F457682

General Info

Members Datasets Scaffolds Average Seq Length
514 216 1028 161

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000013|Ga0070699_100000013198
Length 176
Sequence VTADNDYLLLTMFELKPLHRDAIPAALDKAMRYRLLNEPGAAESICLDVLKVDPDHQQALVTLLLAMTDRLAKGYTVGDTQIQDALGRLRDQYERTYYTGLVWERRAKARLAKGSPDARYAAYDWFREAMEWFEKAESIRPAGNDDAILRWNSCARVIMSNNLSPRAEEYAEHFLE

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
196 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
197 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
198 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
202 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
203 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
204 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.78
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 16.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100000013 3300005518 Bacteria 241303
2 LJQas_1000197 3300000549 Bacteria 10904
3 rootL2_10282921 3300003322 Bacteria 4220
4 Ga0065704_10147463 3300005289 Bacteria 1458
5 Ga0065715_10010320 3300005293 Bacteria 2359
6 Ga0065715_10585936 3300005293 Bacteria 705
7 Ga0065707_10189719 3300005295 Bacteria 1368
8 Ga0070676_10151201 3300005328 Bacteria 1486
9 Ga0070683_101074108 3300005329 Unclassified 773
10 Ga0070690_100024433 3300005330 Bacteria 3714
11 Ga0070690_100630318 3300005330 Bacteria 817
12 Ga0070690_100797804 3300005330 Unclassified 732
13 Ga0070670_100003119 3300005331 Bacteria 13715
14 Ga0070670_100010608 3300005331 Bacteria 7868
15 Ga0070670_100044765 3300005331 Bacteria 3804
16 Ga0068869_100033909 3300005334 Bacteria 3607
17 Ga0070666_10075120 3300005335 Bacteria 2305
18 Ga0070680_101085076 3300005336 Bacteria 692
19 Ga0070682_100646484 3300005337 Unclassified 841
20 Ga0070682_100837981 3300005337 Unclassified 750
21 Ga0070660_100158056 3300005339 Bacteria 1825
22 Ga0070660_100350865 3300005339 Bacteria 1215
23 Ga0070689_100020487 3300005340 Bacteria 4908
24 Ga0070689_100112406 3300005340 Bacteria 2168
25 Ga0070689_100367768 3300005340 Bacteria 1209
26 Ga0070689_100564130 3300005340 Bacteria 982
27 Ga0070689_100815141 3300005340 Bacteria 821
28 Ga0070687_100200429 3300005343 Unclassified 1209
29 Ga0070661_100021050 3300005344 Bacteria 4656
30 Ga0070661_100068246 3300005344 Bacteria 2613
31 Ga0070668_100086744 3300005347 Bacteria 2462
32 Ga0070668_101013510 3300005347 Unclassified 747
33 Ga0070675_100057071 3300005354 Bacteria 3218
34 Ga0070675_100116415 3300005354 Bacteria 2267
35 Ga0070675_100497754 3300005354 Bacteria 1098
36 Ga0070675_100557609 3300005354 Bacteria 1037
37 Ga0070671_100125394 3300005355 Bacteria 2161
38 Ga0070671_100132131 3300005355 Bacteria 2103
39 Ga0070671_100159581 3300005355 Bacteria 1906
40 Ga0070671_100678131 3300005355 Bacteria 893
41 Ga0070671_100696757 3300005355 Unclassified 881
42 Ga0070674_100024215 3300005356 Bacteria 3938
43 Ga0070688_100117594 3300005365 Bacteria 1776
44 Ga0070688_100533407 3300005365 Bacteria 890
45 Ga0070688_101104504 3300005365 Bacteria 634
46 Ga0070688_101163778 3300005365 Unclassified 618
47 Ga0070659_100032232 3300005366 Bacteria 4063
48 Ga0070667_100132819 3300005367 Bacteria 2174
49 Ga0070667_100967854 3300005367 Bacteria 793
50 Ga0070703_10000293 3300005406 Bacteria 23071
51 Ga0070703_10229101 3300005406 Unclassified 744
52 Ga0070709_10000024 3300005434 Bacteria 131900
53 Ga0070709_11525312 3300005434 Unclassified 543
54 Ga0070710_11085198 3300005437 Unclassified 587
55 Ga0070711_100000022 3300005439 Bacteria 119718
56 Ga0070705_100000383 3300005440 Bacteria 25809
57 Ga0070705_100362166 3300005440 Bacteria 1061
58 Ga0070694_101018142 3300005444 Unclassified 688
59 Ga0070708_101269921 3300005445 Bacteria 688
60 Ga0070678_100806431 3300005456 Bacteria 853
61 Ga0070678_101193381 3300005456 Unclassified 705
62 Ga0070662_100072866 3300005457 Bacteria 2537
63 Ga0070662_100289532 3300005457 Bacteria 1327
64 Ga0070681_10076907 3300005458 Bacteria 3295
65 Ga0070681_10088242 3300005458 Bacteria 3053
66 Ga0068867_100076893 3300005459 Bacteria 2507
67 Ga0068867_100258039 3300005459 Bacteria 1420
68 Ga0070685_10145692 3300005466 Bacteria 1496
69 Ga0070706_100000730 3300005467 Bacteria 37034
70 Ga0070707_100288688 3300005468 Bacteria 1594
71 Ga0070698_100795899 3300005471 Unclassified 889
72 Ga0070679_100067673 3300005530 Bacteria 3562
73 Ga0070679_100627797 3300005530 Bacteria 1017
74 Ga0070684_100403942 3300005535 Bacteria 1260
75 Ga0068853_100102495 3300005539 Bacteria 2532
76 Ga0068853_100211818 3300005539 Bacteria 1766
77 Ga0068853_100334216 3300005539 Bacteria 1407
78 Ga0068853_100626874 3300005539 Unclassified 1022
79 Ga0068853_100839712 3300005539 Unclassified 881
80 Ga0070672_100265715 3300005543 Bacteria 1448
81 Ga0070672_100298310 3300005543 Bacteria 1365
82 Ga0070672_100375768 3300005543 Bacteria 1215
83 Ga0070672_100923906 3300005543 Unclassified 771
84 Ga0070686_100124728 3300005544 Bacteria 1772
