacteria 3104
39 Ga0070669_100002367 3300005353 Bacteria 13623
40 Ga0070669_100134216 3300005353 Bacteria 1902
41 Ga0070675_100003251 3300005354 Bacteria 12310
42 Ga0070675_100003640 3300005354 Bacteria 11721
43 Ga0070675_100006390 3300005354 Bacteria 9044
44 Ga0070675_100014473 3300005354 Bacteria 6222
45 Ga0070675_100039895 3300005354 Bacteria 3832
46 Ga0070675_100047639 3300005354 Bacteria 3512
47 Ga0070675_100111967 3300005354 Bacteria 2310
48 Ga0070671_100052558 3300005355 Bacteria 3387
49 Ga0070671_100071072 3300005355 Bacteria 2904
50 Ga0070671_100075979 3300005355 Bacteria 2806
51 Ga0070674_100005544 3300005356 Bacteria 7299
52 Ga0070674_100017406 3300005356 Bacteria 4521
53 Ga0070673_100003414 3300005364 Bacteria 9890
54 Ga0070673_100011156 3300005364 Bacteria 6126
55 Ga0070673_100031844 3300005364 Bacteria 3962
56 Ga0070673_100075664 3300005364 Bacteria 2716
57 Ga0070673_100195480 3300005364 Bacteria 1739
58 Ga0070659_100004770 3300005366 Bacteria 9691
59 Ga0070659_100030937 3300005366 Bacteria 4143
60 Ga0070667_100006347 3300005367 Bacteria 9828
61 Ga0070667_100007643 3300005367 Bacteria 8965
62 Ga0070667_100039414 3300005367 Bacteria 3960
63 Ga0070667_100048274 3300005367 Bacteria 3583
64 Ga0070708_100319001 3300005445 Bacteria 1464
65 Ga0070663_100103431 3300005455 Bacteria 2129
66 Ga0070678_100040759 3300005456 Bacteria 3288
67 Ga0070678_100085730 3300005456 Bacteria 2401
68 Ga0070678_100096638 3300005456 Bacteria 2279
69 Ga0070678_100128097 3300005456 Bacteria 2012
70 Ga0070678_100231282 3300005456 Bacteria 1541
71 Ga0070662_100006488 3300005457 Bacteria 7545
72 Ga0070662_100006522 3300005457 Bacteria 7527
73 Ga0070662_100028020 3300005457 Bacteria 3917
74 Ga0070662_100038414 3300005457 Bacteria 3400
75 Ga0070662_100224104 3300005457 Bacteria 1501
76 Ga0068867_100008316 3300005459 Bacteria 7325
77 Ga0068867_100012355 3300005459 Bacteria 6040
78 Ga0068867_100037704 3300005459 Bacteria 3514
79 Ga0068867_100065368 3300005459 Bacteria 2707
80 Ga0070684_100170516 3300005535 Bacteria 1976
81 Ga0068853_100019899 3300005539 Bacteria 5575
82 Ga0070672_100008925 3300005543 Bacteria 6889
83 Ga0070672_100009684 3300005543 Bacteria 6652
84 Ga0070672_100014575 3300005543 Bacteria 5574
85 Ga0070672_100014963 3300005543 Bacteria 5511
86 Ga0070672_100026270 3300005543 Bacteria 4330
87 Ga0070672_100030631 3300005543 Bacteria 4044
88 Ga0070672_100096315 3300005543 Bacteria 2394
89 Ga0070672_100149709 3300005543 Bacteria 1930
90 Ga0070672_100155264 3300005543 Bacteria 1895
91 Ga0070665_100014521 3300005548 Bacteria 7900
92 Ga0068855_100154931 3300005563 Bacteria 2603
93 Ga0070664_100015765 3300005564 Bacteria 6185
94 Ga0070664_100021202 3300005564 Bacteria 5353
95 Ga0070664_100093314 3300005564 Bacteria 2608
96 Ga0070664_100131960 3300005564 Bacteria 2195
97 Ga0068857_100062699 3300005577 Bacteria 3305
98 Ga0068857_100068862 3300005577 Bacteria 3150
99 Ga0068854_100020370 3300005578 Bacteria 4486
100 Ga0068854_100034170 3300005578 Bacteria 3550
101 Ga0068854_100063580 3300005578 Bacteria 2679
102 Ga0068854_100152823 3300005578 Bacteria 1781
103 Ga0068856_100012973 3300005614 Bacteria 8068
104 Ga0068852_100004800 3300005616 Bacteria 9601
105 Ga0068852_100006288 3300005616 Bacteria 8574
106 Ga0068852_100076323 3300005616 Bacteria 2958
107 Ga0068852_100120323 3300005616 Bacteria 2402
108 Ga0068852_100329238 3300005616 Bacteria 1486
109 Ga0068859_100020923 3300005617 Bacteria 6567
110 Ga0068859_100034265 3300005617 Bacteria 5097
111 Ga0068864_100002240 3300005618 Bacteria 15980
112 Ga0068864_100003831 3300005618 Bacteria 12399
113 Ga0068864_100019410 3300005618 Bacteria 5684
114 Ga0068864_100026960 3300005618 Bacteria 4847
115 Ga0068864_100076309 3300005618 Bacteria 2928
116 Ga0068864_100165588 3300005618 Bacteria 2012
117 Ga0068866_10039029 3300005718 Bacteria 2342
118 Ga0068861_100001035 3300005719 Bacteria 17040
119 Ga0068851_10006380 3300005834 Bacteria 5381
120 Ga0068851_10030385 3300005834 Bacteria 2679
121 Ga0068870_10004528 3300005840 Bacteria 5990
122 Ga0068863_100009320 3300005841 Bacteria 9578
123 Ga0068863_100022793 3300005841 Bacteria 5982
124 Ga0068863_100031425 3300005841 Bacteria 5066
125 Ga0068863_100049632 3300005841 Bacteria 3978
126 Ga0068863_100073507 3300005841 Bacteria 3234
127 Ga0068858_100003858 3300005842 Bacteria 14819
128 Ga0068858_100013579 3300005842 Bacteria 7686
129 Ga0068858_100015449 3300005842 Bacteria 7180
130 Ga0068860_100009677 3300005843 Bacteria 9574
131 Ga0068860_100010520 3300005843 Bacteria 9146
132 Ga0068860_100171227 3300005843 Bacteria 2097
133 Ga0068860_100219140 3300005843 Bacteria 1848
134 Ga0068862_100007872 3300005844 Bacteria 8816
135 Ga0075368_10013509 3300006042 Bacteria 3000
136 Ga0075364_10072880 3300006051 Bacteria 2263
137 Ga0075362_10048742 3300006177 Bacteria 1890
138 Ga0075366_10011275 3300006195 Bacteria 5045
139 Ga0075366_10016063 3300006195 Bacteria 4298
140 Ga0075366_10056630 3300006195 Bacteria 2328
141 Ga0075366_10089488 3300006195 Bacteria 1844
142 Ga0097621_100019992 3300006237 Bacteria 5153
143 Ga0097621_100022325 3300006237 Bacteria 4911
144 Ga0097621_100029886 3300006237 Bacteria 4308
145 Ga0097621_100117715 3300006237 Bacteria 2251
146 Ga0075370_10107703 3300006353 Bacteria 1617
147 Ga0075370_10114202 3300006353 Bacteria 1569
148 Ga0075370_10114897 3300006353 Bacteria 1564
149 Ga0068871_100081594 3300006358 Bacteria 2679
150 Ga0075430_100094253 3300006846 Bacteria 2503
151 Ga0075429_100024893 3300006880 Bacteria 5195
152 Ga0097620_100020923 3300006931 Bacteria 6567
153 Ga0097620_100034265 3300006931 Bacteria 5097
154 Ga0079104_1000206 3300006946 Bacteria 82424
155 Ga0105245_10008776 3300009098 Bacteria 8815
156 Ga0105245_10142126 3300009098 Bacteria 2262
157 Ga0105243_10050039 3300009148 Bacteria 3300
158 Ga0105243_10190419 3300009148 Bacteria 1791
159 Ga0105243_10192236 3300009148 Bacteria 1783
160 Ga0105242_10089559 3300009176 Bacteria 2587
161 Ga0105248_10003509 3300009177 Bacteria 17390
162 Ga0105248_10110227 3300009177 Bacteria 3103
163 Ga0105248_10321557 3300009177 Bacteria 1742
164 Ga0105249_10044205 3300009553 Bacteria 4051
165 Ga0105239_10197450 3300010375 Bacteria 2253
166 Ga0157371_10115036 3300013102 Bacteria 1910
167 Ga0157369_10005006 3300013105 Bacteria 15519
168 Ga0157374_10021185 3300013296 Bacteria 5779
169 Ga0163162_10067305 3300013306 Bacteria 3632
170 Ga0157372_10007733 3300013307 Bacteria 11419
171 Ga0157372_10017438 3300013307 Bacteria 7708
172 Ga0157375_10007068 3300013308 Bacteria 9800
173 Ga0157375_10021697 3300013308 Bacteria 5895
174 Ga0157375_10044164 3300013308 Bacteria 4327
175 Ga0157375_10065314 3300013308 Bacteria 3627
176 Ga0157375_10327630 3300013308 Bacteria 1696
177 Ga0163163_10030904 3300014325 Bacteria 5164
178 Ga0157380_10004143 3300014326 Bacteria 10022
179 Ga0157380_10305327 3300014326 Bacteria 1468
