F457642

General Info

Members Datasets Scaffolds Average Seq Length
513 251 499 371

Family's Representative Sequence

Representative Sequence 3300050516|nmdc:mga0sz30_3908_c1|nmdc:mga0sz30_3908_c1_1649_2800
Length 383
Sequence MSDLPEEATDMPTPGVVREFIGVPSPTARRAGAGGHPCQGLYHRGVGRKPKVAVIATHYQIDFSEHYLADYLATRGIGFLGWNTRFRGFESSFMLDHALVDIGVGMHWLRDVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGLTDLPPADAYIASAAHPGRPDVLTAWMDGAVVDENDPVATDPDLDLFDERNGPPFSDEFLARYRSAQIARNHAITDWAETELKRVQSAGFSDRPFAVMRTWADPRMVDPDIEPTKRQPNLCYAGVPAKANRSSYGIAAACTLRNWLGMWSLKTAQTRAEPHLARVSVPALVINAEQDTGVFPSDAQRIFDALATTDKTLCAIDTDHYFTTPGARSEQADTIAKWIAKRWR

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
6 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
9 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
10 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
11 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
12 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
13 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
14 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
15 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.06
Nodule 0
Rhizoplane 13.65
Rhizosphere 64.13
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1001999 3300001978 Bacteria 1605
2 JGI24743J22301_10008347 3300001991 Bacteria 1816
3 JGI24745J21846_1000833 3300002073 Bacteria 2841
4 JGI24738J21930_10013340 3300002075 Bacteria 1780
5 JGI24749J21850_1001430 3300002076 Bacteria 3382
6 JGI24744J21845_10000539 3300002077 Bacteria 6786
7 JGI24744J21845_10003218 3300002077 Bacteria 3351
8 JGI24034J26672_10001158 3300002239 Bacteria 3445
9 JGI24742J22300_10000756 3300002244 Bacteria 4908
10 JGI24751J29686_10015418 3300002459 Bacteria 1576
11 Ga0055540_1000207 3300003792 Bacteria 56613
12 Ga0055540_1000913 3300003792 Bacteria 19334
13 Ga0055540_1003234 3300003792 Bacteria 7987
14 Ga0055540_1015201 3300003792 Bacteria 2253
15 Ga0070676_10005410 3300005328 Bacteria 6803
16 Ga0070690_100003998 3300005330 Bacteria 8154
17 Ga0068869_100009419 3300005334 Bacteria 6338
18 Ga0070682_100161188 3300005337 Bacteria 1549
19 Ga0068868_100017004 3300005338 Bacteria 5411
20 Ga0070687_100021525 3300005343 Bacteria 3033
21 Ga0070687_100084715 3300005343 Bacteria 1738
22 Ga0070692_10033191 3300005345 Bacteria 2601
23 Ga0070668_100000533 3300005347 Bacteria 25353
24 Ga0070668_100012064 3300005347 Bacteria 6437
25 Ga0070669_100016152 3300005353 Bacteria 5325
26 Ga0070669_100033426 3300005353 Bacteria 3720
27 Ga0070675_100202245 3300005354 Bacteria 1724
28 Ga0070671_100007032 3300005355 Bacteria 9014
29 Ga0070671_100017910 3300005355 Bacteria 5745
30 Ga0070671_100108748 3300005355 Bacteria 2328
31 Ga0070673_100069288 3300005364 Bacteria 2826
32 Ga0070688_100013315 3300005365 Bacteria 4633
33 Ga0070688_100081132 3300005365 Bacteria 2100
34 Ga0070659_100018434 3300005366 Bacteria 5268
35 Ga0070659_100251912 3300005366 Bacteria 1464
36 Ga0070667_100000549 3300005367 Bacteria 37300
37 Ga0070667_100004882 3300005367 Bacteria 11224
38 Ga0070667_100009437 3300005367 Bacteria 8095
39 Ga0070667_100045631 3300005367 Bacteria 3685
40 Ga0070667_100255860 3300005367 Bacteria 1566
41 Ga0070667_100314559 3300005367 Bacteria 1412
42 Ga0070709_10019293 3300005434 Bacteria 3939
