F457721

General Info

Members Datasets Scaffolds Average Seq Length
514 204 1028 259

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000266|Ga0213875_1000026634
Length 253
Sequence MPVYGRFLINNLSQYAEIEGDTAHFIGNLFESPQRTGQSAPVADLKILSPVAPSKLFAIGLNYVDHAKESGKPVPEVPLMWFKAPSAIIAQGEAVEVAYPEHRTDYEGELTIVIGKRCKGASEANATSYIFGYTIGQDISDRDIQNSESQWARAKSFDTYAPLGPFIYTDIDPADLPVETRLNGEVRQQSSTKQLVFSPAQLIAFLSESITLEPGDCIMTGTPFGVGPVKAGDTIETRIGSMQPLITPVRGRS

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.39
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 26.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000266 3300021388 Bacteria 51562
2 CNXas_1000006 3300000545 Bacteria 45010
3 JGI25406J46586_10000002 3300003203 Bacteria 202415
4 JGI25405J52794_10000108 3300003911 Bacteria 9499
5 JGI25405J52794_10030556 3300003911 Bacteria 1117
6 Ga0065704_10011507 3300005289 Unclassified 2224
7 Ga0065712_10002212 3300005290 Bacteria 6192
8 Ga0065712_10005915 3300005290 Bacteria 6437
9 Ga0065712_10194631 3300005290 Unclassified 1133
10 Ga0065715_10001654 3300005293 Bacteria 6469
11 Ga0065715_10021002 3300005293 Bacteria 3177
12 Ga0065715_10154501 3300005293 Bacteria 1692
13 Ga0065715_10183655 3300005293 Bacteria 1459
14 Ga0065707_10238369 3300005295 Bacteria 1164
15 Ga0070676_10003636 3300005328 Bacteria 8065
16 Ga0070683_100001630 3300005329 Bacteria 17370
17 Ga0070683_100077573 3300005329 Bacteria 3107
18 Ga0070683_100082748 3300005329 Bacteria 3006
19 Ga0070690_100006260 3300005330 Bacteria 6749
20 Ga0070690_100011521 3300005330 Bacteria 5174
21 Ga0070690_100036368 3300005330 Unclassified 3094
22 Ga0070670_100015828 3300005331 Bacteria 6472
23 Ga0070670_100023748 3300005331 Bacteria 5277
24 Ga0070670_100072563 3300005331 Unclassified 2956
25 Ga0070670_100193929 3300005331 Bacteria 1765
26 Ga0070670_100196211 3300005331 Bacteria 1754
27 Ga0070677_10140284 3300005333 Unclassified 1114
28 Ga0070666_10003392 3300005335 Bacteria 9654
29 Ga0070666_10018705 3300005335 Unclassified 4460
30 Ga0070666_10033398 3300005335 Bacteria 3404
31 Ga0070666_10319446 3300005335 Bacteria 1107
32 Ga0070682_100243525 3300005337 Bacteria 1292
33 Ga0068868_100068068 3300005338 Bacteria 2834
34 Ga0068868_100116289 3300005338 Bacteria 2178
35 Ga0068868_100125720 3300005338 Bacteria 2094
36 Ga0068868_100218564 3300005338 Bacteria 1594
37 Ga0068868_100236724 3300005338 Bacteria 1533
38 Ga0068868_100544784 3300005338 Unclassified 1022
39 Ga0070660_100450618 3300005339 Bacteria 1067
40 Ga0070689_100114871 3300005340 Bacteria 2145
41 Ga0070689_100459029 3300005340 Unclassified 1085
42 Ga0070687_100040476 3300005343 Bacteria 2348
43 Ga0070687_100175155 3300005343 Bacteria 1280
44 Ga0070687_100331500 3300005343 Bacteria 976
45 Ga0070661_100115533 3300005344 Bacteria 2007
46 Ga0070668_100010994 3300005347 Bacteria 6738
47 Ga0070668_100018383 3300005347 Bacteria 5248
48 Ga0070668_100190642 3300005347 Bacteria 1679
49 Ga0070669_100000734 3300005353 Bacteria 23917
50 Ga0070669_100046190 3300005353 Unclassified 3175
51 Ga0070669_100087823 3300005353 Unclassified 2326
52 Ga0070669_100245422 3300005353 Bacteria 1424
53 Ga0070675_100006907 3300005354 Bacteria 8716
54 Ga0070675_100016903 3300005354 Bacteria 5794
55 Ga0070675_100036310 3300005354 Bacteria 4009
56 Ga0070675_100092558 3300005354 Bacteria 2534
57 Ga0070675_100120999 3300005354 Unclassified 2224
58 Ga0070675_100423235 3300005354 Bacteria 1191
59 Ga0070671_100010527 3300005355 Bacteria 7425
60 Ga0070671_100040942 3300005355 Bacteria 3850
61 Ga0070671_100067807 3300005355 Bacteria 2975
62 Ga0070671_100127982 3300005355 Bacteria 2138
63 Ga0070671_100207537 3300005355 Bacteria 1661
64 Ga0070671_100224625 3300005355 Bacteria 1593
65 Ga0070671_100283138 3300005355 Bacteria 1410
66 Ga0070674_100026425 3300005356 Bacteria 3792
67 Ga0070674_100110388 3300005356 Bacteria 2018
68 Ga0070673_100026393 3300005364 Unclassified 4289
69 Ga0070673_100060960 3300005364 Bacteria 2991
70 Ga0070673_100444288 3300005364 Unclassified 1166
71 Ga0070688_100286702 3300005365 Unclassified 1185
72 Ga0070659_100045663 3300005366 Bacteria 3432
73 Ga0070659_100081946 3300005366 Bacteria 2577
74 Ga0070667_100021174 3300005367 Bacteria 5402
75 Ga0070667_100064971 3300005367 Unclassified 3097
76 Ga0070667_100126914 3300005367 Bacteria 2223
77 Ga0070703_10049927 3300005406 Bacteria 1334
78 Ga0070714_100087928 3300005435 Unclassified 2718
79 Ga0070713_100101122 3300005436 Unclassified 2497
80 Ga0070713_100166623 3300005436 Unclassified 1970
81 Ga0070713_100201790 3300005436 Bacteria 1796
82 Ga0070710_10053734 3300005437 Bacteria 2270
83 Ga0070710_10108458 3300005437 Bacteria 1664
84 Ga0070710_10179814 3300005437 Unclassified 1323
85 Ga0070710_10214909 3300005437 Unclassified 1220
86 Ga0070711_100027967 3300005439 Bacteria 3706
87 Ga0070711_100101521 3300005439 Unclassified 2093
88 Ga0070711_100203081 3300005439 Unclassified 1531