180 Ga0157377_10000954 3300014745 Bacteria 12108
181 Ga0157379_10002231 3300014968 Bacteria 16123
182 Ga0157379_10003267 3300014968 Bacteria 13732
183 Ga0157379_10043502 3300014968 Bacteria 4010
184 Ga0157376_10003713 3300014969 Bacteria 10551
185 Ga0157376_10015915 3300014969 Bacteria 5696
186 Ga0163161_10015147 3300017792 Bacteria 5373
187 Ga0163161_10019424 3300017792 Bacteria 4767
188 Ga0213872_10000006 3300021361 Bacteria 249845
189 Ga0213872_10001260 3300021361 Bacteria 17048
190 Ga0213872_10037249 3300021361 Bacteria 2220
191 Ga0207425_1000121 3300025245 Bacteria 73749
192 Ga0209129_1000012 3300025258 Bacteria 541516
193 Ga0209564_1000022 3300025295 Bacteria 555109
194 Ga0209758_1000099 3300025297 Bacteria 230054
195 Ga0209758_1000358 3300025297 Bacteria 81693
196 Ga0209050_1000760 3300025298 Bacteria 46346
197 Ga0209050_1000873 3300025298 Bacteria 40656
198 Ga0209050_1001867 3300025298 Bacteria 20271
199 Ga0209050_1007119 3300025298 Bacteria 6389
200 Ga0209256_1000036 3300025299 Bacteria 386664
201 Ga0209051_1000068 3300025303 Bacteria 220063
202 Ga0209051_1001319 3300025303 Bacteria 21686
203 Ga0209051_1012471 3300025303 Bacteria 4108
204 Ga0209257_1000033 3300025304 Bacteria 671006
205 Ga0209257_1000146 3300025304 Bacteria 194261
206 Ga0209257_1017781 3300025304 Bacteria 2779
207 Ga0207697_10013155 3300025315 Bacteria 3455
208 Ga0207697_10018459 3300025315 Bacteria 2861
209 Ga0207656_10010441 3300025321 Bacteria 3480
210 Ga0207656_10021309 3300025321 Bacteria 2588
211 Ga0207682_10000367 3300025893 Bacteria 20767
212 Ga0207682_10003512 3300025893 Bacteria 6791
213 Ga0207682_10024597 3300025893 Bacteria 2385
214 Ga0207642_10002152 3300025899 Bacteria 6105
215 Ga0207642_10057936 3300025899 Bacteria 1785
216 Ga0207688_10043749 3300025901 Bacteria 2494
217 Ga0207680_10020291 3300025903 Bacteria 3572
218 Ga0207645_10003747 3300025907 Bacteria 11429
219 Ga0207645_10004840 3300025907 Bacteria 9886
220 Ga0207645_10032581 3300025907 Bacteria 3350
221 Ga0207645_10038443 3300025907 Bacteria 3069
222 Ga0207645_10062495 3300025907 Bacteria 2379
223 Ga0207643_10011593 3300025908 Bacteria 4760
224 Ga0207705_10033979 3300025909 Bacteria 3645
225 Ga0207662_10003252 3300025918 Bacteria 8329
226 Ga0207657_10050511 3300025919 Bacteria 3619
227 Ga0207649_10005548 3300025920 Bacteria 6827
228 Ga0207649_10010036 3300025920 Bacteria 5194
229 Ga0207652_10014128 3300025921 Bacteria 6464
230 Ga0207681_10095507 3300025923 Bacteria 2132
231 Ga0207694_10028123 3300025924 Bacteria 4286
232 Ga0207650_10003433 3300025925 Bacteria 10894
233 Ga0207650_10005558 3300025925 Bacteria 8601
234 Ga0207650_10010469 3300025925 Bacteria 6359
235 Ga0207650_10099644 3300025925 Bacteria 2234
236 Ga0207659_10010007 3300025926 Bacteria 5940
237 Ga0207659_10010360 3300025926 Bacteria 5857
238 Ga0207659_10027917 3300025926 Bacteria 3828
239 Ga0207659_10052485 3300025926 Bacteria 2905
240 Ga0207659_10064458 3300025926 Bacteria 2652
241 Ga0207687_10009888 3300025927 Bacteria 6244
242 Ga0207687_10060244 3300025927 Bacteria 2677
243 Ga0207687_10072823 3300025927 Bacteria 2459
244 Ga0207687_10252492 3300025927 Bacteria 1403
245 Ga0207644_10007388 3300025931 Bacteria 7159
246 Ga0207644_10007832 3300025931 Bacteria 6978
247 Ga0207690_10022955 3300025932 Bacteria 3888
248 Ga0207690_10113220 3300025932 Bacteria 1957
249 Ga0207706_10001701 3300025933 Bacteria 21679
250 Ga0207706_10003954 3300025933 Bacteria 14043
251 Ga0207706_10026008 3300025933 Bacteria 5241
252 Ga0207706_10041139 3300025933 Bacteria 4098
253 Ga0207706_10171440 3300025933 Bacteria 1907
254 Ga0207669_10139049 3300025937 Bacteria 1682
255 Ga0207704_10038465 3300025938 Bacteria 2775
256 Ga0207704_10089420 3300025938 Bacteria 2018
257 Ga0207704_10139382 3300025938 Bacteria 1694
258 Ga0207691_10003400 3300025940 Bacteria 15475
259 Ga0207691_10008283 3300025940 Bacteria 9981
260 Ga0207691_10038504 3300025940 Bacteria 4425
261 Ga0207691_10042669 3300025940 Bacteria 4180
262 Ga0207691_10059310 3300025940 Bacteria 3480
263 Ga0207691_10071711 3300025940 Bacteria 3125
264 Ga0207691_10159584 3300025940 Bacteria 1979
265 Ga0207691_10174197 3300025940 Bacteria 1883
266 Ga0207691_10179617 3300025940 Bacteria 1850
267 Ga0207711_10049902 3300025941 Bacteria 3582
268 Ga0207711_10207954 3300025941 Bacteria 1787
269 Ga0207689_10001858 3300025942 Bacteria 19991
270 Ga0207689_10005387 3300025942 Bacteria 11450
271 Ga0207689_10034084 3300025942 Bacteria 4228
272 Ga0207661_10056370 3300025944 Bacteria 3154
273 Ga0207679_10018055 3300025945 Bacteria 4717
274 Ga0207679_10018942 3300025945 Bacteria 4619
275 Ga0207679_10079594 3300025945 Bacteria 2500
276 Ga0207651_10023944 3300025960 Bacteria 3766
277 Ga0207651_10058800 3300025960 Bacteria 2658
278 Ga0207651_10059481 3300025960 Bacteria 2647
279 Ga0207651_10066908 3300025960 Bacteria 2526
280 Ga0207712_10003299 3300025961 Bacteria 10236
281 Ga0207668_10007352 3300025972 Bacteria 6546
282 Ga0207668_10064371 3300025972 Bacteria 2591
283 Ga0207668_10151197 3300025972 Bacteria 1797
284 Ga0207668_10215229 3300025972 Bacteria 1539
285 Ga0207640_10011321 3300025981 Bacteria 5047
286 Ga0207640_10027449 3300025981 Bacteria 3469
287 Ga0207640_10129967 3300025981 Bacteria 1819
288 Ga0207658_10001534 3300025986 Bacteria 17947
289 Ga0207658_10006844 3300025986 Bacteria 7769
290 Ga0207658_10099465 3300025986 Bacteria 2275
291 Ga0207677_10003376 3300026023 Bacteria 8451
292 Ga0207677_10022400 3300026023 Bacteria 3882
293 Ga0207677_10030925 3300026023 Bacteria 3424
294 Ga0207677_10056389 3300026023 Bacteria 2692
295 Ga0207677_10194560 3300026023 Bacteria 1607
296 Ga0207703_10001859 3300026035 Bacteria 18774
297 Ga0207703_10008117 3300026035 Bacteria 8297
298 Ga0207703_10016847 3300026035 Bacteria 5699
299 Ga0207703_10028951 3300026035 Bacteria 4371
300 Ga0207639_10007190 3300026041 Bacteria 7584
301 Ga0207639_10009935 3300026041 Bacteria 6575
302 Ga0207639_10058528 3300026041 Bacteria 2964
303 Ga0207678_10004374 3300026067 Bacteria 12704
304 Ga0207678_10063327 3300026067 Bacteria 3178
305 Ga0207641_10002724 3300026088 Bacteria 16119
306 Ga0207641_10053919 3300026088 Bacteria 3410
307 Ga0207641_10061294 3300026088 Bacteria 3208
308 Ga0207641_10185212 3300026088 Bacteria 1909
309 Ga0207648_10000878 3300026089 Bacteria 33868
310 Ga0207648_10010177 3300026089 Bacteria 8943
311 Ga0207648_10026969 3300026089 Bacteria 5102
312 Ga0207648_10036109 3300026089 Bacteria 4354
313 Ga0207648_10088106 3300026089 Bacteria 2710
314 Ga0207648_10092740 3300026089 Bacteria 2641
315 Ga0207676_10005560 3300026095 Bacteria 8916
316 Ga0207676_10015385 3300026095 Bacteria 5517
317 Ga0207676_10026669 3300026095 Bacteria 4297
318 Ga0207676_10044955 3300026095 Bacteria 3409
319 Ga0207676_10126518 3300026095 Bacteria 2165
320 Ga0207676_10128050 3300026095 Bacteria 2154
321 Ga0207676_10251656 3300026095 Bacteria 1590
322 Ga0207674_10012770 3300026116 Bacteria 9382