43 Ga0070714_100094294 3300005435 Bacteria 2627
44 Ga0070710_10002894 3300005437 Bacteria 8179
45 Ga0070701_10001164 3300005438 Bacteria 9622
46 Ga0070711_100003817 3300005439 Bacteria 8850
47 Ga0070711_100013666 3300005439 Bacteria 5101
48 Ga0070705_100045658 3300005440 Bacteria 2522
49 Ga0070700_100005156 3300005441 Bacteria 6904
50 Ga0070700_100100002 3300005441 Bacteria 1909
51 Ga0070694_100086627 3300005444 Bacteria 2189
52 Ga0070663_100023566 3300005455 Bacteria 4127
53 Ga0070678_100008757 3300005456 Bacteria 6079
54 Ga0070678_100090734 3300005456 Bacteria 2343
55 Ga0070662_100022649 3300005457 Bacteria 4303
56 Ga0068867_100006883 3300005459 Bacteria 8044
57 Ga0068867_100132397 3300005459 Bacteria 1940
58 Ga0070685_10012068 3300005466 Bacteria 4531
59 Ga0070685_10013883 3300005466 Bacteria 4261
60 Ga0068853_100032706 3300005539 Bacteria 4408
61 Ga0068853_100119925 3300005539 Bacteria 2345
62 Ga0070672_100039234 3300005543 Bacteria 3626
63 Ga0070686_100017981 3300005544 Bacteria 4141
64 Ga0070696_100001922 3300005546 Bacteria 13679
65 Ga0070665_100013574 3300005548 Bacteria 8195
66 Ga0070665_100041096 3300005548 Bacteria 4647
67 Ga0070665_100081375 3300005548 Bacteria 3244
68 Ga0070665_100389696 3300005548 Bacteria 1401
69 Ga0070704_100000324 3300005549 Bacteria 21508
70 Ga0070704_100080695 3300005549 Bacteria 2393
71 Ga0068855_100116574 3300005563 Bacteria 3061
72 Ga0068859_100002116 3300005617 Bacteria 20220
73 Ga0068859_100014430 3300005617 Bacteria 7928
74 Ga0068864_100018243 3300005618 Bacteria 5858
75 Ga0068866_10001959 3300005718 Bacteria 8578
76 Ga0068861_100004359 3300005719 Bacteria 9492
77 Ga0068861_100090016 3300005719 Bacteria 2419
78 Ga0068861_100110812 3300005719 Bacteria 2199
79 Ga0068863_100006579 3300005841 Bacteria 11405
80 Ga0068863_100030504 3300005841 Bacteria 5148
81 Ga0068863_100119432 3300005841 Bacteria 2513
82 Ga0068863_100426762 3300005841 Bacteria 1299
83 Ga0068858_100006263 3300005842 Bacteria 11596
84 Ga0068858_100249851 3300005842 Bacteria 1684
85 Ga0068860_100000207 3300005843 Bacteria 93648
86 Ga0068860_100007584 3300005843 Bacteria 10857
87 Ga0068862_100000030 3300005844 Bacteria 182487
88 Ga0068862_100000958 3300005844 Bacteria 27782
89 Ga0068862_100206083 3300005844 Bacteria 1775
90 Ga0081455_10016939 3300005937 Bacteria 7005
91 Ga0081455_10130845 3300005937 Bacteria 1962
92 Ga0081538_10093185 3300005981 Bacteria 1548
93 Ga0075365_10001569 3300006038 Bacteria 10483
94 Ga0075365_10003033 3300006038 Bacteria 8515
95 Ga0075363_100000105 3300006048 Bacteria 19058
96 Ga0075363_100000685 3300006048 Bacteria 11415
97 Ga0075363_100002874 3300006048 Bacteria 7173
98 Ga0075363_100004240 3300006048 Bacteria 6233
99 Ga0075363_100009769 3300006048 Bacteria 4521
100 Ga0075364_10000429 3300006051 Bacteria 21031
101 Ga0075364_10002054 3300006051 Bacteria 11240
102 Ga0075364_10008915 3300006051 Bacteria 6008
103 Ga0075364_10016556 3300006051 Bacteria 4588
104 Ga0075364_10050655 3300006051 Bacteria 2711
105 Ga0070715_10023763 3300006163 Bacteria 2406
106 Ga0070716_100006291 3300006173 Bacteria 5793
107 Ga0070716_100007144 3300006173 Bacteria 5486
108 Ga0070712_100005385 3300006175 Bacteria 7921
109 Ga0070712_100018276 3300006175 Bacteria 4550