85 Ga0070695_100014387 3300005545 Bacteria 4769
86 Ga0070696_100001817 3300005546 Bacteria 14017
87 Ga0070696_100013385 3300005546 Bacteria 5503
88 Ga0070693_100013150 3300005547 Bacteria 4209
89 Ga0070693_100108409 3300005547 Bacteria 1704
90 Ga0068855_100323725 3300005563 Unclassified 1703
91 Ga0068855_100327842 3300005563 Bacteria 1691
92 Ga0070664_100034530 3300005564 Bacteria 4242
93 Ga0070664_100053358 3300005564 Bacteria 3427
94 Ga0070664_100122009 3300005564 Bacteria 2283
95 Ga0070664_100439882 3300005564 Unclassified 1196
96 Ga0068857_100049619 3300005577 Bacteria 3723
97 Ga0068857_100054672 3300005577 Bacteria 3543
98 Ga0068857_100065892 3300005577 Bacteria 3222
99 Ga0068857_100105449 3300005577 Bacteria 2531
100 Ga0068857_101527945 3300005577 Unclassified 651
101 Ga0068857_101727285 3300005577 Bacteria 612
102 Ga0068854_100191274 3300005578 Bacteria 1604
103 Ga0068854_100676081 3300005578 Unclassified 889
104 Ga0068856_100508278 3300005614 Bacteria 1226
105 Ga0068852_100145964 3300005616 Bacteria 2194
106 Ga0068852_100176838 3300005616 Bacteria 2004
107 Ga0068852_100211655 3300005616 Bacteria 1839
108 Ga0068852_100401163 3300005616 Bacteria 1349
109 Ga0068859_100012017 3300005617 Bacteria 8698
110 Ga0068859_100047750 3300005617 Bacteria 4301
111 Ga0068859_100273936 3300005617 Bacteria 1780
112 Ga0068859_100375869 3300005617 Bacteria 1516
113 Ga0068859_100477234 3300005617 Bacteria 1343
114 Ga0068859_100937494 3300005617 Bacteria 949
115 Ga0068864_100007082 3300005618 Bacteria 9207
116 Ga0068864_100079487 3300005618 Bacteria 2871
117 Ga0068864_100108992 3300005618 Unclassified 2465
118 Ga0068864_100689050 3300005618 Unclassified 997
119 Ga0068864_100754340 3300005618 Bacteria 954
120 Ga0068864_101300171 3300005618 Unclassified 727
121 Ga0068864_101325112 3300005618 Unclassified 721
122 Ga0068864_101566532 3300005618 Unclassified 662
123 Ga0068866_10288272 3300005718 Bacteria 1020
124 Ga0068861_100835812 3300005719 Bacteria 867
125 Ga0068861_100852194 3300005719 Bacteria 859
126 Ga0068861_101032974 3300005719 Bacteria 786
127 Ga0068851_10041676 3300005834 Bacteria 2309
128 Ga0068870_10013139 3300005840 Bacteria 3884
129 Ga0068870_10214531 3300005840 Bacteria 1174
130 Ga0068863_100043143 3300005841 Bacteria 4282
131 Ga0068863_100057293 3300005841 Bacteria 3688
132 Ga0068863_100147808 3300005841 Bacteria 2248
133 Ga0068863_101055171 3300005841 Bacteria 816
134 Ga0068858_100247436 3300005842 Bacteria 1693
135 Ga0068858_100365408 3300005842 Bacteria 1383
136 Ga0068858_100525197 3300005842 Bacteria 1145
137 Ga0068858_100929941 3300005842 Unclassified 851
138 Ga0068860_100023785 3300005843 Bacteria 5922
139 Ga0068860_100024771 3300005843 Bacteria 5796
140 Ga0068860_100049453 3300005843 Bacteria 4004
141 Ga0068860_100330028 3300005843 Bacteria 1498
142 Ga0068860_101514220 3300005843 Unclassified 692
143 Ga0068862_100031166 3300005844 Bacteria 4498
144 Ga0068862_100050605 3300005844 Bacteria 3551
145 Ga0068862_100122201 3300005844 Bacteria 2296
146 Ga0068862_100578023 3300005844 Bacteria 1076
147 Ga0081455_10008865 3300005937 Bacteria 10403
148 Ga0070716_100529021 3300006173 Unclassified 875
149 Ga0097621_100027482 3300006237 Bacteria 4475
150 Ga0097621_100048582 3300006237 Bacteria 3443
151 Ga0097621_100677591 3300006237 Bacteria 948
152 Ga0068871_100053092 3300006358 Bacteria 3284
153 Ga0068871_100156352 3300006358 Bacteria 1947
154 Ga0068871_100426748 3300006358 Bacteria 1185
155 Ga0068871_100475133 3300006358 Bacteria 1124
156 Ga0075428_100000904 3300006844 Bacteria 31311
157 Ga0075428_100083411 3300006844 Bacteria 3487
158 Ga0075428_100200746 3300006844 Bacteria 2156
159 Ga0075428_100372169 3300006844 Bacteria 1532
160 Ga0075428_100474282 3300006844 Bacteria 1339
161 Ga0075428_100835228 3300006844 Bacteria 978
162 Ga0075428_101153001 3300006844 Bacteria 818
163 Ga0075430_100558085 3300006846 Bacteria 945
164 Ga0075433_10114540 3300006852 Unclassified 2392
165 Ga0075434_100042793 3300006871 Unclassified 4491
166 Ga0075434_100868963 3300006871 Bacteria 917
167 Ga0075429_100179968 3300006880 Bacteria 1853
168 Ga0075429_100277031 3300006880 Bacteria 1469
169 Ga0068865_100269462 3300006881 Bacteria 1351
170 Ga0068865_100463435 3300006881 Bacteria 1050
171 Ga0075436_100001466 3300006914 Bacteria 16028
172 Ga0075436_100109823 3300006914 Bacteria 1924
173 Ga0075436_100195462 3300006914 Bacteria 1432
174 Ga0097620_100012017 3300006931 Bacteria 8698
175 Ga0097620_100047752 3300006931 Bacteria 4301
176 Ga0097620_100273935 3300006931 Bacteria 1780
177 Ga0097620_100375874 3300006931 Bacteria 1516
178 Ga0097620_100477207 3300006931 Bacteria 1343
179 Ga0097620_100937517 3300006931 Bacteria 949
180 Ga0075435_100636430 3300007076 Unclassified 925
181 Ga0099795_10203732 3300007788 Bacteria 836
182 Ga0105240_10620245 3300009093 Bacteria 1189
183 Ga0111539_10000136 3300009094 Bacteria 83578
184 Ga0111539_10033335 3300009094 Bacteria 6253