323 Ga0207674_10076475 3300026116 Bacteria 3355
324 Ga0207674_10108250 3300026116 Bacteria 2756
325 Ga0207675_100001372 3300026118 Bacteria 24404
326 Ga0207675_100002097 3300026118 Bacteria 19787
327 Ga0207675_100045497 3300026118 Bacteria 4100
328 Ga0207675_100144733 3300026118 Bacteria 2259
329 Ga0207683_10007352 3300026121 Bacteria 9439
330 Ga0207683_10011145 3300026121 Bacteria 7662
331 Ga0207683_10030363 3300026121 Bacteria 4684
332 Ga0207698_10014121 3300026142 Bacteria 5296
333 Ga0207698_10032308 3300026142 Bacteria 3790
334 Ga0209281_1000259 3300027111 Bacteria 101905
335 Ga0209968_1003621 3300027526 Bacteria 2318
336 Ga0209966_1000118 3300027695 Bacteria 35137
337 Ga0268265_10004979 3300028380 Bacteria 9123
338 Ga0268264_10012729 3300028381 Bacteria 6923
339 Ga0268264_10026002 3300028381 Bacteria 4779
340 Ga0268264_10042567 3300028381 Bacteria 3760
341 Ga0307515_10000011 3300028794 Bacteria 633903
342 Ga0307515_10000138 3300028794 Bacteria 173220
343 Ga0307515_10000382 3300028794 Bacteria 107907
344 Ga0307515_10003938 3300028794 Bacteria 30997
345 Ga0307515_10008707 3300028794 Bacteria 19727
346 Ga0307515_10016574 3300028794 Bacteria 13485
347 Ga0307515_10027638 3300028794 Bacteria 9685
348 Ga0307515_10055843 3300028794 Bacteria 5757
349 Ga0307513_10005580 3300031456 Bacteria 16591
350 Ga0307513_10057022 3300031456 Bacteria 4165
351 Ga0307513_10173198 3300031456 Bacteria 2033
352 Ga0307509_10050129 3300031507 Bacteria 4472
353 Ga0307408_100000089 3300031548 Bacteria 100712
354 Ga0307408_100111356 3300031548 Bacteria 2103
355 Ga0307408_100240916 3300031548 Bacteria 1486
356 Ga0307508_10000509 3300031616 Bacteria 46521
357 Ga0307508_10002648 3300031616 Bacteria 18776
358 Ga0307514_10006054 3300031649 Bacteria 10634
359 Ga0307516_10001122 3300031730 Bacteria 37338
360 Ga0307516_10001343 3300031730 Bacteria 34183
361 Ga0307516_10010884 3300031730 Bacteria 9951
362 Ga0307516_10140755 3300031730 Bacteria 2182
363 Ga0307405_10052268 3300031731 Bacteria 2539
364 Ga0307410_10007442 3300031852 Bacteria 5994
365 Ga0307406_10027875 3300031901 Bacteria 3408
366 Ga0307406_10079843 3300031901 Bacteria 2170
367 Ga0307412_10055643 3300031911 Bacteria 2632
368 Ga0307416_100092910 3300032002 Bacteria 2597
369 Ga0307416_100137567 3300032002 Bacteria 2213
370 Ga0307416_100176869 3300032002 Bacteria 1995
371 Ga0307414_10069304 3300032004 Bacteria 2535
372 Ga0307411_10000578 3300032005 Bacteria 13083
373 Ga0307411_10073121 3300032005 Bacteria 2331
374 Ga0307415_100003116 3300032126 Bacteria 8394
375 Ga0307415_100142047 3300032126 Bacteria 1835
376 Ga0307507_10201879 3300033179 Bacteria 1373
377 Ga0373934_0055528 3300035086 Bacteria 1574
378 Ga0373939_0000041 3300035114 Bacteria 45477
379 Ga0373960_0000135 3300035121 Bacteria 12101
380 Ga0373960_0018354 3300035121 Bacteria 1823
381 Ga0373943_0138570 3300035170 Bacteria 1309
382 Ga0373962_0006819 3300035242 Bacteria 2778
383 Ga0373931_0000376 3300035691 Bacteria 18350
384 Ga0373931_0031563 3300035691 Bacteria 2735
385 Ga0373931_0056188 3300035691 Bacteria 2108
386 Ga0373925_0072442 3300037068 Bacteria 2607
387 Ga0395900_0000879 3300037418 Bacteria 39414
388 Ga0395898_0001863 3300037466 Bacteria 27013
389 Ga0395905_0003362 3300037471 Bacteria 17150
390 Ga0395905_0032528 3300037471 Bacteria 4905
391 Ga0395905_0232761 3300037471 Bacteria 1722
392 Ga0436365_0129427 3300039437 Bacteria 1352
393 Ga0436365_1211877 3300039437 Bacteria 3471
394 Ga0436361_0085209 3300039447 Bacteria 38016
395 Ga0436361_0694318 3300039447 Bacteria 14752
396 Ga0436361_1050662 3300039447 Bacteria 5587
397 Ga0451853_3280139 3300041512 Bacteria 1606
398 Ga0439431_0013172 3300041997 Bacteria 1905
399 Ga0439437_002217 3300042000 Bacteria 2068
400 Ga0450890_001159 3300042127 Bacteria 3813
401 Ga0450892_001171 3300042130 Bacteria 2696
402 Ga0450889_000511 3300042144 Bacteria 4330
403 Ga0439464_0008961 3300042439 Bacteria 2625
404 Ga0450918_001860 3300042531 Bacteria 4103
405 Ga0466969_0000080 3300044656 Bacteria 51012
406 Ga0466972_0001998 3300044658 Bacteria 9983
407 Ga0466972_0003796 3300044658 Bacteria 7511
408 Ga0466966_0021580 3300044684 Bacteria 4229
409 Ga0466964_0050000 3300044706 Bacteria 1713
410 Ga0453684_0004127 3300044712 Bacteria 31463
411 Ga0453684_0077669 3300044712 Bacteria 4159
412 Ga0453684_0123452 3300044712 Bacteria 3122
413 Ga0466960_0032373 3300044901 Bacteria 2420
414 Ga0466959_0039156 3300045049 Bacteria 3503
415 Ga0451576_0002071 3300045051 Bacteria 31414
416 Ga0451576_0134912 3300045051 Bacteria 2574
417 Ga0451576_0166531 3300045051 Bacteria 2300
418 Ga0451576_0224709 3300045051 Bacteria 1960
419 Ga0466958_0157040 3300045836 Bacteria 1436
420 Ga0495629_0027006 3300046459 Bacteria 4077
421 Ga0495650_0005020 3300046471 Bacteria 8792
422 Ga0495620_0061941 3300046515 Bacteria 1555
423 Ga0495632_0003426 3300046519 Bacteria 11271
424 Ga0495598_0047909 3300046537 Bacteria 1276
425 Ga0495621_0016142 3300046539 Bacteria 2392
426 Ga0495611_0024802 3300046648 Bacteria 2610
427 Ga0495625_0057604 3300046660 Bacteria 2762
428 Ga0495625_0138031 3300046660 Bacteria 1646
429 Ga0495658_0087175 3300046683 Bacteria 1843
430 Ga0495658_0113371 3300046683 Bacteria 1632
431 Ga0495658_0131764 3300046683 Bacteria 1522
432 Ga0495649_0011008 3300046694 Bacteria 5329
433 Ga0495676_0045922 3300047321 Bacteria 3551
434 Ga0495680_0100660 3300047322 Bacteria 2153
435 Ga0495687_004841 3300047443 Bacteria 8856
436 Ga0495687_041483 3300047443 Bacteria 2018
437 Ga0495684_0211105 3300047471 Bacteria 1427
438 Ga0496100_0015594 3300048903 Bacteria 4439
439 Ga0496102_0097526 3300048905 Bacteria 2726
440 Ga0496104_0214506 3300048907 Bacteria 1837
441 Ga0496105_0086240 3300048908 Bacteria 2594
442 Ga0496106_0003964 3300048909 Bacteria 11064
443 Ga0496108_0013851 3300048911 Bacteria 6577
444 Ga0496108_0025598 3300048911 Bacteria 4864
445 Ga0496109_0054662 3300048912 Bacteria 3642
446 Ga0496109_0314118 3300048912 Bacteria 1478
447 Ga0496110_0046498 3300048913 Bacteria 3797
448 Ga0496111_0140764 3300048914 Bacteria 1787
449 Ga0496112_0245041 3300048915 Bacteria 1744
450 Ga0496113_0048359 3300048916 Bacteria 3164
451 Ga0496114_0006497 3300048917 Bacteria 9213
452 Ga0496114_0098319 3300048917 Bacteria 2495
453 Ga0501310_000567 3300049130 Bacteria 3256
454 Ga0501292_002820 3300049515 Bacteria 2272
455 Ga0501297_002053 3300049520 Bacteria 1920
456 Ga0501300_005742 3300049523 Bacteria 1828
457 Ga0501031_0004445 3300049568 Bacteria 9093
458 Ga0501043_0000009 3300049579 Bacteria 214823
459 Ga0501046_0000022 3300049580 Bacteria 215451
460 Ga0501047_0000021 3300049581 Bacteria 254841
461 Ga0501048_0017288 3300049582 Bacteria 5313
462 Ga0501198_000019 3300049649 Bacteria 83282
463 Ga0501206_005550 3300049653 Bacteria 1623
464 Ga0501222_000059 3300049662 Bacteria 34949
465 Ga0501227_005993 3300049665 Bacteria 2607