89 Ga0070711_100335466 3300005439 Bacteria 1212
90 Ga0070705_100061372 3300005440 Bacteria 2234
91 Ga0070705_100214226 3300005440 Bacteria 1330
92 Ga0070694_100049076 3300005444 Bacteria 2841
93 Ga0070708_100020966 3300005445 Bacteria 5519
94 Ga0070708_100021927 3300005445 Bacteria 5412
95 Ga0070708_100027395 3300005445 Bacteria 4889
96 Ga0070708_100413753 3300005445 Bacteria 1271
97 Ga0070663_100026660 3300005455 Bacteria 3916
98 Ga0070663_100452869 3300005455 Bacteria 1058
99 Ga0070678_100001802 3300005456 Bacteria 11542
100 Ga0070678_100036708 3300005456 Bacteria 3433
101 Ga0070678_100120138 3300005456 Unclassified 2071
102 Ga0070662_100196241 3300005457 Bacteria 1599
103 Ga0070662_100371276 3300005457 Unclassified 1176
104 Ga0070681_10040483 3300005458 Unclassified 4668
105 Ga0068867_100137221 3300005459 Bacteria 1908
106 Ga0068867_100438135 3300005459 Unclassified 1111
107 Ga0070685_10010454 3300005466 Bacteria 4825
108 Ga0070685_10037763 3300005466 Unclassified 2737
109 Ga0070706_100000286 3300005467 Bacteria 61351
110 Ga0070706_100003298 3300005467 Bacteria 15966
111 Ga0070706_100028843 3300005467 Bacteria 5112
112 Ga0070706_100039993 3300005467 Bacteria 4328
113 Ga0070706_100052279 3300005467 Unclassified 3771
114 Ga0070706_100072600 3300005467 Unclassified 3184
115 Ga0070706_100209255 3300005467 Bacteria 1821
116 Ga0070706_100717741 3300005467 Bacteria 927
117 Ga0070707_100002233 3300005468 Bacteria 18498
118 Ga0070707_100028825 3300005468 Bacteria 5283
119 Ga0070707_100046768 3300005468 Bacteria 4141
120 Ga0070707_100063710 3300005468 Bacteria 3538
121 Ga0070707_100070052 3300005468 Unclassified 3378
122 Ga0070707_100076752 3300005468 Unclassified 3223
123 Ga0070707_100091255 3300005468 Unclassified 2949
124 Ga0070707_100417251 3300005468 Bacteria 1303
125 Ga0070698_100001957 3300005471 Bacteria 22869
126 Ga0070698_100008544 3300005471 Bacteria 11051
127 Ga0070698_100130467 3300005471 Bacteria 2469
128 Ga0070698_100247886 3300005471 Bacteria 1714
129 Ga0070698_100374770 3300005471 Bacteria 1356
130 Ga0070698_100454786 3300005471 Unclassified 1216
131 Ga0070699_100047544 3300005518 Bacteria 3712
132 Ga0070699_100397555 3300005518 Bacteria 1246
133 Ga0070679_100133174 3300005530 Bacteria 2467
134 Ga0070684_100101223 3300005535 Bacteria 2574
135 Ga0070684_100256588 3300005535 Bacteria 1599
136 Ga0070697_100004942 3300005536 Bacteria 10234
137 Ga0070697_100033677 3300005536 Unclassified 4127
138 Ga0070697_100078108 3300005536 Bacteria 2723
139 Ga0070697_100108938 3300005536 Bacteria 2306
140 Ga0070697_100124078 3300005536 Bacteria 2162
141 Ga0070697_100135903 3300005536 Bacteria 2065
142 Ga0070697_100173232 3300005536 Archaea 1827
143 Ga0070697_100354890 3300005536 Bacteria 1267
144 Ga0070672_100004759 3300005543 Bacteria 8906
145 Ga0070672_100083156 3300005543 Bacteria 2569
146 Ga0070686_100050667 3300005544 Bacteria 2640
147 Ga0070686_100054361 3300005544 Bacteria 2561
148 Ga0070695_100110662 3300005545 Bacteria 1863
149 Ga0070693_100176580 3300005547 Bacteria 1372
150 Ga0070665_100014886 3300005548 Bacteria 7807
151 Ga0070665_100020993 3300005548 Bacteria 6565
152 Ga0070665_100237923 3300005548 Bacteria 1821
153 Ga0070665_100396071 3300005548 Bacteria 1389
154 Ga0070704_100004877 3300005549 Bacteria 7779
155 Ga0070664_100023757 3300005564 Bacteria 5063
156 Ga0070664_100379192 3300005564 Unclassified 1290
157 Ga0068856_100004883 3300005614 Bacteria 13277
158 Ga0068856_100394934 3300005614 Bacteria 1403
159 Ga0068859_100053247 3300005617 Bacteria 4070
160 Ga0068866_10123759 3300005718 Bacteria 1461
161 Ga0068863_100016981 3300005841 Bacteria 6980
162 Ga0068858_100005855 3300005842 Bacteria 12010
163 Ga0068858_100188498 3300005842 Bacteria 1949
164 Ga0068860_100012337 3300005843 Bacteria 8420
165 Ga0068860_100034684 3300005843 Bacteria 4841
166 Ga0068862_100341706 3300005844 Bacteria 1386
167 Ga0081455_10001521 3300005937 Bacteria 28596
168 Ga0081455_10032183 3300005937 Bacteria 4730
169 Ga0081455_10034680 3300005937 Unclassified 4518
170 Ga0081455_10084086 3300005937 Bacteria 2598
171 Ga0081540_1008065 3300005983 Bacteria 7402
172 Ga0081540_1023222 3300005983 Bacteria 3635
173 Ga0081539_10000061 3300005985 Bacteria 250890
174 Ga0081539_10001104 3300005985 Bacteria 49011
175 Ga0081539_10009995 3300005985 Bacteria 7813
176 Ga0081539_10104255 3300005985 Bacteria 1440
177 Ga0081539_10185867 3300005985 Bacteria 971
178 Ga0070717_10010699 3300006028 Bacteria 6940
179 Ga0070717_10029096 3300006028 Bacteria 4429
180 Ga0070717_10069243 3300006028 Unclassified 2938
181 Ga0070717_10237715 3300006028 Bacteria 1605
182 Ga0070717_10316967 3300006028 Bacteria 1389
183 Ga0070717_10321777 3300006028 Bacteria 1378
184 Ga0070717_10645493 3300006028 Unclassified 961
185 Ga0070715_10039084 3300006163 Unclassified 1974
186 Ga0070715_10054787 3300006163 Bacteria 1728
187 Ga0070715_10196057 3300006163 Unclassified 1023