185 Ga0111539_10425024 3300009094 Bacteria 1547
186 Ga0111539_10463388 3300009094 Bacteria 1476
187 Ga0111539_11165143 3300009094 Unclassified 895
188 Ga0111539_11265106 3300009094 Bacteria 856
189 Ga0105245_11408981 3300009098 Bacteria 747
190 Ga0105247_10157472 3300009101 Bacteria 1501
191 Ga0105247_10199457 3300009101 Bacteria 1344
192 Ga0105247_11365352 3300009101 Unclassified 572
193 Ga0114129_10010691 3300009147 Bacteria 13091
194 Ga0114129_10081778 3300009147 Unclassified 4490
195 Ga0114129_10134692 3300009147 Bacteria 3390
196 Ga0114129_10240998 3300009147 Bacteria 2431
197 Ga0114129_11831194 3300009147 Unclassified 737
198 Ga0114129_12532765 3300009147 Unclassified 613
199 Ga0105243_10396227 3300009148 Unclassified 1281
200 Ga0105241_10041683 3300009174 Bacteria 3470
201 Ga0105242_10295326 3300009176 Bacteria 1477
202 Ga0105248_10025003 3300009177 Bacteria 6638
203 Ga0105248_10596106 3300009177 Unclassified 1247
204 Ga0105248_10848764 3300009177 Bacteria 1031
205 Ga0105248_10908084 3300009177 Bacteria 994
206 Ga0105248_11122718 3300009177 Bacteria 889
207 Ga0105237_10049106 3300009545 Bacteria 4243
208 Ga0105249_10013892 3300009553 Bacteria 7118
209 Ga0105249_10064430 3300009553 Bacteria 3369
210 Ga0105249_10081739 3300009553 Bacteria 3004
211 Ga0105249_10144868 3300009553 Bacteria 2281
212 Ga0105249_10699387 3300009553 Bacteria 1074
213 Ga0105249_10991747 3300009553 Unclassified 909
214 Ga0105239_10180752 3300010375 Bacteria 2360
215 Ga0105239_10252637 3300010375 Bacteria 1980
216 Ga0105246_10474472 3300011119 Bacteria 1057
217 Ga0157373_10042477 3300013100 Bacteria 3249
218 Ga0157373_10132486 3300013100 Bacteria 1753
219 Ga0157373_10170861 3300013100 Bacteria 1529
220 Ga0157371_10186349 3300013102 Bacteria 1485
221 Ga0157371_10717835 3300013102 Unclassified 749
222 Ga0157370_10037820 3300013104 Bacteria 4673
223 Ga0157369_10236055 3300013105 Bacteria 1911
224 Ga0157374_10076044 3300013296 Bacteria 3174
225 Ga0157374_10111858 3300013296 Bacteria 2627
226 Ga0157378_10160664 3300013297 Bacteria 2101
227 Ga0157378_10427083 3300013297 Unclassified 1311
228 Ga0157378_10717654 3300013297 Unclassified 1020
229 Ga0157378_10719186 3300013297 Unclassified 1019
230 Ga0157378_10780546 3300013297 Bacteria 980
231 Ga0157378_11634993 3300013297 Bacteria 690
232 Ga0163162_10093043 3300013306 Bacteria 3099
233 Ga0163162_10564656 3300013306 Bacteria 1265
234 Ga0163162_10604496 3300013306 Bacteria 1223
235 Ga0157372_10091732 3300013307 Bacteria 3455
236 Ga0157372_10100165 3300013307 Bacteria 3306
237 Ga0157372_10278918 3300013307 Bacteria 1943
238 Ga0157372_10304704 3300013307 Bacteria 1853
239 Ga0157375_10027751 3300013308 Bacteria 5296
240 Ga0157375_10467666 3300013308 Bacteria 1426
241 Ga0157375_10492739 3300013308 Bacteria 1390
242 Ga0157375_10516403 3300013308 Bacteria 1358
243 Ga0157375_11552736 3300013308 Unclassified 782
244 Ga0157375_11584956 3300013308 Bacteria 774
245 Ga0163163_10029253 3300014325 Bacteria 5300
246 Ga0163163_10215540 3300014325 Bacteria 1969
247 Ga0163163_10360216 3300014325 Bacteria 1511
248 Ga0163163_10389514 3300014325 Unclassified 1451
249 Ga0163163_10565669 3300014325 Bacteria 1200
250 Ga0163163_10866074 3300014325 Bacteria 967
251 Ga0157380_10020810 3300014326 Bacteria 4911
252 Ga0157380_10040103 3300014326 Bacteria 3645
253 Ga0157380_10141601 3300014326 Bacteria 2067
254 Ga0157380_10326502 3300014326 Bacteria 1425
255 Ga0157380_10391066 3300014326 Bacteria 1316
256 Ga0157380_10530066 3300014326 Bacteria 1151
257 Ga0157380_10917267 3300014326 Bacteria 903
258 Ga0157377_10863863 3300014745 Unclassified 673
259 Ga0157379_10154292 3300014968 Bacteria 2071
260 Ga0157379_10620166 3300014968 Bacteria 1011
261 Ga0157376_10045238 3300014969 Bacteria 3623
262 Ga0157376_10318712 3300014969 Bacteria 1477
263 Ga0163161_10002047 3300017792 Bacteria 14607
264 Ga0163161_10046578 3300017792 Bacteria 3129
265 Ga0163161_10062384 3300017792 Bacteria 2715
266 Ga0163161_10565043 3300017792 Bacteria 934
267 Ga0213874_10209437 3300021377 Unclassified 704
268 Ga0213876_10603131 3300021384 Unclassified 584
269 Ga0207656_10045006 3300025321 Bacteria 1887
270 Ga0207656_10202647 3300025321 Bacteria 959
271 Ga0207653_10000142 3300025885 Bacteria 51280
272 Ga0207682_10607514 3300025893 Unclassified 515
273 Ga0207710_10071688 3300025900 Bacteria 1590
274 Ga0207685_10427828 3300025905 Bacteria 684
275 Ga0207699_10000049 3300025906 Bacteria 108746
276 Ga0207643_10012805 3300025908 Bacteria 4534
277 Ga0207643_10515391 3300025908 Bacteria 765
278 Ga0207684_10000075 3300025910 Bacteria 183366
279 Ga0207654_10087636 3300025911 Bacteria 1889
280 Ga0207707_10004836 3300025912 Bacteria 11813
281 Ga0207707_10242597 3300025912 Bacteria 1566
282 Ga0207671_10057355 3300025914 Bacteria 2886
283 Ga0207663_10000060 3300025916 Bacteria 54325
284 Ga0207660_10231715 3300025917 Unclassified 1452
285 Ga0207657_10041547 3300025919 Bacteria 4066