466 Ga0501257_012538 3300049686 Bacteria 1939
467 Ga0501229_000514 3300049706 Bacteria 4388
468 Ga0501267_000661 3300049764 Bacteria 2742
469 Ga0501281_01403 3300049777 Bacteria 1902
470 Ga0501045_0013616 3300049824 Bacteria 5748
471 nmdc:mga03683_49026_c1 3300050489 Bacteria 1757
472 nmdc:mga03683_7564_c1 3300050489 Bacteria 3778
473 nmdc:mga03n38_17237_c1 3300050490 Bacteria 2825
474 nmdc:mga0k408_145698_c1 3300050493 Bacteria 1410
475 nmdc:mga0k408_3352_c1 3300050493 Bacteria 8484
476 nmdc:mga0k408_62506_c1 3300050493 Bacteria 2165
477 nmdc:mga0k408_85417_c1 3300050493 Bacteria 1852
478 nmdc:mga0k408_88319_c1 3300050493 Bacteria 1820
479 nmdc:mga07m45_12882_c1 3300050496 Bacteria 4424
480 nmdc:mga07m45_212_c1 3300050496 Bacteria 23044
481 nmdc:mga07m45_5711_c1 3300050496 Bacteria 6223
482 nmdc:mga07m45_821_c1 3300050496 Bacteria 13429
483 nmdc:mga07m45_9989_c1 3300050496 Bacteria 4942
484 nmdc:mga09592_21996_c1 3300050508 Bacteria 5261
485 nmdc:mga0qj67_62492_c1 3300050509 Bacteria 2959
486 nmdc:mga0n895_388726_c1 3300050512 Bacteria 1411
487 Ga0495601_0024148 3300053077 Bacteria 3742
488 Ga0495595_0080244 3300053084 Bacteria 1553
489 Ga0495619_0023748 3300053085 Bacteria 3931
490 Ga0500578_0000712 3300053086 Bacteria 39576
491 Ga0500651_0003737 3300053093 Bacteria 8384
492 Ga0500651_0083902 3300053093 Bacteria 1970
493 Ga0500628_001000 3300053129 Bacteria 4941
494 Ga0500652_000123 3300053131 Bacteria 29418
495 Ga0500658_0038410 3300053134 Bacteria 1908
496 Ga0500559_0000446 3300053136 Bacteria 29360
497 Ga0500568_0002851 3300053139 Bacteria 9963
498 Ga0500568_0054192 3300053139 Bacteria 1569
499 Ga0500590_034871 3300053148 Bacteria 2605
500 Ga0500619_000205 3300053154 Bacteria 13646
501 Ga0500622_0000111 3300053156 Bacteria 83844
502 Ga0500622_0000147 3300053156 Bacteria 74375
503 Ga0500645_002750 3300053730 Bacteria 7623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_12882_c1 nmdc:mga07m45_12882_c1_2837_4066 383
2 3300006042 Ga0075368_10013509 Ga0075368_100135091 386
3 3300006177 Ga0075362_10048742 Ga0075362_100487421 386
4 3300044712 Ga0453684_0077669 Ga0453684_0077669_1475_2656 388
5 3300031456 Ga0307513_10005580 Ga0307513_100055806 389
6 3300026118 Ga0207675_100144733 Ga0207675_1001447332 390
7 3300005353 Ga0070669_100134216 Ga0070669_1001342161 391
8 3300005543 Ga0070672_100155264 Ga0070672_1001552642 391
9 3300005718 Ga0068866_10039029 Ga0068866_100390292 391
10 3300006237 Ga0097621_100117715 Ga0097621_1001177152 391
11 3300009177 Ga0105248_10321557 Ga0105248_103215571 391
12 3300025923 Ga0207681_10095507 Ga0207681_100955072 391
13 3300025925 Ga0207650_10005558 Ga0207650_100055581 391
14 iso_pu_bacteria 2585428062 2587759470 392
15 iso_pu_bacteria 2643221585 2643932726 392
16 iso_pu_bacteria 2643221644 2644243419 392
17 iso_pu_bacteria 2643221656 2644313976 392
18 iso_pu_bacteria 2643221544 2643743253 393
19 3300045051 Ga0451576_0134912 Ga0451576_0134912_292_1491 394
20 3300031456 Ga0307513_10057022 Ga0307513_100570222 395
21 3300031730 Ga0307516_10140755 Ga0307516_101407552 395
22 3300003316 rootH1_10026619 rootH1_100266193 396
23 3300003322 rootL2_10004746 rootL2_100047463 396
24 3300003775 Ga0055524_1000052 Ga0055524_100005249 396
25 3300003791 Ga0055530_10006054 Ga0055530_100060544 396
26 3300003792 Ga0055540_1000123 Ga0055540_100012347 396
27 3300003794 Ga0055531_10004658 Ga0055531_100046586 396
28 3300005293 Ga0065715_10133874 Ga0065715_101338741 396
29 3300005328 Ga0070676_10017077 Ga0070676_100170773 396
30 3300005331 Ga0070670_100121549 Ga0070670_1001215492 396
31 3300005333 Ga0070677_10004059 Ga0070677_100040594 396
32 3300005335 Ga0070666_10094428 Ga0070666_100944281 396
33 3300005338 Ga0068868_100019699 Ga0068868_1000196993 396
34 3300005344 Ga0070661_100013952 Ga0070661_1000139522 396
35 3300005354 Ga0070675_100006390 Ga0070675_1000063904 396
36 3300005355 Ga0070671_100052558 Ga0070671_1000525584 396
37 3300005356 Ga0070674_100005544 Ga0070674_1000055447 396
38 3300005356 Ga0070674_100017406 Ga0070674_1000174061 396
39 3300005364 Ga0070673_100195480 Ga0070673_1001954801 396
40 3300005366 Ga0070659_100004770 Ga0070659_1000047709 396
41 3300005367 Ga0070667_100007643 Ga0070667_1000076435 396
42 3300005459 Ga0068867_100008316 Ga0068867_1000083161 396
43 3300005459 Ga0068867_100037704 Ga0068867_1000377044 396
44 3300005543 Ga0070672_100008925 Ga0070672_1000089253 396
45 3300005543 Ga0070672_100009684 Ga0070672_1000096842 396
46 3300005543 Ga0070672_100149709 Ga0070672_1001497092 396
47 3300005548 Ga0070665_100014521 Ga0070665_1000145216 396
48 3300005564 Ga0070664_100021202 Ga0070664_1000212024 396
49 3300005564 Ga0070664_100093314 Ga0070664_1000933141 396
50 3300005578 Ga0068854_100034170 Ga0068854_1000341701 396
51 3300005616 Ga0068852_100329238 Ga0068852_1003292381 396
52 3300005617 Ga0068859_100034265 Ga0068859_1000342657 396
53 3300005618 Ga0068864_100019410 Ga0068864_1000194102 396
54 3300005840 Ga0068870_10004528 Ga0068870_100045285 396
55 3300005841 Ga0068863_100031425 Ga0068863_1000314256 396
56 3300006195 Ga0075366_10011275 Ga0075366_100112754 396
57 3300006195 Ga0075366_10056630 Ga0075366_100566303 396
58 3300006195 Ga0075366_10089488 Ga0075366_100894882 396
59 3300006237 Ga0097621_100029886 Ga0097621_1000298865 396
60 3300006353 Ga0075370_10114202 Ga0075370_101142021 396
61 3300006353 Ga0075370_10114897 Ga0075370_101148972 396
62 3300006931 Ga0097620_100034265 Ga0097620_1000342652 396
63 3300006946 Ga0079104_1000206 Ga0079104_100020679 396
64 3300009098 Ga0105245_10142126 Ga0105245_101421262 396
65 3300009148 Ga0105243_10050039 Ga0105243_100500393 396
66 3300013308 Ga0157375_10021697 Ga0157375_100216975 396
67 3300017792 Ga0163161_10015147 Ga0163161_100151472 396
68 3300021361 Ga0213872_10000006 Ga0213872_1000000647 396
69 3300021361 Ga0213872_10001260 Ga0213872_100012606 396
70 3300021361 Ga0213872_10037249 Ga0213872_100372491 396
71 3300025298 Ga0209050_1000760 Ga0209050_100076016 396
72 3300025298 Ga0209050_1007119 Ga0209050_10071195 396
73 3300025299 Ga0209256_1000036 Ga0209256_1000036179 396
74 3300025303 Ga0209051_1000068 Ga0209051_100006832 396
75 3300025304 Ga0209257_1000146 Ga0209257_10001466 396
76 3300025315 Ga0207697_10013155 Ga0207697_100131554 396
77 3300025893 Ga0207682_10000367 Ga0207682_1000036713 396
78 3300025907 Ga0207645_10003747 Ga0207645_100037479 396
79 3300025907 Ga0207645_10032581 Ga0207645_100325814 396
80 3300025907 Ga0207645_10062495 Ga0207645_100624952 396
81 3300025908 Ga0207643_10011593 Ga0207643_100115935 396
82 3300025920 Ga0207649_10010036 Ga0207649_100100364 396
83 3300025925 Ga0207650_10010469 Ga0207650_100104693 396
84 3300025926 Ga0207659_10010360 Ga0207659_100103605 396
85 3300025926 Ga0207659_10052485 Ga0207659_100524852 396
86 3300025927 Ga0207687_10009888 Ga0207687_100098888 396
87 3300025931 Ga0207644_10007388 Ga0207644_100073884 396