110 Ga0075362_10012950 3300006177 Bacteria 3326
111 Ga0075362_10043543 3300006177 Bacteria 1987
112 Ga0075367_10000979 3300006178 Bacteria 11687
113 Ga0075369_10003968 3300006186 Bacteria 5426
114 Ga0075369_10005809 3300006186 Bacteria 4634
115 Ga0075369_10018948 3300006186 Bacteria 2806
116 Ga0075369_10022555 3300006186 Bacteria 2597
117 Ga0075369_10053409 3300006186 Bacteria 1753
118 Ga0075369_10071116 3300006186 Bacteria 1531
119 Ga0097621_100104329 3300006237 Bacteria 2389
120 Ga0075370_10000892 3300006353 Bacteria 12223
121 Ga0075370_10018539 3300006353 Bacteria 3778
122 Ga0075370_10021326 3300006353 Bacteria 3550
123 Ga0075370_10022688 3300006353 Bacteria 3450
124 Ga0075370_10127055 3300006353 Bacteria 1486
125 Ga0068871_100060031 3300006358 Bacteria 3100
126 Ga0068871_100103636 3300006358 Bacteria 2386
127 Ga0075428_100000609 3300006844 Bacteria 36516
128 Ga0075430_100010710 3300006846 Bacteria 7772
129 Ga0075431_100061091 3300006847 Bacteria 3889
130 Ga0068865_100004001 3300006881 Bacteria 8852
131 Ga0097620_100002116 3300006931 Bacteria 20220
132 Ga0097620_100014430 3300006931 Bacteria 7928
133 Ga0099795_10004050 3300007788 Bacteria 3730
134 Ga0105250_10017687 3300009092 Bacteria 2896
135 Ga0105245_10005692 3300009098 Bacteria 10943
136 Ga0105247_10000008 3300009101 Bacteria 391450
137 Ga0105247_10000265 3300009101 Bacteria 48548
138 Ga0105247_10019046 3300009101 Bacteria 4122
139 Ga0105243_10001541 3300009148 Bacteria 20148
140 Ga0105243_10001612 3300009148 Bacteria 19634
141 Ga0105243_10167769 3300009148 Bacteria 1899
142 Ga0105243_10193948 3300009148 Bacteria 1776
143 Ga0105242_10000329 3300009176 Bacteria 38103
144 Ga0105248_10000217 3300009177 Bacteria 66541
145 Ga0105248_10003997 3300009177 Bacteria 16303
146 Ga0105248_10145599 3300009177 Bacteria 2673
147 Ga0105237_10012791 3300009545 Bacteria 8826
148 Ga0105249_10000036 3300009553 Bacteria 198578
149 Ga0105249_10000892 3300009553 Bacteria 26445
150 Ga0105249_10013956 3300009553 Bacteria 7101
151 Ga0105249_10014506 3300009553 Bacteria 6966
152 Ga0105239_10019243 3300010375 Bacteria 7541
153 Ga0105239_10058234 3300010375 Bacteria 4239
154 Ga0105239_10085448 3300010375 Bacteria 3477
155 Ga0105239_10401495 3300010375 Bacteria 1551
156 Ga0105246_10008600 3300011119 Bacteria 6277
157 Ga0157374_10022036 3300013296 Bacteria 5678
158 Ga0157374_10307494 3300013296 Bacteria 1569
159 Ga0157378_10000356 3300013297 Bacteria 45048
160 Ga0157378_10019684 3300013297 Bacteria 5934
161 Ga0163162_10002067 3300013306 Bacteria 18862
162 Ga0163162_10009917 3300013306 Bacteria 9263
163 Ga0163162_10344938 3300013306 Bacteria 1622
164 Ga0157372_10001106 3300013307 Bacteria 29308
165 Ga0157375_10000760 3300013308 Bacteria 28299
166 Ga0157375_10389158 3300013308 Bacteria 1561
167 Ga0163163_10008072 3300014325 Bacteria 9328
168 Ga0163163_10150919 3300014325 Bacteria 2367
169 Ga0157380_10001851 3300014326 Bacteria 13990
170 Ga0157380_10030651 3300014326 Bacteria 4121
171 Ga0157377_10003791 3300014745 Bacteria 6864
172 Ga0157379_10035386 3300014968 Bacteria 4452
173 Ga0157379_10112277 3300014968 Bacteria 2449
174 Ga0213876_10002493 3300021384 Bacteria 10799
175 Ga0213876_10021309 3300021384 Bacteria 3428
176 Ga0209673_1037285 3300025273 Bacteria 1430