286 Ga0207657_10295771 3300025919 Bacteria 1283
287 Ga0207657_10555432 3300025919 Unclassified 898
288 Ga0207649_10048558 3300025920 Bacteria 2618
289 Ga0207652_10179050 3300025921 Bacteria 1904
290 Ga0207652_10214860 3300025921 Bacteria 1732
291 Ga0207650_10009739 3300025925 Bacteria 6572
292 Ga0207650_10012022 3300025925 Bacteria 5967
293 Ga0207650_10082589 3300025925 Unclassified 2439
294 Ga0207659_10405721 3300025926 Unclassified 1141
295 Ga0207659_10869021 3300025926 Bacteria 775
296 Ga0207690_10093006 3300025932 Bacteria 2135
297 Ga0207706_10016205 3300025933 Bacteria 6735
298 Ga0207706_10043771 3300025933 Bacteria 3967
299 Ga0207670_10042187 3300025936 Bacteria 3005
300 Ga0207670_10218232 3300025936 Bacteria 1458
301 Ga0207665_10232362 3300025939 Bacteria 1356
302 Ga0207691_10108308 3300025940 Bacteria 2473
303 Ga0207691_10651405 3300025940 Bacteria 890
304 Ga0207711_10019134 3300025941 Bacteria 5699
305 Ga0207711_10353659 3300025941 Bacteria 1360
306 Ga0207689_10187754 3300025942 Bacteria 1705
307 Ga0207661_10205556 3300025944 Bacteria 1733
308 Ga0207679_10027521 3300025945 Bacteria 3933
309 Ga0207679_10077247 3300025945 Bacteria 2532
310 Ga0207667_10372692 3300025949 Bacteria 1455
311 Ga0207651_10115678 3300025960 Bacteria 2023
312 Ga0207651_10346348 3300025960 Unclassified 1250
313 Ga0207712_10022359 3300025961 Bacteria 4162
314 Ga0207712_10440876 3300025961 Bacteria 1103
315 Ga0207712_10508205 3300025961 Bacteria 1031
316 Ga0207712_10994359 3300025961 Bacteria 744
317 Ga0207668_10423062 3300025972 Bacteria 1131
318 Ga0207668_10447539 3300025972 Bacteria 1102
319 Ga0207640_10179240 3300025981 Bacteria 1587
320 Ga0207658_10055043 3300025986 Bacteria 2946
321 Ga0207658_10379645 3300025986 Bacteria 1237
322 Ga0207703_10077235 3300026035 Bacteria 2764
323 Ga0207703_10396201 3300026035 Bacteria 1280
324 Ga0207703_10586272 3300026035 Unclassified 1054
325 Ga0207703_10878915 3300026035 Unclassified 858
326 Ga0207639_10057610 3300026041 Bacteria 2984
327 Ga0207639_10207785 3300026041 Bacteria 1683
328 Ga0207639_10292720 3300026041 Bacteria 1436
329 Ga0207639_10682254 3300026041 Unclassified 952
330 Ga0207678_10130067 3300026067 Bacteria 2147
331 Ga0207702_10823767 3300026078 Bacteria 918
332 Ga0207641_10128455 3300026088 Bacteria 2272
333 Ga0207641_10169509 3300026088 Bacteria 1991
334 Ga0207641_10306164 3300026088 Bacteria 1502
335 Ga0207641_11018355 3300026088 Bacteria 825
336 Ga0207648_10085312 3300026089 Bacteria 2755
337 Ga0207676_10044054 3300026095 Bacteria 3440
338 Ga0207676_10044174 3300026095 Bacteria 3436
339 Ga0207676_10179107 3300026095 Bacteria 1854
340 Ga0207676_10705217 3300026095 Unclassified 978
341 Ga0207674_10031852 3300026116 Bacteria 5535
342 Ga0207674_10051582 3300026116 Bacteria 4198
343 Ga0207674_10068554 3300026116 Bacteria 3570
344 Ga0207674_10264827 3300026116 Bacteria 1666
345 Ga0207674_11088618 3300026116 Bacteria 768
346 Ga0207674_11635578 3300026116 Bacteria 612
347 Ga0207675_100172658 3300026118 Bacteria 2067
348 Ga0207675_100342355 3300026118 Bacteria 1464
349 Ga0207675_100398547 3300026118 Bacteria 1356
350 Ga0207675_100667887 3300026118 Bacteria 1046
351 Ga0207675_100830496 3300026118 Bacteria 938
352 Ga0207683_10034979 3300026121 Bacteria 4369
353 Ga0207683_10081509 3300026121 Archaea 2872
354 Ga0207683_10189001 3300026121 Bacteria 1869
355 Ga0207683_11164111 3300026121 Unclassified 715
356 Ga0207683_11384087 3300026121 Unclassified 651
357 Ga0207698_10309146 3300026142 Bacteria 1475
358 Ga0207698_10329270 3300026142 Bacteria 1434
359 Ga0207428_10000825 3300027907 Bacteria 34926
360 Ga0207428_10604146 3300027907 Unclassified 790
361 Ga0268265_10054755 3300028380 Bacteria 3029
362 Ga0268265_10131989 3300028380 Bacteria 2077
363 Ga0268264_10023004 3300028381 Bacteria 5085
364 Ga0268264_10046621 3300028381 Bacteria 3600
365 Ga0268264_10234289 3300028381 Bacteria 1697
366 Ga0268264_11734890 3300028381 Unclassified 635
367 Ga0307509_10295364 3300031507 Bacteria 1372
368 Ga0307408_100344055 3300031548 Bacteria 1263
369 Ga0307408_100856863 3300031548 Bacteria 829
370 Ga0307408_100918283 3300031548 Bacteria 802
371 Ga0307405_10005701 3300031731 Bacteria 6042
372 Ga0307405_10053055 3300031731 Bacteria 2524
373 Ga0307405_10123747 3300031731 Bacteria 1774
374 Ga0307405_10293440 3300031731 Bacteria 1230
375 Ga0307405_10499037 3300031731 Bacteria 975
376 Ga0307405_10569952 3300031731 Bacteria 919
377 Ga0307405_11097294 3300031731 Bacteria 684
378 Ga0307413_10002674 3300031824 Bacteria 7306
379 Ga0307413_10005751 3300031824 Bacteria 5574
380 Ga0307413_10010709 3300031824 Bacteria 4466
381 Ga0307413_10098586 3300031824 Bacteria 1924
382 Ga0307413_10173274 3300031824 Bacteria 1530
383 Ga0307410_10004100 3300031852 Bacteria 7460
384 Ga0307410_10005033 3300031852 Bacteria 6941
385 Ga0307410_10025570 3300031852 Bacteria 3706
386 Ga0307410_10351074 3300031852 Bacteria 1178