88 3300025937 Ga0207669_10139049 Ga0207669_101390491 396
89 3300025938 Ga0207704_10089420 Ga0207704_100894201 396
90 3300025940 Ga0207691_10003400 Ga0207691_1000340012 396
91 3300025940 Ga0207691_10008283 Ga0207691_100082837 396
92 3300025940 Ga0207691_10174197 Ga0207691_101741972 396
93 3300025942 Ga0207689_10034084 Ga0207689_100340841 396
94 3300025945 Ga0207679_10018942 Ga0207679_100189422 396
95 3300025945 Ga0207679_10079594 Ga0207679_100795942 396
96 3300025960 Ga0207651_10058800 Ga0207651_100588002 396
97 3300025960 Ga0207651_10059481 Ga0207651_100594812 396
98 3300025972 Ga0207668_10215229 Ga0207668_102152291 396
99 3300025981 Ga0207640_10129967 Ga0207640_101299671 396
100 3300025986 Ga0207658_10006844 Ga0207658_100068446 396
101 3300026023 Ga0207677_10022400 Ga0207677_100224001 396
102 3300026088 Ga0207641_10053919 Ga0207641_100539192 396
103 3300026089 Ga0207648_10000878 Ga0207648_100008789 396
104 3300026089 Ga0207648_10010177 Ga0207648_100101771 396
105 3300026089 Ga0207648_10036109 Ga0207648_100361091 396
106 3300026095 Ga0207676_10015385 Ga0207676_100153852 396
107 3300026095 Ga0207676_10126518 Ga0207676_101265182 396
108 3300026116 Ga0207674_10108250 Ga0207674_101082501 396
109 3300026121 Ga0207683_10007352 Ga0207683_100073523 396
110 3300027111 Ga0209281_1000259 Ga0209281_100025978 396
111 3300028381 Ga0268264_10042567 Ga0268264_100425672 396
112 3300028794 Ga0307515_10000011 Ga0307515_10000011233 396
113 3300028794 Ga0307515_10000138 Ga0307515_1000013881 396
114 3300028794 Ga0307515_10000382 Ga0307515_1000038292 396
115 3300028794 Ga0307515_10003938 Ga0307515_1000393828 396
116 3300028794 Ga0307515_10055843 Ga0307515_100558432 396
117 3300031456 Ga0307513_10173198 Ga0307513_101731982 396
118 3300031507 Ga0307509_10050129 Ga0307509_100501294 396
119 3300031548 Ga0307408_100000089 Ga0307408_10000008973 396
120 3300031548 Ga0307408_100111356 Ga0307408_1001113561 396
121 3300031616 Ga0307508_10000509 Ga0307508_1000050913 396
122 3300031616 Ga0307508_10002648 Ga0307508_100026482 396
123 3300031649 Ga0307514_10006054 Ga0307514_100060547 396
124 3300031730 Ga0307516_10001343 Ga0307516_100013432 396
125 3300031730 Ga0307516_10010884 Ga0307516_100108842 396
126 3300031731 Ga0307405_10052268 Ga0307405_100522681 396
127 3300031852 Ga0307410_10007442 Ga0307410_100074421 396
128 3300031901 Ga0307406_10079843 Ga0307406_100798432 396
129 3300031911 Ga0307412_10055643 Ga0307412_100556432 396
130 3300032002 Ga0307416_100092910 Ga0307416_1000929103 396
131 3300032002 Ga0307416_100137567 Ga0307416_1001375672 396
132 3300032002 Ga0307416_100176869 Ga0307416_1001768692 396
133 3300032004 Ga0307414_10069304 Ga0307414_100693042 396
134 3300032005 Ga0307411_10000578 Ga0307411_100005786 396
135 3300032126 Ga0307415_100142047 Ga0307415_1001420471 396
136 3300033179 Ga0307507_10201879 Ga0307507_102018791 396
137 3300035114 Ga0373939_0000041 Ga0373939_0000041_25467_26675 396
138 3300035121 Ga0373960_0000135 Ga0373960_0000135_1859_3067 396
139 3300035242 Ga0373962_0006819 Ga0373962_0006819_1274_2482 396
140 3300035691 Ga0373931_0000376 Ga0373931_0000376_306_1514 396
141 3300035691 Ga0373931_0056188 Ga0373931_0056188_206_1411 396
142 3300037471 Ga0395905_0032528 Ga0395905_0032528_455_1660 396
143 3300039437 Ga0436365_0129427 Ga0436365_0129427_46_1251 396
144 3300039447 Ga0436361_0085209 Ga0436361_0085209_24390_25595 396
145 3300039447 Ga0436361_0694318 Ga0436361_0694318_6945_8150 396
146 3300039447 Ga0436361_1050662 Ga0436361_1050662_1408_2613 396
147 3300041512 Ga0451853_3280139 Ga0451853_3280139_276_1484 396
148 3300042127 Ga0450890_001159 Ga0450890_001159_924_2132 396
149 3300042531 Ga0450918_001860 Ga0450918_001860_1223_2428 396
150 3300044684 Ga0466966_0021580 Ga0466966_0021580_310_1515 396
151 3300044706 Ga0466964_0050000 Ga0466964_0050000_200_1405 396
152 3300044712 Ga0453684_0004127 Ga0453684_0004127_2765_3970 396
153 3300044712 Ga0453684_0123452 Ga0453684_0123452_583_1788 396
154 3300044901 Ga0466960_0032373 Ga0466960_0032373_355_1560 396
155 3300045049 Ga0466959_0039156 Ga0466959_0039156_1175_2380 396
156 3300045051 Ga0451576_0002071 Ga0451576_0002071_27994_29199 396
157 3300045051 Ga0451576_0224709 Ga0451576_0224709_384_1592 396
158 3300045836 Ga0466958_0157040 Ga0466958_0157040_54_1259 396
159 3300046471 Ga0495650_0005020 Ga0495650_0005020_2308_3513 396
160 3300046537 Ga0495598_0047909 Ga0495598_0047909_14_1255 396
161 3300046660 Ga0495625_0057604 Ga0495625_0057604_449_1654 396
162 3300046683 Ga0495658_0113371 Ga0495658_0113371_170_1375 396
163 3300047321 Ga0495676_0045922 Ga0495676_0045922_13_1218 396
164 3300048917 Ga0496114_0006497 Ga0496114_0006497_5055_6260 396
165 3300049130 Ga0501310_000567 Ga0501310_000567_1461_2669 396
166 3300049515 Ga0501292_002820 Ga0501292_002820_1014_2219 396
167 3300049520 Ga0501297_002053 Ga0501297_002053_260_1468 396
168 3300049523 Ga0501300_005742 Ga0501300_005742_415_1623 396
169 3300049579 Ga0501043_0000009 Ga0501043_0000009_88773_89978 396
170 3300049580 Ga0501046_0000022 Ga0501046_0000022_88762_89967 396
171 3300049581 Ga0501047_0000021 Ga0501047_0000021_88820_90025 396
172 3300049582 Ga0501048_0017288 Ga0501048_0017288_3480_4685 396
173 3300049653 Ga0501206_005550 Ga0501206_005550_30_1235 396
174 3300049665 Ga0501227_005993 Ga0501227_005993_479_1687 396
175 3300049686 Ga0501257_012538 Ga0501257_012538_380_1585 396
176 3300049706 Ga0501229_000514 Ga0501229_000514_2652_3860 396
177 3300049764 Ga0501267_000661 Ga0501267_000661_1285_2493 396
178 3300049777 Ga0501281_01403 Ga0501281_01403_565_1770 396
179 3300049824 Ga0501045_0013616 Ga0501045_0013616_3743_4948 396
180 3300050493 nmdc:mga0k408_145698_c1 nmdc:mga0k408_145698_c1_61_1266 396
181 3300050493 nmdc:mga0k408_62506_c1 nmdc:mga0k408_62506_c1_797_2002 396
182 3300050493 nmdc:mga0k408_88319_c1 nmdc:mga0k408_88319_c1_467_1672 396
183 3300050496 nmdc:mga07m45_212_c1 nmdc:mga07m45_212_c1_10034_11242 396
184 3300053093 Ga0500651_0003737 Ga0500651_0003737_5903_7108 396
185 3300053136 Ga0500559_0000446 Ga0500559_0000446_22766_23971 396
186 3300053154 Ga0500619_000205 Ga0500619_000205_7799_9004 396
187 3300053156 Ga0500622_0000111 Ga0500622_0000111_77428_78633 396
188 3300053730 Ga0500645_002750 Ga0500645_002750_4734_5939 396
189 3300003794 Ga0055531_10000001 Ga0055531_10000001109 397
190 3300006846 Ga0075430_100094253 Ga0075430_1000942532 397
191 3300006880 Ga0075429_100024893 Ga0075429_1000248932 397
192 3300025298 Ga0209050_1001867 Ga0209050_100186711 397
193 3300025303 Ga0209051_1012471 Ga0209051_10124713 397
194 3300025304 Ga0209257_1000033 Ga0209257_1000033196 397
195 3300025304 Ga0209257_1017781 Ga0209257_10177813 397
196 3300025933 Ga0207706_10003954 Ga0207706_1000395412 397
197 3300028794 Ga0307515_10027638 Ga0307515_100276385 397
198 3300031548 Ga0307408_100240916 Ga0307408_1002409162 397
199 3300037418 Ga0395900_0000879 Ga0395900_0000879_37812_39020 397