188 Ga0070716_100041892 3300006173 Unclassified 2553
189 Ga0070716_100066724 3300006173 Bacteria 2100
190 Ga0070716_100109074 3300006173 Unclassified 1712
191 Ga0070712_100010408 3300006175 Bacteria 5867
192 Ga0070712_100204328 3300006175 Unclassified 1554
193 Ga0070712_100205293 3300006175 Bacteria 1551
194 Ga0070712_100321822 3300006175 Bacteria 1258
195 Ga0097621_100007270 3300006237 Bacteria 7908
196 Ga0097621_100098976 3300006237 Bacteria 2451
197 Ga0097621_100415552 3300006237 Bacteria 1206
198 Ga0068871_100265400 3300006358 Bacteria 1499
199 Ga0068871_100420082 3300006358 Bacteria 1194
200 Ga0068871_100424047 3300006358 Unclassified 1188
201 Ga0075428_100120877 3300006844 Unclassified 2852
202 Ga0075428_100591633 3300006844 Bacteria 1185
203 Ga0075434_100433492 3300006871 Unclassified 1336
204 Ga0075434_100562662 3300006871 Unclassified 1160
205 Ga0075436_100035616 3300006914 Unclassified 3433
206 Ga0075436_100041595 3300006914 Bacteria 3171
207 Ga0075436_100117737 3300006914 Bacteria 1857
208 Ga0075436_100261649 3300006914 Unclassified 1234
209 Ga0097620_100053248 3300006931 Bacteria 4070
210 Ga0075435_100126406 3300007076 Bacteria 2137
211 Ga0075435_100363308 3300007076 Unclassified 1242
212 Ga0099795_10036567 3300007788 Bacteria 1724
213 Ga0105240_10437103 3300009093 Unclassified 1467
214 Ga0105245_10239523 3300009098 Bacteria 1758
215 Ga0114129_10281163 3300009147 Bacteria 2223
216 Ga0105243_10296161 3300009148 Bacteria 1464
217 Ga0105237_10087556 3300009545 Bacteria 3104
218 Ga0105237_10526048 3300009545 Unclassified 1189
219 Ga0105237_10774016 3300009545 Bacteria 966
220 Ga0105249_10002500 3300009553 Bacteria 15914
221 Ga0105249_10130527 3300009553 Bacteria 2398
222 Ga0105239_10150356 3300010375 Bacteria 2599
223 Ga0105246_10115261 3300011119 Bacteria 1981
224 Ga0157369_10807362 3300013105 Bacteria 964
225 Ga0157374_10017735 3300013296 Bacteria 6274
226 Ga0157374_10029161 3300013296 Bacteria 4993
227 Ga0157374_10048857 3300013296 Bacteria 3927
228 Ga0157374_10212923 3300013296 Bacteria 1895
229 Ga0157374_10252505 3300013296 Unclassified 1736
230 Ga0157374_10305634 3300013296 Unclassified 1574
231 Ga0157374_10577213 3300013296 Bacteria 1133
232 Ga0157378_10013277 3300013297 Bacteria 7202
233 Ga0157378_10019408 3300013297 Bacteria 5976
234 Ga0157378_10034167 3300013297 Unclassified 4497
235 Ga0157378_10065134 3300013297 Bacteria 3261
236 Ga0157378_10105303 3300013297 Bacteria 2579
237 Ga0157378_10130569 3300013297 Unclassified 2325
238 Ga0163162_10025675 3300013306 Bacteria 5824
239 Ga0163162_10251446 3300013306 Bacteria 1899
240 Ga0163162_10613919 3300013306 Unclassified 1213
241 Ga0157372_10018419 3300013307 Bacteria 7506
242 Ga0157372_10051672 3300013307 Bacteria 4574
243 Ga0157372_10387148 3300013307 Bacteria 1629
244 Ga0157372_10496787 3300013307 Bacteria 1423
245 Ga0157375_10024632 3300013308 Bacteria 5573
246 Ga0157375_10129102 3300013308 Bacteria 2646
247 Ga0157375_10235260 3300013308 Unclassified 1991
248 Ga0157375_10245923 3300013308 Unclassified 1949
249 Ga0157375_10248910 3300013308 Bacteria 1938
250 Ga0157375_10267060 3300013308 Bacteria 1873
251 Ga0157375_10469590 3300013308 Bacteria 1423
252 Ga0157375_11060992 3300013308 Unclassified 947
253 Ga0157379_10867178 3300014968 Unclassified 855
254 Ga0157376_10054400 3300014969 Bacteria 3336
255 Ga0157376_10059514 3300014969 Unclassified 3203
256 Ga0163161_10018151 3300017792 Unclassified 4932
257 Ga0163161_10221407 3300017792 Unclassified 1465
258 Ga0207666_1013851 3300025271 Bacteria 1135
259 Ga0207697_10000444 3300025315 Bacteria 23320
260 Ga0207697_10001023 3300025315 Bacteria 15666
261 Ga0207697_10002919 3300025315 Bacteria 8650
262 Ga0207697_10003392 3300025315 Bacteria 7911
263 Ga0207697_10003510 3300025315 Bacteria 7733
264 Ga0207697_10013574 3300025315 Bacteria 3398
265 Ga0207697_10017168 3300025315 Unclassified 2975
266 Ga0207682_10108678 3300025893 Bacteria 1219
267 Ga0207642_10149063 3300025899 Unclassified 1243
268 Ga0207688_10009933 3300025901 Bacteria 5178
269 Ga0207688_10027981 3300025901 Bacteria 3101
270 Ga0207688_10083073 3300025901 Unclassified 1831
271 Ga0207680_10032923 3300025903 Bacteria 2951
272 Ga0207680_10036945 3300025903 Bacteria 2816
273 Ga0207647_10003648 3300025904 Bacteria 11517
274 Ga0207699_10097003 3300025906 Unclassified 1862
275 Ga0207699_10228606 3300025906 Unclassified 1273
276 Ga0207645_10001285 3300025907 Bacteria 20617
277 Ga0207645_10021875 3300025907 Bacteria 4166
278 Ga0207645_10039615 3300025907 Bacteria 3019
279 Ga0207645_10047937 3300025907 Bacteria 2728
280 Ga0207645_10089651 3300025907 Bacteria 1978
281 Ga0207705_10288293 3300025909 Bacteria 1257
282 Ga0207684_10000361 3300025910 Bacteria 61371
283 Ga0207684_10003455 3300025910 Bacteria 15413
284 Ga0207684_10006037 3300025910 Bacteria 11085
285 Ga0207684_10009863 3300025910 Bacteria 8428
286 Ga0207684_10014196 3300025910 Bacteria 6876