177 Ga0209051_1000158 3300025303 Bacteria 127723
178 Ga0209051_1000706 3300025303 Bacteria 36549
179 Ga0209051_1000949 3300025303 Bacteria 28423
180 Ga0209051_1019303 3300025303 Bacteria 2980
181 Ga0207692_10004970 3300025898 Bacteria 5292
182 Ga0207642_10000993 3300025899 Bacteria 8870
183 Ga0207710_10000006 3300025900 Bacteria 538831
184 Ga0207710_10002330 3300025900 Bacteria 8875
185 Ga0207688_10000235 3300025901 Bacteria 25164
186 Ga0207688_10001745 3300025901 Bacteria 11541
187 Ga0207680_10021178 3300025903 Bacteria 3514
188 Ga0207647_10048638 3300025904 Bacteria 2633
189 Ga0207685_10001595 3300025905 Bacteria 4839
190 Ga0207645_10029822 3300025907 Bacteria 3515
191 Ga0207671_10013754 3300025914 Bacteria 6424
192 Ga0207671_10020639 3300025914 Bacteria 5011
193 Ga0207693_10008540 3300025915 Bacteria 8383
194 Ga0207693_10014667 3300025915 Bacteria 6297
195 Ga0207693_10047230 3300025915 Bacteria 3383
196 Ga0207663_10004494 3300025916 Bacteria 6942
197 Ga0207662_10053039 3300025918 Bacteria 2415
198 Ga0207681_10005867 3300025923 Bacteria 7529
199 Ga0207681_10050619 3300025923 Bacteria 2811
200 Ga0207659_10037203 3300025926 Bacteria 3378
201 Ga0207687_10002188 3300025927 Bacteria 13354
202 Ga0207644_10027049 3300025931 Bacteria 3960
203 Ga0207644_10044361 3300025931 Bacteria 3159
204 Ga0207706_10009420 3300025933 Bacteria 8966
205 Ga0207706_10017506 3300025933 Bacteria 6460
206 Ga0207686_10001775 3300025934 Bacteria 11995
207 Ga0207709_10133806 3300025935 Bacteria 1694
208 Ga0207670_10018014 3300025936 Bacteria 4282
209 Ga0207669_10003990 3300025937 Bacteria 6450
210 Ga0207704_10004093 3300025938 Bacteria 6643
211 Ga0207665_10001216 3300025939 Bacteria 17397
212 Ga0207665_10009410 3300025939 Bacteria 6410
213 Ga0207691_10059412 3300025940 Bacteria 3476
214 Ga0207711_10000184 3300025941 Bacteria 66619
215 Ga0207711_10010451 3300025941 Bacteria 7706
216 Ga0207711_10091749 3300025941 Bacteria 2672
217 Ga0207689_10030834 3300025942 Bacteria 4468
218 Ga0207712_10000036 3300025961 Bacteria 198586
219 Ga0207712_10007922 3300025961 Bacteria 6711
220 Ga0207712_10020138 3300025961 Bacteria 4366
221 Ga0207712_10150216 3300025961 Bacteria 1799
222 Ga0207668_10004026 3300025972 Bacteria 8644
223 Ga0207668_10004242 3300025972 Bacteria 8407
224 Ga0207668_10056488 3300025972 Bacteria 2734
225 Ga0207640_10087616 3300025981 Bacteria 2146
226 Ga0207658_10000102 3300025986 Bacteria 94706
227 Ga0207658_10004623 3300025986 Bacteria 9542
228 Ga0207658_10034693 3300025986 Bacteria 3607
229 Ga0207658_10057188 3300025986 Bacteria 2897
230 Ga0207658_10061903 3300025986 Bacteria 2799
231 Ga0207658_10066017 3300025986 Bacteria 2720
232 Ga0207658_10086405 3300025986 Bacteria 2419
233 Ga0207677_10012361 3300026023 Bacteria 4904
234 Ga0207677_10088735 3300026023 Bacteria 2243
235 Ga0207703_10027683 3300026035 Bacteria 4463
236 Ga0207639_10010300 3300026041 Bacteria 6471
237 Ga0207639_10011187 3300026041 Bacteria 6225
238 Ga0207678_10008422 3300026067 Bacteria 9098
239 Ga0207678_10023345 3300026067 Bacteria 5409
240 Ga0207678_10186942 3300026067 Bacteria 1770
241 Ga0207708_10002539 3300026075 Bacteria 13426
242 Ga0207708_10046208 3300026075 Bacteria 3316
243 Ga0207641_10001722 3300026088 Bacteria 21138