200 3300037466 Ga0395898_0001863 Ga0395898_0001863_124_1332 397
201 3300039437 Ga0436365_1211877 Ga0436365_1211877_1206_2420 397
202 3300041997 Ga0439431_0013172 Ga0439431_0013172_398_1606 397
203 3300044658 Ga0466972_0001998 Ga0466972_0001998_6303_7511 397
204 3300044658 Ga0466972_0003796 Ga0466972_0003796_1926_3134 397
205 3300050508 nmdc:mga09592_21996_c1 nmdc:mga09592_21996_c1_3382_4590 397
206 3300050509 nmdc:mga0qj67_62492_c1 nmdc:mga0qj67_62492_c1_1160_2368 397
207 3300053148 Ga0500590_034871 Ga0500590_034871_966_2174 397
208 3300028794 Ga0307515_10008707 Ga0307515_1000870718 398
209 3300031730 Ga0307516_10001122 Ga0307516_1000112218 398
210 3300042000 Ga0439437_002217 Ga0439437_002217_372_1613 398
211 3300042130 Ga0450892_001171 Ga0450892_001171_255_1496 398
212 3300042144 Ga0450889_000511 Ga0450889_000511_2731_3972 398
213 3300046539 Ga0495621_0016142 Ga0495621_0016142_952_2169 398
214 3300049649 Ga0501198_000019 Ga0501198_000019_49072_50289 398
215 3300049662 Ga0501222_000059 Ga0501222_000059_737_1954 398
216 3300025927 Ga0207687_10252492 Ga0207687_102524922 399
217 3300037471 Ga0395905_0232761 Ga0395905_0232761_413_1633 399
218 3300044656 Ga0466969_0000080 Ga0466969_0000080_16554_17774 399
219 iso_pu_bacteria 2585428057 2587725208 399
220 iso_pu_bacteria 2585428058 2587731436 399
221 iso_pu_bacteria 2588253510 2588294144 399
222 iso_pu_bacteria 2643221592 2643972908 399
223 iso_pu_bacteria 2643221625 2644139727 399
224 iso_pu_bacteria 2643221648 2644274518 399
225 iso_pu_bacteria 2894023352 2894024260 399
226 3300037471 Ga0395905_0003362 Ga0395905_0003362_12334_13554 401
227 3300049568 Ga0501031_0004445 Ga0501031_0004445_1559_2785 401
228 3300025303 Ga0209051_1001319 Ga0209051_10013198 402
229 3300003215 JGI25153J46596_10030419 JGI25153J46596_100304191 403
230 3300005327 Ga0070658_10021320 Ga0070658_100213201 403
231 3300005327 Ga0070658_10157109 Ga0070658_101571091 403
232 3300005329 Ga0070683_100011245 Ga0070683_1000112456 403
233 3300005330 Ga0070690_100048445 Ga0070690_1000484452 403
234 3300005330 Ga0070690_100104880 Ga0070690_1001048802 403
235 3300005331 Ga0070670_100009121 Ga0070670_1000091215 403
236 3300005331 Ga0070670_100063425 Ga0070670_1000634254 403
237 3300005334 Ga0068869_100046654 Ga0068869_1000466544 403
238 3300005335 Ga0070666_10029211 Ga0070666_100292112 403
239 3300005335 Ga0070666_10092092 Ga0070666_100920922 403
240 3300005336 Ga0070680_100029336 Ga0070680_1000293363 403
241 3300005338 Ga0068868_100018166 Ga0068868_1000181666 403
242 3300005339 Ga0070660_100036699 Ga0070660_1000366992 403
243 3300005344 Ga0070661_100010658 Ga0070661_1000106583 403
244 3300005347 Ga0070668_100053786 Ga0070668_1000537864 403
245 3300005353 Ga0070669_100002367 Ga0070669_1000023676 403
246 3300005354 Ga0070675_100003251 Ga0070675_1000032516 403
247 3300005354 Ga0070675_100003640 Ga0070675_10000364013 403
248 3300005354 Ga0070675_100039895 Ga0070675_1000398952 403
249 3300005354 Ga0070675_100111967 Ga0070675_1001119672 403
250 3300005355 Ga0070671_100071072 Ga0070671_1000710724 403
251 3300005355 Ga0070671_100075979 Ga0070671_1000759793 403
252 3300005364 Ga0070673_100003414 Ga0070673_1000034144 403
253 3300005364 Ga0070673_100031844 Ga0070673_1000318443 403
254 3300005364 Ga0070673_100075664 Ga0070673_1000756642 403
255 3300005366 Ga0070659_100030937 Ga0070659_1000309372 403
256 3300005367 Ga0070667_100006347 Ga0070667_10000634712 403
257 3300005367 Ga0070667_100048274 Ga0070667_1000482743 403
258 3300005445 Ga0070708_100319001 Ga0070708_1003190011 403
259 3300005456 Ga0070678_100085730 Ga0070678_1000857302 403
260 3300005456 Ga0070678_100096638 Ga0070678_1000966382 403
261 3300005456 Ga0070678_100128097 Ga0070678_1001280972 403
262 3300005456 Ga0070678_100231282 Ga0070678_1002312821 403
263 3300005457 Ga0070662_100006522 Ga0070662_1000065221 403
264 3300005457 Ga0070662_100038414 Ga0070662_1000384143 403
265 3300005457 Ga0070662_100224104 Ga0070662_1002241042 403
266 3300005535 Ga0070684_100170516 Ga0070684_1001705161 403
267 3300005539 Ga0068853_100019899 Ga0068853_1000198995 403
268 3300005543 Ga0070672_100014575 Ga0070672_1000145756 403
269 3300005543 Ga0070672_100014963 Ga0070672_1000149632 403
270 3300005543 Ga0070672_100026270 Ga0070672_1000262701 403
271 3300005543 Ga0070672_100030631 Ga0070672_1000306315 403
272 3300005543 Ga0070672_100096315 Ga0070672_1000963151 403
273 3300005563 Ga0068855_100154931 Ga0068855_1001549312 403
274 3300005564 Ga0070664_100015765 Ga0070664_1000157655 403
275 3300005564 Ga0070664_100131960 Ga0070664_1001319601 403
276 3300005577 Ga0068857_100068862 Ga0068857_1000688623 403
277 3300005578 Ga0068854_100020370 Ga0068854_1000203701 403
278 3300005578 Ga0068854_100152823 Ga0068854_1001528232 403
279 3300005614 Ga0068856_100012973 Ga0068856_1000129732 403
280 3300005616 Ga0068852_100004800 Ga0068852_1000048003 403
281 3300005616 Ga0068852_100006288 Ga0068852_1000062881 403
282 3300005616 Ga0068852_100076323 Ga0068852_1000763231 403
283 3300005616 Ga0068852_100120323 Ga0068852_1001203233 403
284 3300005617 Ga0068859_100020923 Ga0068859_1000209235 403
285 3300005618 Ga0068864_100002240 Ga0068864_1000022407 403
286 3300005618 Ga0068864_100003831 Ga0068864_1000038316 403
287 3300005618 Ga0068864_100076309 Ga0068864_1000763094 403
288 3300005618 Ga0068864_100165588 Ga0068864_1001655881 403
289 3300005834 Ga0068851_10030385 Ga0068851_100303852 403
290 3300005841 Ga0068863_100009320 Ga0068863_1000093208 403
291 3300005841 Ga0068863_100049632 Ga0068863_1000496321 403
292 3300005841 Ga0068863_100073507 Ga0068863_1000735072 403
293 3300005842 Ga0068858_100003858 Ga0068858_1000038582 403
294 3300005842 Ga0068858_100013579 Ga0068858_1000135793 403
295 3300005842 Ga0068858_100015449 Ga0068858_1000154497 403
296 3300005843 Ga0068860_100009677 Ga0068860_1000096777 403
297 3300005843 Ga0068860_100010520 Ga0068860_1000105208 403
298 3300005843 Ga0068860_100171227 Ga0068860_1001712271 403
299 3300005844 Ga0068862_100007872 Ga0068862_10000787210 403
300 3300006051 Ga0075364_10072880 Ga0075364_100728801 403
301 3300006195 Ga0075366_10016063 Ga0075366_100160632 403
302 3300006237 Ga0097621_100022325 Ga0097621_1000223253 403
303 3300006353 Ga0075370_10107703 Ga0075370_101077032 403
304 3300006931 Ga0097620_100020923 Ga0097620_1000209234 403
305 3300009148 Ga0105243_10190419 Ga0105243_101904191 403
306 3300009148 Ga0105243_10192236 Ga0105243_101922362 403
307 3300009176 Ga0105242_10089559 Ga0105242_100895593 403
308 3300009177 Ga0105248_10110227 Ga0105248_101102274 403
309 3300009553 Ga0105249_10044205 Ga0105249_100442054 403
310 3300010375 Ga0105239_10197450 Ga0105239_101974502 403
311 3300013105 Ga0157369_10005006 Ga0157369_1000500612 403
312 3300013306 Ga0163162_10067305 Ga0163162_100673051 403
313 3300013307 Ga0157372_10017438 Ga0157372_100174389 403
314 3300013308 Ga0157375_10007068 Ga0157375_1000706812 403