387 Ga0307410_10393807 3300031852 Unclassified 1117
388 Ga0307410_10546178 3300031852 Unclassified 960
389 Ga0307410_10561928 3300031852 Bacteria 947
390 Ga0307406_10006231 3300031901 Bacteria 6568
391 Ga0307406_10066702 3300031901 Bacteria 2343
392 Ga0307406_10129446 3300031901 Unclassified 1769
393 Ga0307406_10136057 3300031901 Bacteria 1732
394 Ga0307406_10146910 3300031901 Bacteria 1677
395 Ga0307406_10164778 3300031901 Bacteria 1598
396 Ga0307406_10471845 3300031901 Unclassified 1011
397 Ga0307406_11572100 3300031901 Bacteria 580
398 Ga0307407_10000475 3300031903 Bacteria 12326
399 Ga0307407_10002898 3300031903 Bacteria 6861
400 Ga0307407_10016117 3300031903 Bacteria 3712
401 Ga0307412_10063257 3300031911 Bacteria 2495
402 Ga0307412_10176514 3300031911 Bacteria 1602
403 Ga0307409_100000731 3300031995 Bacteria 14714
404 Ga0307409_100016205 3300031995 Bacteria 4923
405 Ga0307409_100053436 3300031995 Bacteria 3103
406 Ga0307409_100354194 3300031995 Bacteria 1386
407 Ga0307409_100496934 3300031995 Bacteria 1187
408 Ga0307409_100497619 3300031995 Bacteria 1186
409 Ga0307409_100747277 3300031995 Unclassified 982
410 Ga0307409_100784987 3300031995 Bacteria 959
411 Ga0307409_101126388 3300031995 Bacteria 806
412 Ga0307409_101821071 3300031995 Bacteria 638
413 Ga0307416_100006835 3300032002 Bacteria 7178
414 Ga0307416_100012092 3300032002 Bacteria 5796
415 Ga0307416_100117948 3300032002 Bacteria 2357
416 Ga0307416_100259632 3300032002 Bacteria 1697
417 Ga0307416_100311879 3300032002 Bacteria 1570
418 Ga0307416_101168389 3300032002 Bacteria 875
419 Ga0307416_101290256 3300032002 Bacteria 836
420 Ga0307414_10030638 3300032004 Bacteria 3517
421 Ga0307414_10067179 3300032004 Bacteria 2567
422 Ga0307414_10162485 3300032004 Bacteria 1776
423 Ga0307411_10002145 3300032005 Bacteria 8555
424 Ga0307411_10012071 3300032005 Bacteria 4693
425 Ga0307411_10036286 3300032005 Bacteria 3087
426 Ga0307411_10050725 3300032005 Bacteria 2704
427 Ga0307411_10227362 3300032005 Bacteria 1452
428 Ga0307411_10405270 3300032005 Unclassified 1128
429 Ga0307411_11049950 3300032005 Bacteria 732
430 Ga0307415_100007943 3300032126 Bacteria 5842
431 Ga0307415_100018530 3300032126 Bacteria 4206
432 Ga0307415_100083685 3300032126 Bacteria 2287
433 Ga0307415_100168444 3300032126 Bacteria 1706
434 Ga0307415_100169213 3300032126 Bacteria 1702
435 Ga0307415_100292496 3300032126 Unclassified 1345
436 Ga0307415_100353336 3300032126 Bacteria 1238
437 Ga0307415_100651791 3300032126 Bacteria 944
438 Ga0307415_100828091 3300032126 Bacteria 847
439 Ga0307415_100993807 3300032126 Bacteria 779
440 Ga0307415_101115347 3300032126 Bacteria 739
441 Ga0373952_0157537 3300035092 Archaea 641
442 Ga0373937_0026952 3300036401 Bacteria 5195
443 Ga0395900_0926329 3300037418 Unclassified 794
444 Ga0395905_0050230 3300037471 Bacteria 3908
445 Ga0395905_0607294 3300037471 Bacteria 996
446 Ga0436365_0481662 3300039437 Bacteria 1875
447 Ga0436363_1646369 3300039450 Bacteria 7670
448 Ga0451843_0269480 3300041509 Bacteria 2076
449 Ga0439432_016616 3300042006 Bacteria 2475
450 Ga0466963_0090476 3300044694 Bacteria 2084
451 Ga0466957_0212643 3300044842 Bacteria 1274
452 Ga0451576_0008551 3300045051 Bacteria 12003
453 Ga0466967_0154676 3300045976 Bacteria 2147
454 Ga0495603_0352694 3300046455 Bacteria 844
455 Ga0495582_0086199 3300046473 Unclassified 1748
456 Ga0495582_0123657 3300046473 Bacteria 1459
457 Ga0495616_0086384 3300046513 Bacteria 1492
458 Ga0495618_0094743 3300046514 Bacteria 1909
459 Ga0495640_0169948 3300046533 Bacteria 1393
460 Ga0495598_0009412 3300046537 Bacteria 2308
461 Ga0495621_0071653 3300046539 Bacteria 1278
462 Ga0495668_0004789 3300046616 Bacteria 9435
463 Ga0495672_0168082 3300047320 Bacteria 1121
464 Ga0496106_0447405 3300048909 Bacteria 1038
465 Ga0496109_0000050 3300048912 Bacteria 126918
466 Ga0496109_0952501 3300048912 Bacteria 796
467 Ga0496113_0139056 3300048916 Bacteria 1910
468 Ga0501072_0013722 3300049588 Bacteria 6202
469 Ga0501202_112876 3300049652 Unclassified 675
470 Ga0501206_038646 3300049653 Unclassified 730
471 Ga0501223_083104 3300049663 Bacteria 643
472 Ga0501227_007786 3300049665 Unclassified 2298
473 Ga0501227_063600 3300049665 Bacteria 949
474 Ga0501228_013048 3300049666 Unclassified 862
475 Ga0501233_044165 3300049668 Bacteria 1058
476 Ga0501235_018413 3300049669 Bacteria 1549
477 Ga0501242_009200 3300049674 Bacteria 1166
478 Ga0501250_036632 3300049680 Unclassified 704
479 Ga0501259_022704 3300049688 Bacteria 1130
480 Ga0501260_005711 3300049689 Bacteria 1178
481 Ga0501225_0138812 3300049705 Unclassified 733
482 Ga0501225_0169556 3300049705 Bacteria 676
483 Ga0501268_001255 3300049765 Bacteria 3119
484 nmdc:mga05p37_101578_c1 3300050507 Unclassified 3541
485 nmdc:mga05p37_113937_c2 3300050507 Bacteria 2216
486 nmdc:mga05p37_1194576_c1 3300050507 Bacteria 786
487 nmdc:mga05p37_144192_c1 3300050507 Bacteria 2917
488 nmdc:mga05p37_311667_c1 3300050507 Bacteria 1865