287 Ga0207684_10028134 3300025910 Bacteria 4788
288 Ga0207684_10058349 3300025910 Bacteria 3275
289 Ga0207684_10324496 3300025910 Unclassified 1327
290 Ga0207684_10419546 3300025910 Unclassified 1150
291 Ga0207684_10534076 3300025910 Bacteria 1004
292 Ga0207707_10020471 3300025912 Bacteria 5777
293 Ga0207671_10309688 3300025914 Unclassified 1248
294 Ga0207693_10001355 3300025915 Bacteria 21674
295 Ga0207693_10047777 3300025915 Unclassified 3362
296 Ga0207693_10061203 3300025915 Bacteria 2949
297 Ga0207693_10084150 3300025915 Unclassified 2492
298 Ga0207693_10243185 3300025915 Bacteria 1413
299 Ga0207693_10349172 3300025915 Bacteria 1158
300 Ga0207663_10042524 3300025916 Bacteria 2776
301 Ga0207662_10000375 3300025918 Bacteria 20156
302 Ga0207662_10037014 3300025918 Bacteria 2855
303 Ga0207657_10029455 3300025919 Bacteria 4998
304 Ga0207657_10267373 3300025919 Bacteria 1360
305 Ga0207649_10080204 3300025920 Bacteria 2110
306 Ga0207649_10084246 3300025920 Bacteria 2066
307 Ga0207649_10160541 3300025920 Bacteria 1557
308 Ga0207652_10016896 3300025921 Bacteria 5966
309 Ga0207646_10000115 3300025922 Bacteria 110424
310 Ga0207646_10001435 3300025922 Bacteria 29563
311 Ga0207646_10024025 3300025922 Bacteria 5589
312 Ga0207646_10074488 3300025922 Unclassified 3033
313 Ga0207646_10121492 3300025922 Bacteria 2347
314 Ga0207646_10121576 3300025922 Unclassified 2346
315 Ga0207646_10146738 3300025922 Unclassified 2126
316 Ga0207646_10179643 3300025922 Bacteria 1911
317 Ga0207646_10244926 3300025922 Bacteria 1619
318 Ga0207646_10269059 3300025922 Bacteria 1540
319 Ga0207646_10339369 3300025922 Bacteria 1357
320 Ga0207646_10405751 3300025922 Bacteria 1230
321 Ga0207646_10496672 3300025922 Bacteria 1099
322 Ga0207681_10002979 3300025923 Bacteria 10645
323 Ga0207681_10078360 3300025923 Unclassified 2325
324 Ga0207681_10163092 3300025923 Unclassified 1682
325 Ga0207681_10307351 3300025923 Bacteria 1257
326 Ga0207681_10615188 3300025923 Unclassified 899
327 Ga0207650_10030769 3300025925 Bacteria 3870
328 Ga0207650_10159440 3300025925 Unclassified 1786
329 Ga0207659_10004448 3300025926 Bacteria 8483
330 Ga0207659_10023937 3300025926 Unclassified 4084
331 Ga0207659_10037817 3300025926 Unclassified 3353
332 Ga0207659_10080047 3300025926 Unclassified 2412
333 Ga0207659_10284541 3300025926 Unclassified 1353
334 Ga0207687_10094816 3300025927 Bacteria 2185
335 Ga0207700_10012378 3300025928 Bacteria 5500
336 Ga0207700_10478922 3300025928 Unclassified 1100
337 Ga0207664_10015216 3300025929 Bacteria 5578
338 Ga0207664_10091750 3300025929 Unclassified 2492
339 Ga0207664_10349617 3300025929 Unclassified 1308
340 Ga0207644_10020725 3300025931 Bacteria 4472
341 Ga0207644_10054515 3300025931 Bacteria 2880
342 Ga0207644_10375851 3300025931 Bacteria 1158
343 Ga0207690_10031003 3300025932 Bacteria 3417
344 Ga0207706_10002111 3300025933 Bacteria 19453
345 Ga0207706_10074916 3300025933 Unclassified 2976
346 Ga0207706_10218131 3300025933 Unclassified 1671
347 Ga0207706_10352449 3300025933 Bacteria 1280
348 Ga0207670_10157118 3300025936 Bacteria 1694
349 Ga0207670_10164529 3300025936 Bacteria 1659
350 Ga0207670_10314258 3300025936 Unclassified 1231
351 Ga0207669_10021591 3300025937 Bacteria 3402
352 Ga0207669_10222036 3300025937 Unclassified 1387
353 Ga0207704_10438131 3300025938 Bacteria 1040
354 Ga0207665_10045079 3300025939 Unclassified 2953
355 Ga0207665_10069215 3300025939 Unclassified 2406
356 Ga0207665_10120911 3300025939 Bacteria 1850
357 Ga0207665_10192894 3300025939 Unclassified 1481
358 Ga0207691_10001851 3300025940 Bacteria 20664
359 Ga0207691_10003807 3300025940 Bacteria 14644
360 Ga0207691_10018166 3300025940 Bacteria 6662
361 Ga0207691_10028546 3300025940 Bacteria 5223
362 Ga0207691_10076735 3300025940 Unclassified 3011
363 Ga0207689_10122978 3300025942 Bacteria 2134
364 Ga0207661_10193943 3300025944 Bacteria 1782
365 Ga0207661_10301503 3300025944 Bacteria 1436
366 Ga0207661_10695353 3300025944 Bacteria 935
367 Ga0207679_10140254 3300025945 Unclassified 1953
368 Ga0207679_10409370 3300025945 Unclassified 1194
369 Ga0207651_10006741 3300025960 Bacteria 6049
370 Ga0207651_10041859 3300025960 Unclassified 3044
371 Ga0207651_10110451 3300025960 Unclassified 2062
372 Ga0207712_10035750 3300025961 Bacteria 3378
373 Ga0207668_10002463 3300025972 Bacteria 10811
374 Ga0207668_10013858 3300025972 Bacteria 4978
375 Ga0207668_10076803 3300025972 Unclassified 2406
376 Ga0207668_10168819 3300025972 Bacteria 1714
377 Ga0207658_10172824 3300025986 Bacteria 1782
378 Ga0207677_10066307 3300026023 Bacteria 2523
379 Ga0207677_10384457 3300026023 Unclassified 1185
380 Ga0207677_10474744 3300026023 Unclassified 1076
381 Ga0207678_10007526 3300026067 Bacteria 9628
382 Ga0207678_10132043 3300026067 Bacteria 2131
383 Ga0207678_10331054 3300026067 Bacteria 1311
384 Ga0207702_10278281 3300026078 Bacteria 1581
385 Ga0207648_10165425 3300026089 Bacteria 1954
386 Ga0207648_10258383 3300026089 Bacteria 1554