315 3300013308 Ga0157375_10044164 Ga0157375_100441644 403
316 3300013308 Ga0157375_10065314 Ga0157375_100653145 403
317 3300014326 Ga0157380_10004143 Ga0157380_1000414312 403
318 3300014326 Ga0157380_10305327 Ga0157380_103053271 403
319 3300014968 Ga0157379_10003267 Ga0157379_1000326715 403
320 3300014968 Ga0157379_10043502 Ga0157379_100435024 403
321 3300017792 Ga0163161_10019424 Ga0163161_100194241 403
322 3300025297 Ga0209758_1000358 Ga0209758_100035822 403
323 3300025298 Ga0209050_1000873 Ga0209050_100087323 403
324 3300025315 Ga0207697_10018459 Ga0207697_100184593 403
325 3300025893 Ga0207682_10003512 Ga0207682_100035125 403
326 3300025899 Ga0207642_10002152 Ga0207642_100021523 403
327 3300025899 Ga0207642_10057936 Ga0207642_100579361 403
328 3300025903 Ga0207680_10020291 Ga0207680_100202914 403
329 3300025907 Ga0207645_10004840 Ga0207645_1000484012 403
330 3300025909 Ga0207705_10033979 Ga0207705_100339792 403
331 3300025918 Ga0207662_10003252 Ga0207662_100032525 403
332 3300025919 Ga0207657_10050511 Ga0207657_100505111 403
333 3300025920 Ga0207649_10005548 Ga0207649_100055487 403
334 3300025921 Ga0207652_10014128 Ga0207652_100141284 403
335 3300025924 Ga0207694_10028123 Ga0207694_100281234 403
336 3300025925 Ga0207650_10003433 Ga0207650_100034339 403
337 3300025925 Ga0207650_10099644 Ga0207650_100996443 403
338 3300025926 Ga0207659_10010007 Ga0207659_100100071 403
339 3300025926 Ga0207659_10064458 Ga0207659_100644581 403
340 3300025927 Ga0207687_10072823 Ga0207687_100728231 403
341 3300025931 Ga0207644_10007832 Ga0207644_100078326 403
342 3300025932 Ga0207690_10022955 Ga0207690_100229554 403
343 3300025933 Ga0207706_10026008 Ga0207706_100260081 403
344 3300025933 Ga0207706_10041139 Ga0207706_100411392 403
345 3300025933 Ga0207706_10171440 Ga0207706_101714401 403
346 3300025938 Ga0207704_10038465 Ga0207704_100384652 403
347 3300025938 Ga0207704_10139382 Ga0207704_101393821 403
348 3300025940 Ga0207691_10038504 Ga0207691_100385045 403
349 3300025940 Ga0207691_10059310 Ga0207691_100593101 403
350 3300025940 Ga0207691_10071711 Ga0207691_100717114 403
351 3300025940 Ga0207691_10159584 Ga0207691_101595842 403
352 3300025940 Ga0207691_10179617 Ga0207691_101796172 403
353 3300025941 Ga0207711_10207954 Ga0207711_102079541 403
354 3300025942 Ga0207689_10005387 Ga0207689_100053874 403
355 3300025944 Ga0207661_10056370 Ga0207661_100563704 403
356 3300025945 Ga0207679_10018055 Ga0207679_100180554 403
357 3300025960 Ga0207651_10023944 Ga0207651_100239443 403
358 3300025960 Ga0207651_10066908 Ga0207651_100669082 403
359 3300025961 Ga0207712_10003299 Ga0207712_1000329910 403
360 3300025972 Ga0207668_10007352 Ga0207668_100073521 403
361 3300025972 Ga0207668_10151197 Ga0207668_101511971 403
362 3300025981 Ga0207640_10027449 Ga0207640_100274494 403
363 3300025986 Ga0207658_10001534 Ga0207658_1000153415 403
364 3300026023 Ga0207677_10030925 Ga0207677_100309254 403
365 3300026023 Ga0207677_10056389 Ga0207677_100563893 403
366 3300026023 Ga0207677_10194560 Ga0207677_101945601 403
367 3300026035 Ga0207703_10001859 Ga0207703_1000185912 403
368 3300026035 Ga0207703_10008117 Ga0207703_100081179 403
369 3300026035 Ga0207703_10016847 Ga0207703_100168476 403
370 3300026041 Ga0207639_10058528 Ga0207639_100585282 403
371 3300026067 Ga0207678_10063327 Ga0207678_100633271 403
372 3300026088 Ga0207641_10002724 Ga0207641_100027246 403
373 3300026088 Ga0207641_10061294 Ga0207641_100612941 403
374 3300026088 Ga0207641_10185212 Ga0207641_101852122 403
375 3300026089 Ga0207648_10026969 Ga0207648_100269693 403
376 3300026089 Ga0207648_10092740 Ga0207648_100927403 403
377 3300026095 Ga0207676_10026669 Ga0207676_100266692 403
378 3300026095 Ga0207676_10044955 Ga0207676_100449553 403
379 3300026095 Ga0207676_10128050 Ga0207676_101280502 403
380 3300026095 Ga0207676_10251656 Ga0207676_102516561 403
381 3300026116 Ga0207674_10012770 Ga0207674_100127704 403
382 3300026118 Ga0207675_100001372 Ga0207675_1000013728 403
383 3300026118 Ga0207675_100045497 Ga0207675_1000454975 403
384 3300026121 Ga0207683_10011145 Ga0207683_100111455 403
385 3300026121 Ga0207683_10030363 Ga0207683_100303634 403
386 3300028380 Ga0268265_10004979 Ga0268265_100049791 403
387 3300028381 Ga0268264_10012729 Ga0268264_100127297 403
388 3300028381 Ga0268264_10026002 Ga0268264_100260025 403
389 3300031901 Ga0307406_10027875 Ga0307406_100278754 403
390 3300032005 Ga0307411_10073121 Ga0307411_100731213 403
391 3300032126 Ga0307415_100003116 Ga0307415_1000031166 403
392 3300035086 Ga0373934_0055528 Ga0373934_0055528_239_1486 403
393 3300035121 Ga0373960_0018354 Ga0373960_0018354_254_1486 403
394 3300035170 Ga0373943_0138570 Ga0373943_0138570_11_1258 403
395 3300037068 Ga0373925_0072442 Ga0373925_0072442_179_1414 403
396 3300042439 Ga0439464_0008961 Ga0439464_0008961_372_1607 403
397 3300046459 Ga0495629_0027006 Ga0495629_0027006_1085_2332 403
398 3300046515 Ga0495620_0061941 Ga0495620_0061941_22_1248 403
399 3300046519 Ga0495632_0003426 Ga0495632_0003426_2277_3503 403
400 3300046648 Ga0495611_0024802 Ga0495611_0024802_151_1383 403
401 3300046660 Ga0495625_0138031 Ga0495625_0138031_251_1483 403
402 3300046683 Ga0495658_0087175 Ga0495658_0087175_220_1455 403
403 3300046683 Ga0495658_0131764 Ga0495658_0131764_202_1449 403
404 3300046694 Ga0495649_0011008 Ga0495649_0011008_363_1598 403
405 3300047322 Ga0495680_0100660 Ga0495680_0100660_45_1292 403
406 3300047443 Ga0495687_004841 Ga0495687_004841_7208_8443 403
407 3300047443 Ga0495687_041483 Ga0495687_041483_388_1623 403
408 3300047471 Ga0495684_0211105 Ga0495684_0211105_86_1333 403
409 3300048908 Ga0496105_0086240 Ga0496105_0086240_20_1255 403
410 3300048913 Ga0496110_0046498 Ga0496110_0046498_1206_2438 403
411 3300048914 Ga0496111_0140764 Ga0496111_0140764_24_1256 403
412 3300048916 Ga0496113_0048359 Ga0496113_0048359_179_1411 403
413 3300048917 Ga0496114_0098319 Ga0496114_0098319_129_1364 403
414 3300050489 nmdc:mga03683_49026_c1 nmdc:mga03683_49026_c1_128_1363 403
415 3300050489 nmdc:mga03683_7564_c1 nmdc:mga03683_7564_c1_725_1957 403
416 3300050490 nmdc:mga03n38_17237_c1 nmdc:mga03n38_17237_c1_603_1835 403
417 3300050493 nmdc:mga0k408_3352_c1 nmdc:mga0k408_3352_c1_4027_5262 403
418 3300050496 nmdc:mga07m45_5711_c1 nmdc:mga07m45_5711_c1_217_1452 403
419 3300050496 nmdc:mga07m45_821_c1 nmdc:mga07m45_821_c1_7091_8323 403
420 3300050496 nmdc:mga07m45_9989_c1 nmdc:mga07m45_9989_c1_3133_4368 403
421 3300053077 Ga0495601_0024148 Ga0495601_0024148_1053_2300 403
422 3300053084 Ga0495595_0080244 Ga0495595_0080244_183_1430 403
423 3300053085 Ga0495619_0023748 Ga0495619_0023748_218_1459 403
424 3300053086 Ga0500578_0000712 Ga0500578_0000712_1436_2662 403
425 3300053093 Ga0500651_0083902 Ga0500651_0083902_317_1543 403
426 3300053129 Ga0500628_001000 Ga0500628_001000_3092_4318 403
427 3300053131 Ga0500652_000123 Ga0500652_000123_27841_29067 403