489 nmdc:mga05p37_60_c1 3300050507 Bacteria 95299
490 nmdc:mga09592_378890_c1 3300050508 Bacteria 1223
491 nmdc:mga09592_613541_c1 3300050508 Bacteria 931
492 nmdc:mga09592_635953_c1 3300050508 Bacteria 912
493 nmdc:mga06r32_271641_c1 3300050510 Bacteria 1683
494 nmdc:mga06r32_46184_c1 3300050510 Bacteria 4156
495 nmdc:mga06r32_732807_c1 3300050510 Bacteria 952
496 nmdc:mga06r32_984449_c1 3300050510 Bacteria 797
497 nmdc:mga08y16_447_c1 3300050511 Bacteria 38229
498 nmdc:mga08y16_5098_c1 3300050511 Bacteria 13727
499 nmdc:mga08y16_844105_c1 3300050511 Unclassified 906
500 nmdc:mga08y16_863092_c1 3300050511 Unclassified 894
501 nmdc:mga08y16_89972_c1 3300050511 Bacteria 3199
502 nmdc:mga0rr50_632985_c1 3300050513 Bacteria 912
503 nmdc:mga08x19_253753_c1 3300050514 Bacteria 1215
504 nmdc:mga08x19_28_c1 3300050514 Bacteria 224933
505 nmdc:mga08x19_464429_c1 3300050514 Unclassified 892
506 nmdc:mga0a205_1108115_c1 3300050515 Bacteria 639
507 nmdc:mga0a205_132361_c1 3300050515 Bacteria 2394
508 nmdc:mga0a205_565192_c1 3300050515 Bacteria 992
509 nmdc:mga0a205_874872_c1 3300050515 Bacteria 745
510 Ga0500651_0292596 3300053093 Bacteria 936
511 Ga0501084_0132320 3300054114 Bacteria 2100
512 Ga0501084_0159642 3300054114 Bacteria 1902
513 Ga0501082_0513337 3300060353 Bacteria 1048
514 Ga0501082_1047838 3300060353 Unclassified 713
515 Ga0070699_100000013
516 LJQas_1000197
517 rootL2_10282921
518 Ga0065704_10147463
519 Ga0065715_10010320
520 Ga0065715_10585936
521 Ga0065707_10189719
522 Ga0070676_10151201
523 Ga0070683_101074108
524 Ga0070690_100024433
525 Ga0070690_100630318
526 Ga0070690_100797804
527 Ga0070670_100003119
528 Ga0070670_100010608
529 Ga0070670_100044765
530 Ga0068869_100033909
531 Ga0070666_10075120
532 Ga0070680_101085076
533 Ga0070682_100646484
534 Ga0070682_100837981
535 Ga0070660_100158056
536 Ga0070660_100350865
537 Ga0070689_100020487
538 Ga0070689_100112406
539 Ga0070689_100367768
540 Ga0070689_100564130
541 Ga0070689_100815141
542 Ga0070687_100200429
543 Ga0070661_100021050
544 Ga0070661_100068246
545 Ga0070668_100086744
546 Ga0070668_101013510
547 Ga0070675_100057071
548 Ga0070675_100116415
549 Ga0070675_100497754
550 Ga0070675_100557609
551 Ga0070671_100125394
552 Ga0070671_100132131
553 Ga0070671_100159581
554 Ga0070671_100678131
555 Ga0070671_100696757
556 Ga0070674_100024215
557 Ga0070688_100117594
558 Ga0070688_100533407
559 Ga0070688_101104504
560 Ga0070688_101163778
561 Ga0070659_100032232
562 Ga0070667_100132819
563 Ga0070667_100967854
564 Ga0070703_10000293
565 Ga0070703_10229101
566 Ga0070709_10000024
567 Ga0070709_11525312
568 Ga0070710_11085198
569 Ga0070711_100000022
570 Ga0070705_100000383
571 Ga0070705_100362166
572 Ga0070694_101018142
573 Ga0070708_101269921
574 Ga0070678_100806431
575 Ga0070678_101193381
576 Ga0070662_100072866
577 Ga0070662_100289532
578 Ga0070681_10076907
579 Ga0070681_10088242
580 Ga0068867_100076893
581 Ga0068867_100258039
582 Ga0070685_10145692
583 Ga0070706_100000730
584 Ga0070707_100288688
585 Ga0070698_100795899
586 Ga0070679_100067673
587 Ga0070679_100627797
588 Ga0070684_100403942
589 Ga0068853_100102495
590 Ga0068853_100211818
591 Ga0068853_100334216
592 Ga0068853_100626874
593 Ga0068853_100839712
594 Ga0070672_100265715
595 Ga0070672_100298310
596 Ga0070672_100375768
597 Ga0070672_100923906
598 Ga0070686_100124728
599 Ga0070695_100014387
600 Ga0070696_100001817
601 Ga0070696_100013385
602 Ga0070693_100013150
603 Ga0070693_100108409
604 Ga0068855_100323725
605 Ga0068855_100327842
606 Ga0070664_100034530
607 Ga0070664_100053358
608 Ga0070664_100122009
609 Ga0070664_100439882
610 Ga0068857_100049619
611 Ga0068857_100054672
612 Ga0068857_100065892
613 Ga0068857_100105449
614 Ga0068857_101527945
615 Ga0068857_101727285
616 Ga0068854_100191274
617 Ga0068854_100676081
618 Ga0068856_100508278
619 Ga0068852_100145964
620 Ga0068852_100176838
621 Ga0068852_100211655
622 Ga0068852_100401163
623 Ga0068859_100012017
624 Ga0068859_100047750
625 Ga0068859_100273936
626 Ga0068859_100375869
627 Ga0068859_100477234
628 Ga0068859_100937494
629 Ga0068864_100007082
630 Ga0068864_100079487
631 Ga0068864_100108992
632 Ga0068864_100689050
633 Ga0068864_100754340
634 Ga0068864_101300171
635 Ga0068864_101325112
636 Ga0068864_101566532
637 Ga0068866_10288272
638 Ga0068861_100835812
639 Ga0068861_100852194
640 Ga0068861_101032974
641 Ga0068851_10041676
642 Ga0068870_10013139
643 Ga0068870_10214531
644 Ga0068863_100043143
645 Ga0068863_100057293
646 Ga0068863_100147808
647 Ga0068863_101055171
648 Ga0068858_100247436
649 Ga0068858_100365408
650 Ga0068858_100525197
651 Ga0068858_100929941
652 Ga0068860_100023785
653 Ga0068860_100024771
654 Ga0068860_100049453
655 Ga0068860_100330028
656 Ga0068860_101514220
657 Ga0068862_100031166
658 Ga0068862_100050605
659 Ga0068862_100122201
660 Ga0068862_100578023
661 Ga0081455_10008865
662 Ga0070716_100529021
663 Ga0097621_100027482
664 Ga0097621_100048582