387 Ga0207648_10289278 3300026089 Unclassified 1467
388 Ga0207675_100048593 3300026118 Bacteria 3960
389 Ga0207683_10004604 3300026121 Bacteria 11885
390 Ga0207683_10013143 3300026121 Bacteria 7063
391 Ga0207683_10114125 3300026121 Unclassified 2420
392 Ga0207683_10135837 3300026121 Unclassified 2214
393 Ga0207683_10600174 3300026121 Bacteria 1019
394 Ga0209998_10012296 3300027717 Bacteria 1777
395 Ga0209974_10071139 3300027876 Bacteria 1187
396 Ga0268266_10089603 3300028379 Bacteria 2694
397 Ga0268266_10148161 3300028379 Unclassified 2112
398 Ga0268266_10216775 3300028379 Bacteria 1757
399 Ga0268266_10218564 3300028379 Unclassified 1750
400 Ga0268266_10334701 3300028379 Bacteria 1420
401 Ga0268266_10594306 3300028379 Bacteria 1063
402 Ga0268265_10623361 3300028380 Viruses 1034
403 Ga0268264_10001797 3300028381 Bacteria 19617
404 Ga0268264_10014336 3300028381 Bacteria 6518
405 Ga0307513_10016611 3300031456 Bacteria 8870
406 Ga0373926_0116015 3300035083 Unclassified 1008
407 Ga0373944_0065863 3300035089 Bacteria 1171
408 Ga0373943_0014266 3300035170 Bacteria 3595
409 Ga0373955_0360205 3300035172 Bacteria 882
410 Ga0373931_0145600 3300035691 Bacteria 1377
411 Ga0373931_0164090 3300035691 Unclassified 1304
412 Ga0373935_0117147 3300035692 Unclassified 1775
413 Ga0373935_0415917 3300035692 Bacteria 967
414 Ga0373947_0024785 3300035725 Unclassified 3499
415 Ga0373947_0026549 3300035725 Bacteria 3387
416 Ga0373947_0263131 3300035725 Unclassified 1143
417 Ga0373937_0006068 3300036401 Bacteria 10401
418 Ga0373937_0047009 3300036401 Bacteria 3948
419 Ga0373937_0459977 3300036401 Bacteria 1209
420 Ga0373925_0043223 3300037068 Unclassified 3344
421 Ga0373925_0362853 3300037068 Bacteria 1178
422 Ga0395900_0007479 3300037418 Bacteria 11293
423 Ga0395900_0027545 3300037418 Bacteria 5822
424 Ga0395898_0013491 3300037466 Bacteria 8412
425 Ga0395898_0215123 3300037466 Bacteria 1833
426 Ga0395905_0008443 3300037471 Bacteria 10156
427 Ga0395905_0059620 3300037471 Unclassified 3568
428 Ga0436364_0156620 3300037853 Unclassified 1092
429 Ga0436364_0988623 3300037853 Bacteria 100417
430 Ga0436364_1329891 3300037853 Bacteria 3904
431 Ga0395901_0001270 3300038443 Bacteria 26753
432 Ga0395901_0028632 3300038443 Bacteria 5730
433 Ga0395901_0037856 3300038443 Bacteria 4988
434 Ga0439459_0018917 3300042438 Bacteria 1300
435 Ga0466964_0022998 3300044706 Unclassified 2421
436 Ga0495592_0003725 3300046454 Bacteria 10986
437 Ga0495592_0188831 3300046454 Bacteria 1398
438 Ga0495629_0127757 3300046459 Bacteria 1771
439 Ga0495582_0102686 3300046473 Bacteria 1602
440 Ga0495628_0026085 3300046516 Bacteria 4770
441 Ga0495628_0304101 3300046516 Unclassified 1180
442 Ga0495652_0021147 3300046529 Bacteria 5784
443 Ga0495652_0025291 3300046529 Bacteria 5254
444 Ga0495640_0029850 3300046533 Bacteria 3908
445 Ga0495586_0025898 3300046535 Bacteria 3138
446 Ga0495645_0004254 3300046543 Bacteria 9776
447 Ga0495599_0003768 3300046678 Bacteria 8902
448 Ga0495623_0022894 3300046679 Bacteria 4034
449 Ga0495647_0053165 3300046681 Bacteria 1579
450 Ga0495658_0156163 3300046683 Bacteria 1404
451 Ga0495658_0236711 3300046683 Unclassified 1146
452 Ga0495669_0026903 3300046684 Bacteria 2514
453 Ga0495669_0099365 3300046684 Unclassified 1350
454 Ga0495669_0229138 3300046684 Unclassified 891
455 Ga0495674_0084813 3300047319 Bacteria 2714
456 Ga0495674_0195989 3300047319 Unclassified 1677
457 Ga0495675_0008247 3300047444 Bacteria 6446
458 Ga0495675_0053858 3300047444 Bacteria 2553
459 Ga0495684_0069994 3300047471 Bacteria 2667
460 Ga0495602_0091787 3300048088 Unclassified 2517
461 Ga0496100_0009688 3300048903 Bacteria 5419
462 Ga0496100_0124012 3300048903 Bacteria 1811
463 Ga0496101_0015438 3300048904 Bacteria 5148
464 Ga0496101_0236123 3300048904 Bacteria 1422
465 Ga0496102_0002637 3300048905 Bacteria 15241
466 Ga0496103_0122504 3300048906 Bacteria 1657
467 Ga0496104_0006281 3300048907 Bacteria 10447
468 Ga0496104_0052465 3300048907 Unclassified 3852
469 Ga0496104_0293842 3300048907 Bacteria 1537
470 Ga0496104_0357643 3300048907 Bacteria 1373
471 Ga0496105_0134660 3300048908 Bacteria 2036
472 Ga0496105_0238921 3300048908 Bacteria 1475
473 Ga0496106_0022707 3300048909 Bacteria 4662
474 Ga0496106_0145811 3300048909 Bacteria 1865
475 Ga0496108_0025575 3300048911 Bacteria 4866
476 Ga0496108_0430961 3300048911 Unclassified 1152
477 Ga0496109_0021921 3300048912 Bacteria 5656
478 Ga0496109_0065331 3300048912 Bacteria 3330
479 Ga0496109_0089637 3300048912 Bacteria 2844
480 Ga0496109_0094383 3300048912 Bacteria 2769
481 Ga0496109_0104119 3300048912 Bacteria 2635
482 Ga0496109_0265728 3300048912 Bacteria 1616
483 Ga0496109_0346543 3300048912 Bacteria 1403
484 Ga0496110_0145848 3300048913 Unclassified 2141
485 Ga0496110_0308009 3300048913 Bacteria 1443
486 Ga0496112_0015714 3300048915 Bacteria 7070
487 Ga0496112_0028618 3300048915 Bacteria 5380