428 3300053134 Ga0500658_0038410 Ga0500658_0038410_388_1623 403
429 3300053139 Ga0500568_0002851 Ga0500568_0002851_2017_3243 403
430 3300053139 Ga0500568_0054192 Ga0500568_0054192_149_1381 403
431 3300053156 Ga0500622_0000147 Ga0500622_0000147_1395_2621 403
432 3300005328 Ga0070676_10070358 Ga0070676_100703582 405
433 3300005333 Ga0070677_10065220 Ga0070677_100652201 405
434 3300005334 Ga0068869_100012643 Ga0068869_1000126435 405
435 3300005338 Ga0068868_100002358 Ga0068868_10000235816 405
436 3300005347 Ga0070668_100015507 Ga0070668_1000155073 405
437 3300005354 Ga0070675_100047639 Ga0070675_1000476393 405
438 3300005455 Ga0070663_100103431 Ga0070663_1001034312 405
439 3300005457 Ga0070662_100006488 Ga0070662_1000064882 405
440 3300005457 Ga0070662_100028020 Ga0070662_1000280204 405
441 3300005459 Ga0068867_100065368 Ga0068867_1000653683 405
442 3300005577 Ga0068857_100062699 Ga0068857_1000626993 405
443 3300005578 Ga0068854_100063580 Ga0068854_1000635802 405
444 3300005618 Ga0068864_100026960 Ga0068864_1000269605 405
445 3300005719 Ga0068861_100001035 Ga0068861_1000010356 405
446 3300005834 Ga0068851_10006380 Ga0068851_100063804 405
447 3300005841 Ga0068863_100022793 Ga0068863_1000227936 405
448 3300005843 Ga0068860_100219140 Ga0068860_1002191401 405
449 3300006237 Ga0097621_100019992 Ga0097621_1000199924 405
450 3300006358 Ga0068871_100081594 Ga0068871_1000815943 405
451 3300009098 Ga0105245_10008776 Ga0105245_100087769 405
452 3300009177 Ga0105248_10003509 Ga0105248_100035097 405
453 3300013102 Ga0157371_10115036 Ga0157371_101150362 405
454 3300013296 Ga0157374_10021185 Ga0157374_100211853 405
455 3300013307 Ga0157372_10007733 Ga0157372_100077339 405
456 3300014745 Ga0157377_10000954 Ga0157377_1000095410 405
457 3300014968 Ga0157379_10002231 Ga0157379_1000223114 405
458 3300014969 Ga0157376_10003713 Ga0157376_1000371313 405
459 3300025321 Ga0207656_10010441 Ga0207656_100104413 405
460 3300025893 Ga0207682_10024597 Ga0207682_100245971 405
461 3300025901 Ga0207688_10043749 Ga0207688_100437493 405
462 3300025907 Ga0207645_10038443 Ga0207645_100384432 405
463 3300025926 Ga0207659_10027917 Ga0207659_100279173 405
464 3300025927 Ga0207687_10060244 Ga0207687_100602443 405
465 3300025932 Ga0207690_10113220 Ga0207690_101132201 405
466 3300025933 Ga0207706_10001701 Ga0207706_1000170117 405
467 3300025941 Ga0207711_10049902 Ga0207711_100499023 405
468 3300025942 Ga0207689_10001858 Ga0207689_100018587 405
469 3300025981 Ga0207640_10011321 Ga0207640_100113213 405
470 3300025986 Ga0207658_10099465 Ga0207658_100994653 405
471 3300026023 Ga0207677_10003376 Ga0207677_100033761 405
472 3300026035 Ga0207703_10028951 Ga0207703_100289511 405
473 3300026041 Ga0207639_10007190 Ga0207639_100071902 405
474 3300026041 Ga0207639_10009935 Ga0207639_100099355 405
475 3300026067 Ga0207678_10004374 Ga0207678_100043749 405
476 3300026089 Ga0207648_10088106 Ga0207648_100881063 405
477 3300026095 Ga0207676_10005560 Ga0207676_100055603 405
478 3300026116 Ga0207674_10076475 Ga0207674_100764753 405
479 3300026118 Ga0207675_100002097 Ga0207675_1000020976 405
480 3300026142 Ga0207698_10032308 Ga0207698_100323081 405
481 3300035691 Ga0373931_0031563 Ga0373931_0031563_1111_2382 405
482 3300045051 Ga0451576_0166531 Ga0451576_0166531_425_1696 405
483 3300048903 Ga0496100_0015594 Ga0496100_0015594_2465_3736 405
484 3300048905 Ga0496102_0097526 Ga0496102_0097526_401_1672 405
485 3300048907 Ga0496104_0214506 Ga0496104_0214506_188_1459 405
486 3300048909 Ga0496106_0003964 Ga0496106_0003964_9486_10757 405
487 3300048911 Ga0496108_0013851 Ga0496108_0013851_550_1821 405
488 3300048911 Ga0496108_0025598 Ga0496108_0025598_2822_4099 405
489 3300048912 Ga0496109_0054662 Ga0496109_0054662_1026_2303 405
490 3300048912 Ga0496109_0314118 Ga0496109_0314118_70_1341 405
491 3300048915 Ga0496112_0245041 Ga0496112_0245041_34_1305 405
492 3300050512 nmdc:mga0n895_388726_c1 nmdc:mga0n895_388726_c1_116_1387 405
493 3300005334 Ga0068869_100024391 Ga0068869_1000243911 408
494 3300005354 Ga0070675_100014473 Ga0070675_1000144734 408
495 3300005364 Ga0070673_100011156 Ga0070673_1000111562 408
496 3300005367 Ga0070667_100039414 Ga0070667_1000394142 408
497 3300005456 Ga0070678_100040759 Ga0070678_1000407593 408
498 3300005459 Ga0068867_100012355 Ga0068867_1000123555 408
499 3300028794 Ga0307515_10016574 Ga0307515_100165748 408
500 3300025940 Ga0207691_10042669 Ga0207691_100426692 409
501 3300025972 Ga0207668_10064371 Ga0207668_100643711 409
502 3300026142 Ga0207698_10014121 Ga0207698_100141212 409
503 3300027526 Ga0209968_1003621 Ga0209968_10036212 410
504 3300027695 Ga0209966_1000118 Ga0209966_100011831 410
505 3300050493 nmdc:mga0k408_85417_c1 nmdc:mga0k408_85417_c1_426_1703 413
506 3300003215 JGI25153J46596_10001729 JGI25153J46596_1000172912 415
507 3300003771 Ga0055526_1003022 Ga0055526_10030229 415
508 3300013308 Ga0157375_10327630 Ga0157375_103276301 415
509 3300014325 Ga0163163_10030904 Ga0163163_100309042 415
510 3300014969 Ga0157376_10015915 Ga0157376_100159155 415
511 3300025245 Ga0207425_1000121 Ga0207425_100012118 415
512 3300025258 Ga0209129_1000012 Ga0209129_1000012294 415
513 3300025295 Ga0209564_1000022 Ga0209564_1000022220 415
514 3300025297 Ga0209758_1000099 Ga0209758_100009929 415
515 3300025321 Ga0207656_10021309 Ga0207656_100213092 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

106

282

0.91

PF07690

MFS_1

Major Facilitator Superfamily

92

437

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.9072 28 403
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.9005 22 403
6oom-assembly2.cif.gz_A-2 protein a 0.893 21 403
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.883 28 403
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8789 22 403
ID Description Score Start End Superfamily
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9165 26 212 1.20.1250.20
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9111 29 401 1.20.1720.10
af_B6T9A5_7_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9082 25 208 1.20.1250.20
af_K7ML12_100_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9075 25 201 1.20.1250.20
af_Q7XKJ7_33_226_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9042 28 203 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I0B2L0-F1-model_v4 Bcr/CflA family efflux transporter 0.9424 25 410 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A370CMU4-F1-model_v4 deleted 0.9389 29 405
AF-A0A1Y1R0S4-F1-model_v4 Bcr/CflA family efflux transporter 0.937 26 279 GO:0005886
GO:0042910
GO:1990961
AF-A0A4Q9KLR0-F1-model_v4 Bcr/CflA family efflux MFS transporter 0.9362 22 415 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A2A4P6I6-F1-model_v4 Bcr/CflA family efflux transporter 0.9343 20 410 GO:0005886
GO:0042910
GO:1990961

Feature Viewer

pLDDT pTM Quality
88.32 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map