665 Ga0097621_100677591
666 Ga0068871_100053092
667 Ga0068871_100156352
668 Ga0068871_100426748
669 Ga0068871_100475133
670 Ga0075428_100000904
671 Ga0075428_100083411
672 Ga0075428_100200746
673 Ga0075428_100372169
674 Ga0075428_100474282
675 Ga0075428_100835228
676 Ga0075428_101153001
677 Ga0075430_100558085
678 Ga0075433_10114540
679 Ga0075434_100042793
680 Ga0075434_100868963
681 Ga0075429_100179968
682 Ga0075429_100277031
683 Ga0068865_100269462
684 Ga0068865_100463435
685 Ga0075436_100001466
686 Ga0075436_100109823
687 Ga0075436_100195462
688 Ga0097620_100012017
689 Ga0097620_100047752
690 Ga0097620_100273935
691 Ga0097620_100375874
692 Ga0097620_100477207
693 Ga0097620_100937517
694 Ga0075435_100636430
695 Ga0099795_10203732
696 Ga0105240_10620245
697 Ga0111539_10000136
698 Ga0111539_10033335
699 Ga0111539_10425024
700 Ga0111539_10463388
701 Ga0111539_11165143
702 Ga0111539_11265106
703 Ga0105245_11408981
704 Ga0105247_10157472
705 Ga0105247_10199457
706 Ga0105247_11365352
707 Ga0114129_10010691
708 Ga0114129_10081778
709 Ga0114129_10134692
710 Ga0114129_10240998
711 Ga0114129_11831194
712 Ga0114129_12532765
713 Ga0105243_10396227
714 Ga0105241_10041683
715 Ga0105242_10295326
716 Ga0105248_10025003
717 Ga0105248_10596106
718 Ga0105248_10848764
719 Ga0105248_10908084
720 Ga0105248_11122718
721 Ga0105237_10049106
722 Ga0105249_10013892
723 Ga0105249_10064430
724 Ga0105249_10081739
725 Ga0105249_10144868
726 Ga0105249_10699387
727 Ga0105249_10991747
728 Ga0105239_10180752
729 Ga0105239_10252637
730 Ga0105246_10474472
731 Ga0157373_10042477
732 Ga0157373_10132486
733 Ga0157373_10170861
734 Ga0157371_10186349
735 Ga0157371_10717835
736 Ga0157370_10037820
737 Ga0157369_10236055
738 Ga0157374_10076044
739 Ga0157374_10111858
740 Ga0157378_10160664
741 Ga0157378_10427083
742 Ga0157378_10717654
743 Ga0157378_10719186
744 Ga0157378_10780546
745 Ga0157378_11634993
746 Ga0163162_10093043
747 Ga0163162_10564656
748 Ga0163162_10604496
749 Ga0157372_10091732
750 Ga0157372_10100165
751 Ga0157372_10278918
752 Ga0157372_10304704
753 Ga0157375_10027751
754 Ga0157375_10467666
755 Ga0157375_10492739
756 Ga0157375_10516403
757 Ga0157375_11552736
758 Ga0157375_11584956
759 Ga0163163_10029253
760 Ga0163163_10215540
761 Ga0163163_10360216
762 Ga0163163_10389514
763 Ga0163163_10565669
764 Ga0163163_10866074
765 Ga0157380_10020810
766 Ga0157380_10040103
767 Ga0157380_10141601
768 Ga0157380_10326502
769 Ga0157380_10391066
770 Ga0157380_10530066
771 Ga0157380_10917267
772 Ga0157377_10863863
773 Ga0157379_10154292
774 Ga0157379_10620166
775 Ga0157376_10045238
776 Ga0157376_10318712
777 Ga0163161_10002047
778 Ga0163161_10046578
779 Ga0163161_10062384
780 Ga0163161_10565043
781 Ga0213874_10209437
782 Ga0213876_10603131
783 Ga0207656_10045006
784 Ga0207656_10202647
785 Ga0207653_10000142
786 Ga0207682_10607514
787 Ga0207710_10071688
788 Ga0207685_10427828
789 Ga0207699_10000049
790 Ga0207643_10012805
791 Ga0207643_10515391
792 Ga0207684_10000075
793 Ga0207654_10087636
794 Ga0207707_10004836
795 Ga0207707_10242597
796 Ga0207671_10057355
797 Ga0207663_10000060
798 Ga0207660_10231715
799 Ga0207657_10041547
800 Ga0207657_10295771
801 Ga0207657_10555432
802 Ga0207649_10048558
803 Ga0207652_10179050
804 Ga0207652_10214860
805 Ga0207650_10009739
806 Ga0207650_10012022
807 Ga0207650_10082589
808 Ga0207659_10405721
809 Ga0207659_10869021
810 Ga0207690_10093006
811 Ga0207706_10016205
812 Ga0207706_10043771
813 Ga0207670_10042187
814 Ga0207670_10218232
815 Ga0207665_10232362
816 Ga0207691_10108308
817 Ga0207691_10651405
818 Ga0207711_10019134
819 Ga0207711_10353659
820 Ga0207689_10187754
821 Ga0207661_10205556
822 Ga0207679_10027521
823 Ga0207679_10077247
824 Ga0207667_10372692
825 Ga0207651_10115678
826 Ga0207651_10346348
827 Ga0207712_10022359
828 Ga0207712_10440876
829 Ga0207712_10508205
830 Ga0207712_10994359
831 Ga0207668_10423062
832 Ga0207668_10447539
833 Ga0207640_10179240
834 Ga0207658_10055043
835 Ga0207658_10379645
836 Ga0207703_10077235
837 Ga0207703_10396201
838 Ga0207703_10586272
839 Ga0207703_10878915
840 Ga0207639_10057610
841 Ga0207639_10207785
842 Ga0207639_10292720
843 Ga0207639_10682254
844 Ga0207678_10130067
845 Ga0207702_10823767
846 Ga0207641_10128455
847 Ga0207641_10169509
848 Ga0207641_10306164
849 Ga0207641_11018355
850 Ga0207648_10085312
851 Ga0207676_10044054
852 Ga0207676_10044174
853 Ga0207676_10179107
854 Ga0207676_10705217
855 Ga0207674_10031852
856 Ga0207674_10051582
857 Ga0207674_10068554
858 Ga0207674_10264827
859 Ga0207674_11088618
860 Ga0207674_11635578
861 Ga0207675_100172658
862 Ga0207675_100342355
863 Ga0207675_100398547
864 Ga0207675_100667887
865 Ga0207675_100830496
866 Ga0207683_10034979
867 Ga0207683_10081509
868 Ga0207683_10189001
869 Ga0207683_11164111
870 Ga0207683_11384087
871 Ga0207698_10309146
872 Ga0207698_10329270
873 Ga0207428_10000825
874 Ga0207428_10604146
875 Ga0268265_10054755
876 Ga0268265_10131989