488 Ga0496112_0055026 3300048915 Bacteria 3911
489 Ga0496112_0088177 3300048915 Unclassified 3070
490 Ga0496112_0318115 3300048915 Bacteria 1501
491 Ga0496113_0011831 3300048916 Bacteria 5846
492 Ga0496114_0023110 3300048917 Bacteria 5069
493 Ga0496114_0120472 3300048917 Bacteria 2256
494 Ga0496115_0001208 3300048918 Bacteria 18530
495 Ga0496115_0002913 3300048918 Bacteria 12348
496 Ga0496115_0023880 3300048918 Unclassified 4748
497 Ga0496115_0182099 3300048918 Unclassified 1737
498 Ga0496115_0273562 3300048918 Bacteria 1387
499 nmdc:mga05p37_767297_c1 3300050507 Bacteria 1060
500 nmdc:mga05p37_8732_c1 3300050507 Bacteria 11967
501 nmdc:mga0n895_274081_c1 3300050512 Bacteria 1711
502 nmdc:mga0n895_344253_c1 3300050512 Bacteria 1510
503 nmdc:mga0n895_484432_c1 3300050512 Unclassified 1247
504 nmdc:mga0rr50_374642_c1 3300050513 Unclassified 1200
505 nmdc:mga08x19_105441_c1 3300050514 Bacteria 1874
506 nmdc:mga08x19_305687_c1 3300050514 Bacteria 1105
507 nmdc:mga08x19_61302_c1 3300050514 Bacteria 2437
508 nmdc:mga0a205_233400_c1 3300050515 Unclassified 1722
509 Ga0495601_0001873 3300053077 Bacteria 11724
510 Ga0495601_0012199 3300053077 Bacteria 5153
511 Ga0495655_0036137 3300053083 Unclassified 1234
512 Ga0495619_0077278 3300053085 Unclassified 2236
513 Ga0495619_0135437 3300053085 Bacteria 1694
514 Ga0495619_0332961 3300053085 Bacteria 1051
515 Ga0213875_10000266
516 CNXas_1000006
517 JGI25406J46586_10000002
518 JGI25405J52794_10000108
519 JGI25405J52794_10030556
520 Ga0065704_10011507
521 Ga0065712_10002212
522 Ga0065712_10005915
523 Ga0065712_10194631
524 Ga0065715_10001654
525 Ga0065715_10021002
526 Ga0065715_10154501
527 Ga0065715_10183655
528 Ga0065707_10238369
529 Ga0070676_10003636
530 Ga0070683_100001630
531 Ga0070683_100077573
532 Ga0070683_100082748
533 Ga0070690_100006260
534 Ga0070690_100011521
535 Ga0070690_100036368
536 Ga0070670_100015828
537 Ga0070670_100023748
538 Ga0070670_100072563
539 Ga0070670_100193929
540 Ga0070670_100196211
541 Ga0070677_10140284
542 Ga0070666_10003392
543 Ga0070666_10018705
544 Ga0070666_10033398
545 Ga0070666_10319446
546 Ga0070682_100243525
547 Ga0068868_100068068
548 Ga0068868_100116289
549 Ga0068868_100125720
550 Ga0068868_100218564
551 Ga0068868_100236724
552 Ga0068868_100544784
553 Ga0070660_100450618
554 Ga0070689_100114871
555 Ga0070689_100459029
556 Ga0070687_100040476
557 Ga0070687_100175155
558 Ga0070687_100331500
559 Ga0070661_100115533
560 Ga0070668_100010994
561 Ga0070668_100018383
562 Ga0070668_100190642
563 Ga0070669_100000734
564 Ga0070669_100046190
565 Ga0070669_100087823
566 Ga0070669_100245422
567 Ga0070675_100006907
568 Ga0070675_100016903
569 Ga0070675_100036310
570 Ga0070675_100092558
571 Ga0070675_100120999
572 Ga0070675_100423235
573 Ga0070671_100010527
574 Ga0070671_100040942
575 Ga0070671_100067807
576 Ga0070671_100127982
577 Ga0070671_100207537
578 Ga0070671_100224625
579 Ga0070671_100283138
580 Ga0070674_100026425
581 Ga0070674_100110388
582 Ga0070673_100026393
583 Ga0070673_100060960
584 Ga0070673_100444288
585 Ga0070688_100286702
586 Ga0070659_100045663
587 Ga0070659_100081946
588 Ga0070667_100021174
589 Ga0070667_100064971
590 Ga0070667_100126914
591 Ga0070703_10049927
592 Ga0070714_100087928
593 Ga0070713_100101122
594 Ga0070713_100166623
595 Ga0070713_100201790
596 Ga0070710_10053734
597 Ga0070710_10108458
598 Ga0070710_10179814
599 Ga0070710_10214909
600 Ga0070711_100027967
601 Ga0070711_100101521
602 Ga0070711_100203081
603 Ga0070711_100335466
604 Ga0070705_100061372
605 Ga0070705_100214226
606 Ga0070694_100049076
607 Ga0070708_100020966
608 Ga0070708_100021927
609 Ga0070708_100027395
610 Ga0070708_100413753
611 Ga0070663_100026660
612 Ga0070663_100452869
613 Ga0070678_100001802
614 Ga0070678_100036708
615 Ga0070678_100120138
616 Ga0070662_100196241
617 Ga0070662_100371276
618 Ga0070681_10040483
619 Ga0068867_100137221
620 Ga0068867_100438135
621 Ga0070685_10010454
622 Ga0070685_10037763
623 Ga0070706_100000286
624 Ga0070706_100003298
625 Ga0070706_100028843
626 Ga0070706_100039993
627 Ga0070706_100052279
628 Ga0070706_100072600
629 Ga0070706_100209255
630 Ga0070706_100717741
631 Ga0070707_100002233
632 Ga0070707_100028825
633 Ga0070707_100046768
634 Ga0070707_100063710
635 Ga0070707_100070052
636 Ga0070707_100076752
637 Ga0070707_100091255
638 Ga0070707_100417251
639 Ga0070698_100001957
640 Ga0070698_100008544
641 Ga0070698_100130467
642 Ga0070698_100247886
643 Ga0070698_100374770
644 Ga0070698_100454786
645 Ga0070699_100047544
646 Ga0070699_100397555
647 Ga0070679_100133174
648 Ga0070684_100101223
649 Ga0070684_100256588
650 Ga0070697_100004942
651 Ga0070697_100033677
652 Ga0070697_100078108
653 Ga0070697_100108938
654 Ga0070697_100124078
655 Ga0070697_100135903
656 Ga0070697_100173232
657 Ga0070697_100354890
658 Ga0070672_100004759
659 Ga0070672_100083156
660 Ga0070686_100050667
661 Ga0070686_100054361
662 Ga0070695_100110662
663 Ga0070693_100176580
664 Ga0070665_100014886
665 Ga0070665_100020993
666 Ga0070665_100237923
667 Ga0070665_100396071
668 Ga0070704_100004877
669 Ga0070664_100023757
670 Ga0070664_100379192
671 Ga0068856_100004883
672 Ga0068856_100394934
673 Ga0068859_100053247
674 Ga0068866_10123759
675 Ga0068863_100016981
676 Ga0068858_100005855
677 Ga0068858_100188498
678 Ga0068860_100012337
679 Ga0068860_100034684
680 Ga0068862_100341706
681 Ga0081455_10001521
682 Ga0081455_10032183
683 Ga0081455_10034680
684 Ga0081455_10084086
685 Ga0081540_1008065
686 Ga0081540_1023222
687 Ga0081539_10000061
688 Ga0081539_10001104
689 Ga0081539_10009995
690 Ga0081539_10104255
691 Ga0081539_10185867
692 Ga0070717_10010699
693 Ga0070717_10029096
694 Ga0070717_10069243
695 Ga0070717_10237715
696 Ga0070717_10316967
697 Ga0070717_10321777
698 Ga0070717_10645493
699 Ga0070715_10039084
700 Ga0070715_10054787
701 Ga0070715_10196057
702 Ga0070716_100041892
703 Ga0070716_100066724
704 Ga0070716_100109074
705 Ga0070712_100010408
706 Ga0070712_100204328
707 Ga0070712_100205293
708 Ga0070712_100321822
709 Ga0097621_100007270
710 Ga0097621_100098976
711 Ga0097621_100415552
712 Ga0068871_100265400
713 Ga0068871_100420082
714 Ga0068871_100424047
715 Ga0075428_100120877
716 Ga0075428_100591633
717 Ga0075434_100433492
718 Ga0075434_100562662
719 Ga0075436_100035616
720 Ga0075436_100041595
721 Ga0075436_100117737
722 Ga0075436_100261649
723 Ga0097620_100053248
724 Ga0075435_100126406
725 Ga0075435_100363308
726 Ga0099795_10036567
727 Ga0105240_10437103
728 Ga0105245_10239523
729 Ga0114129_10281163
730 Ga0105243_10296161
731 Ga0105237_10087556
732 Ga0105237_10526048
733 Ga0105237_10774016
734 Ga0105249_10002500
735 Ga0105249_10130527
736 Ga0105239_10150356
737 Ga0105246_10115261
738 Ga0157369_10807362
739 Ga0157374_10017735
740 Ga0157374_10029161
741 Ga0157374_10048857
742 Ga0157374_10212923
743 Ga0157374_10252505
744 Ga0157374_10305634
745 Ga0157374_10577213
746 Ga0157378_10013277
747 Ga0157378_10019408
748 Ga0157378_10034167
749 Ga0157378_10065134
750 Ga0157378_10105303
751 Ga0157378_10130569
752 Ga0163162_10025675
753 Ga0163162_10251446
754 Ga0163162_10613919
755 Ga0157372_10018419
756 Ga0157372_10051672
757 Ga0157372_10387148
758 Ga0157372_10496787
759 Ga0157375_10024632
760 Ga0157375_10129102
761 Ga0157375_10235260
762 Ga0157375_10245923
763 Ga0157375_10248910
764 Ga0157375_10267060
765 Ga0157375_10469590
766 Ga0157375_11060992
767 Ga0157379_10867178
768 Ga0157376_10054400
769 Ga0157376_10059514
770 Ga0163161_10018151
771 Ga0163161_10221407
772 Ga0207666_1013851
773 Ga0207697_10000444
774 Ga0207697_10001023
775 Ga0207697_10002919
776 Ga0207697_10003392
777 Ga0207697_10003510
778 Ga0207697_10013574
779 Ga0207697_10017168
780 Ga0207682_10108678
781 Ga0207642_10149063
782 Ga0207688_10009933
783 Ga0207688_10027981
784 Ga0207688_10083073
785 Ga0207680_10032923
786 Ga0207680_10036945
787 Ga0207647_10003648
788 Ga0207699_10097003
789 Ga0207699_10228606
790 Ga0207645_10001285
791 Ga0207645_10021875
792 Ga0207645_10039615
793 Ga0207645_10047937
794 Ga0207645_10089651
795 Ga0207705_10288293
796 Ga0207684_10000361
797 Ga0207684_10003455
798 Ga0207684_10006037
799 Ga0207684_10009863
800 Ga0207684_10014196
801 Ga0207684_10028134
802 Ga0207684_10058349
803 Ga0207684_10324496
804 Ga0207684_10419546
805 Ga0207684_10534076
806 Ga0207707_10020471
807 Ga0207671_10309688
808 Ga0207693_10001355
809 Ga0207693_10047777
810 Ga0207693_10061203
811 Ga0207693_10084150
812 Ga0207693_10243185
813 Ga0207693_10349172
814 Ga0207663_10042524
815 Ga0207662_10000375
816 Ga0207662_10037014
817 Ga0207657_10029455
818 Ga0207657_10267373
819 Ga0207649_10080204
820 Ga0207649_10084246
821 Ga0207649_10160541
822 Ga0207652_10016896
823 Ga0207646_10000115
824 Ga0207646_10001435
825 Ga0207646_10024025
826 Ga0207646_10074488
827 Ga0207646_10121492
828 Ga0207646_10121576
829 Ga0207646_10146738
830 Ga0207646_10179643
831 Ga0207646_10244926
832 Ga0207646_10269059
833 Ga0207646_10339369
834 Ga0207646_10405751
835 Ga0207646_10496672
836 Ga0207681_10002979
837 Ga0207681_10078360
838 Ga0207681_10163092
839 Ga0207681_10307351
840 Ga0207681_10615188
841 Ga0207650_10030769
842 Ga0207650_10159440
843 Ga0207659_10004448
844 Ga0207659_10023937
845 Ga0207659_10037817
846 Ga0207659_10080047
847 Ga0207659_10284541
848 Ga0207687_10094816
849 Ga0207700_10012378
850 Ga0207700_10478922
851 Ga0207664_10015216
852 Ga0207664_10091750
853 Ga0207664_10349617
854 Ga0207644_10020725
855 Ga0207644_10054515
856 Ga0207644_10375851
857 Ga0207690_10031003
858 Ga0207706_10002111
859 Ga0207706_10074916
860 Ga0207706_10218131
861 Ga0207706_10352449
862 Ga0207670_10157118
863 Ga0207670_10164529
864 Ga0207670_10314258
865 Ga0207669_10021591
866 Ga0207669_10222036
867 Ga0207704_10438131
868 Ga0207665_10045079
869 Ga0207665_10069215
870 Ga0207665_10120911
871 Ga0207665_10192894
872 Ga0207691_10001851
873 Ga0207691_10003807
874 Ga0207691_10018166