877 Ga0268264_10023004
878 Ga0268264_10046621
879 Ga0268264_10234289
880 Ga0268264_11734890
881 Ga0307509_10295364
882 Ga0307408_100344055
883 Ga0307408_100856863
884 Ga0307408_100918283
885 Ga0307405_10005701
886 Ga0307405_10053055
887 Ga0307405_10123747
888 Ga0307405_10293440
889 Ga0307405_10499037
890 Ga0307405_10569952
891 Ga0307405_11097294
892 Ga0307413_10002674
893 Ga0307413_10005751
894 Ga0307413_10010709
895 Ga0307413_10098586
896 Ga0307413_10173274
897 Ga0307410_10004100
898 Ga0307410_10005033
899 Ga0307410_10025570
900 Ga0307410_10351074
901 Ga0307410_10393807
902 Ga0307410_10546178
903 Ga0307410_10561928
904 Ga0307406_10006231
905 Ga0307406_10066702
906 Ga0307406_10129446
907 Ga0307406_10136057
908 Ga0307406_10146910
909 Ga0307406_10164778
910 Ga0307406_10471845
911 Ga0307406_11572100
912 Ga0307407_10000475
913 Ga0307407_10002898
914 Ga0307407_10016117
915 Ga0307412_10063257
916 Ga0307412_10176514
917 Ga0307409_100000731
918 Ga0307409_100016205
919 Ga0307409_100053436
920 Ga0307409_100354194
921 Ga0307409_100496934
922 Ga0307409_100497619
923 Ga0307409_100747277
924 Ga0307409_100784987
925 Ga0307409_101126388
926 Ga0307409_101821071
927 Ga0307416_100006835
928 Ga0307416_100012092
929 Ga0307416_100117948
930 Ga0307416_100259632
931 Ga0307416_100311879
932 Ga0307416_101168389
933 Ga0307416_101290256
934 Ga0307414_10030638
935 Ga0307414_10067179
936 Ga0307414_10162485
937 Ga0307411_10002145
938 Ga0307411_10012071
939 Ga0307411_10036286
940 Ga0307411_10050725
941 Ga0307411_10227362
942 Ga0307411_10405270
943 Ga0307411_11049950
944 Ga0307415_100007943
945 Ga0307415_100018530
946 Ga0307415_100083685
947 Ga0307415_100168444
948 Ga0307415_100169213
949 Ga0307415_100292496
950 Ga0307415_100353336
951 Ga0307415_100651791
952 Ga0307415_100828091
953 Ga0307415_100993807
954 Ga0307415_101115347
955 Ga0373952_0157537
956 Ga0373937_0026952
957 Ga0395900_0926329
958 Ga0395905_0050230
959 Ga0395905_0607294
960 Ga0436365_0481662
961 Ga0436363_1646369
962 Ga0451843_0269480
963 Ga0439432_016616
964 Ga0466963_0090476
965 Ga0466957_0212643
966 Ga0451576_0008551
967 Ga0466967_0154676
968 Ga0495603_0352694
969 Ga0495582_0086199
970 Ga0495582_0123657
971 Ga0495616_0086384
972 Ga0495618_0094743
973 Ga0495640_0169948
974 Ga0495598_0009412
975 Ga0495621_0071653
976 Ga0495668_0004789
977 Ga0495672_0168082
978 Ga0496106_0447405
979 Ga0496109_0000050
980 Ga0496109_0952501
981 Ga0496113_0139056
982 Ga0501072_0013722
983 Ga0501202_112876
984 Ga0501206_038646
985 Ga0501223_083104
986 Ga0501227_007786
987 Ga0501227_063600
988 Ga0501228_013048
989 Ga0501233_044165
990 Ga0501235_018413
991 Ga0501242_009200
992 Ga0501250_036632
993 Ga0501259_022704
994 Ga0501260_005711
995 Ga0501225_0138812
996 Ga0501225_0169556
997 Ga0501268_001255
998 nmdc:mga05p37_101578_c1
999 nmdc:mga05p37_113937_c2
1000 nmdc:mga05p37_1194576_c1
1001 nmdc:mga05p37_144192_c1
1002 nmdc:mga05p37_311667_c1
1003 nmdc:mga05p37_60_c1
1004 nmdc:mga09592_378890_c1
1005 nmdc:mga09592_613541_c1
1006 nmdc:mga09592_635953_c1
1007 nmdc:mga06r32_271641_c1
1008 nmdc:mga06r32_46184_c1
1009 nmdc:mga06r32_732807_c1
1010 nmdc:mga06r32_984449_c1
1011 nmdc:mga08y16_447_c1
1012 nmdc:mga08y16_5098_c1
1013 nmdc:mga08y16_844105_c1
1014 nmdc:mga08y16_863092_c1
1015 nmdc:mga08y16_89972_c1
1016 nmdc:mga0rr50_632985_c1
1017 nmdc:mga08x19_253753_c1
1018 nmdc:mga08x19_28_c1
1019 nmdc:mga08x19_464429_c1
1020 nmdc:mga0a205_1108115_c1
1021 nmdc:mga0a205_132361_c1
1022 nmdc:mga0a205_565192_c1
1023 nmdc:mga0a205_874872_c1
1024 Ga0500651_0292596
1025 Ga0501084_0132320
1026 Ga0501084_0159642
1027 Ga0501082_0513337
1028 Ga0501082_1047838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.7749 13 77
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.7364 7 87
8fyu-assembly2.cif.gz_A crystal structure of the human chip-tpr domain in complex with a 10mer acetylated tau peptide 0.7138 12 149
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.7138 13 77
4gco-assembly1.cif.gz_A central domain of stress-induced protein-1 (sti-1) from c.elegans 0.6972 7 143
ID Description Score Start End Superfamily
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.907 13 78 1.25.40.10
af_C0PEY7_222_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8931 10 78 1.25.40.10
af_G3UYY4_1546_1623_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8778 12 78 1.25.40.10
af_I1KC83_461_545_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8705 12 78 1.25.40.10
af_A0A1P8B3S0_1_63_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8455 9 67 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7Y2GVW8-F1-model_v4 Uncharacterized protein 0.9874 1 163
AF-A0A2V7YCG8-F1-model_v4 Tetratricopeptide repeat protein 0.9718 1 141
AF-A0A3B9LV38-F1-model_v4 Tetratricopeptide repeat protein 0.9663 2 100
AF-A0A1Q7K0X2-F1-model_v4 Tetratricopeptide repeat protein 0.9651 1 156
AF-A0A3N5H9V0-F1-model_v4 Tetratricopeptide repeat protein 0.965 1 154

Map