875 Ga0207691_10028546
876 Ga0207691_10076735
877 Ga0207689_10122978
878 Ga0207661_10193943
879 Ga0207661_10301503
880 Ga0207661_10695353
881 Ga0207679_10140254
882 Ga0207679_10409370
883 Ga0207651_10006741
884 Ga0207651_10041859
885 Ga0207651_10110451
886 Ga0207712_10035750
887 Ga0207668_10002463
888 Ga0207668_10013858
889 Ga0207668_10076803
890 Ga0207668_10168819
891 Ga0207658_10172824
892 Ga0207677_10066307
893 Ga0207677_10384457
894 Ga0207677_10474744
895 Ga0207678_10007526
896 Ga0207678_10132043
897 Ga0207678_10331054
898 Ga0207702_10278281
899 Ga0207648_10165425
900 Ga0207648_10258383
901 Ga0207648_10289278
902 Ga0207675_100048593
903 Ga0207683_10004604
904 Ga0207683_10013143
905 Ga0207683_10114125
906 Ga0207683_10135837
907 Ga0207683_10600174
908 Ga0209998_10012296
909 Ga0209974_10071139
910 Ga0268266_10089603
911 Ga0268266_10148161
912 Ga0268266_10216775
913 Ga0268266_10218564
914 Ga0268266_10334701
915 Ga0268266_10594306
916 Ga0268265_10623361
917 Ga0268264_10001797
918 Ga0268264_10014336
919 Ga0307513_10016611
920 Ga0373926_0116015
921 Ga0373944_0065863
922 Ga0373943_0014266
923 Ga0373955_0360205
924 Ga0373931_0145600
925 Ga0373931_0164090
926 Ga0373935_0117147
927 Ga0373935_0415917
928 Ga0373947_0024785
929 Ga0373947_0026549
930 Ga0373947_0263131
931 Ga0373937_0006068
932 Ga0373937_0047009
933 Ga0373937_0459977
934 Ga0373925_0043223
935 Ga0373925_0362853
936 Ga0395900_0007479
937 Ga0395900_0027545
938 Ga0395898_0013491
939 Ga0395898_0215123
940 Ga0395905_0008443
941 Ga0395905_0059620
942 Ga0436364_0156620
943 Ga0436364_0988623
944 Ga0436364_1329891
945 Ga0395901_0001270
946 Ga0395901_0028632
947 Ga0395901_0037856
948 Ga0439459_0018917
949 Ga0466964_0022998
950 Ga0495592_0003725
951 Ga0495592_0188831
952 Ga0495629_0127757
953 Ga0495582_0102686
954 Ga0495628_0026085
955 Ga0495628_0304101
956 Ga0495652_0021147
957 Ga0495652_0025291
958 Ga0495640_0029850
959 Ga0495586_0025898
960 Ga0495645_0004254
961 Ga0495599_0003768
962 Ga0495623_0022894
963 Ga0495647_0053165
964 Ga0495658_0156163
965 Ga0495658_0236711
966 Ga0495669_0026903
967 Ga0495669_0099365
968 Ga0495669_0229138
969 Ga0495674_0084813
970 Ga0495674_0195989
971 Ga0495675_0008247
972 Ga0495675_0053858
973 Ga0495684_0069994
974 Ga0495602_0091787
975 Ga0496100_0009688
976 Ga0496100_0124012
977 Ga0496101_0015438
978 Ga0496101_0236123
979 Ga0496102_0002637
980 Ga0496103_0122504
981 Ga0496104_0006281
982 Ga0496104_0052465
983 Ga0496104_0293842
984 Ga0496104_0357643
985 Ga0496105_0134660
986 Ga0496105_0238921
987 Ga0496106_0022707
988 Ga0496106_0145811
989 Ga0496108_0025575
990 Ga0496108_0430961
991 Ga0496109_0021921
992 Ga0496109_0065331
993 Ga0496109_0089637
994 Ga0496109_0094383
995 Ga0496109_0104119
996 Ga0496109_0265728
997 Ga0496109_0346543
998 Ga0496110_0145848
999 Ga0496110_0308009
1000 Ga0496112_0015714
1001 Ga0496112_0028618
1002 Ga0496112_0055026
1003 Ga0496112_0088177
1004 Ga0496112_0318115
1005 Ga0496113_0011831
1006 Ga0496114_0023110
1007 Ga0496114_0120472
1008 Ga0496115_0001208
1009 Ga0496115_0002913
1010 Ga0496115_0023880
1011 Ga0496115_0182099
1012 Ga0496115_0273562
1013 nmdc:mga05p37_767297_c1
1014 nmdc:mga05p37_8732_c1
1015 nmdc:mga0n895_274081_c1
1016 nmdc:mga0n895_344253_c1
1017 nmdc:mga0n895_484432_c1
1018 nmdc:mga0rr50_374642_c1
1019 nmdc:mga08x19_105441_c1
1020 nmdc:mga08x19_305687_c1
1021 nmdc:mga08x19_61302_c1
1022 nmdc:mga0a205_233400_c1
1023 Ga0495601_0001873
1024 Ga0495601_0012199
1025 Ga0495655_0036137
1026 Ga0495619_0077278
1027 Ga0495619_0135437
1028 Ga0495619_0332961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

55

250

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9361 56 253
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9286 56 253
4pfz-assembly1.cif.gz_A x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9264 1 253
4pfz-assembly1.cif.gz_A x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9228 1 253
4dbh-assembly1.cif.gz_B crystal structure of cg1458 with inhibitor 0.9191 1 253
ID Description Score Start End Superfamily
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9383 54 253 3.90.850.10
af_Q10B63_1_221_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9372 53 253 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9329 56 252 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9303 53 251 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9287 54 247 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2V6CAW0-F1-model_v4 Uncharacterized protein 0.9779 2 254 GO:0018773
GO:0046872
AF-A0A2V6J182-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9763 1 255 GO:0018773
GO:0046872
AF-A0A2V5X313-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9733 1 224 GO:0018773
GO:0046872
AF-A0A2V5X313-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.969 1 224 GO:0018773
GO:0046872
AF-A0A2V6J182-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9687 1 255 GO:0018773
GO:0046872

Map