244 Ga0207641_10014518 3300026088 Bacteria 6456
245 Ga0207648_10009712 3300026089 Bacteria 9202
246 Ga0207648_10013633 3300026089 Bacteria 7546
247 Ga0207675_100000865 3300026118 Bacteria 30240
248 Ga0207675_100015347 3300026118 Bacteria 7146
249 Ga0207683_10000809 3300026121 Bacteria 28622
250 Ga0207683_10173794 3300026121 Bacteria 1952
251 Ga0207698_10007041 3300026142 Bacteria 7041
252 Ga0207698_10088934 3300026142 Bacteria 2520
253 Ga0268266_10004994 3300028379 Bacteria 12538
254 Ga0268266_10012439 3300028379 Bacteria 7357
255 Ga0268266_10028704 3300028379 Bacteria 4729
256 Ga0268266_10194763 3300028379 Bacteria 1852
257 Ga0268265_10000038 3300028380 Bacteria 198640
258 Ga0268265_10123682 3300028380 Bacteria 2136
259 Ga0268264_10000263 3300028381 Bacteria 93754
260 Ga0268264_10022877 3300028381 Bacteria 5099
261 Ga0265327_10000125 3300031251 Bacteria 167832
262 Ga0265327_10000454 3300031251 Bacteria 73503
263 Ga0265327_10000912 3300031251 Bacteria 43333
264 Ga0265327_10003691 3300031251 Bacteria 14308
265 Ga0307405_10140483 3300031731 Bacteria 1683
266 Ga0307405_10153586 3300031731 Bacteria 1622
267 Ga0307410_10001796 3300031852 Bacteria 9946
268 Ga0307407_10037106 3300031903 Bacteria 2691
269 Ga0307407_10072542 3300031903 Bacteria 2054
270 Ga0307416_100026770 3300032002 Bacteria 4256
271 Ga0307415_100130036 3300032126 Bacteria 1904
272 Ga0373931_0106997 3300035691 Bacteria 1581
273 Ga0316584_0302658 3300036712 Bacteria 1157
274 Ga0395900_0137872 3300037418 Bacteria 2500
275 Ga0436364_0041310 3300037853 Bacteria 14305
276 Ga0436364_0149565 3300037853 Bacteria 12057
277 Ga0436365_0546930 3300039437 Bacteria 18880
278 Ga0436365_0793443 3300039437 Bacteria 2387
279 Ga0436365_1061792 3300039437 Bacteria 46945
280 Ga0436361_1005246 3300039447 Bacteria 1221
281 Ga0436363_0791519 3300039450 Bacteria 2366
282 Ga0439461_0000666 3300041410 Bacteria 4970
283 Ga0439466_0013595 3300041411 Bacteria 2977
284 Ga0439465_0000054 3300041413 Bacteria 24159
285 Ga0439465_0022786 3300041413 Bacteria 1968
286 Ga0451789_1092202 3300041443 Bacteria 1510
287 Ga0451795_0794350 3300041456 Bacteria 1914
288 Ga0439431_0000977 3300041997 Bacteria 6211
289 Ga0439431_0009385 3300041997 Bacteria 2210
290 Ga0439434_0017589 3300042435 Bacteria 2139
291 Ga0466969_0042068 3300044656 Bacteria 2283
292 Ga0466972_0001579 3300044658 Bacteria 11120
293 Ga0466972_0016284 3300044658 Bacteria 3715
294 Ga0466972_0030085 3300044658 Bacteria 2673
295 Ga0466972_0097468 3300044658 Bacteria 1392
296 Ga0466965_0008416 3300044683 Bacteria 4774
297 Ga0466966_0004929 3300044684 Bacteria 8779
298 Ga0466966_0007287 3300044684 Bacteria 7330
299 Ga0466966_0011178 3300044684 Bacteria 5955
300 Ga0466966_0031084 3300044684 Bacteria 3462
301 Ga0466961_0010419 3300044693 Bacteria 5932
302 Ga0466961_0016498 3300044693 Bacteria 4745
303 Ga0466961_0035752 3300044693 Bacteria 3189
304 Ga0466964_0026804 3300044706 Bacteria 2258
305 Ga0466964_0097572 3300044706 Bacteria 1290
306 Ga0466971_0004566 3300044719 Bacteria 5986
307 Ga0466971_0034419 3300044719 Bacteria 2270
308 Ga0466968_0000462 3300044735 Bacteria 13702
309 Ga0466968_0004440 3300044735 Bacteria 5248
310 Ga0466968_0006629 3300044735 Bacteria 4373
311 Ga0466968_0045029 3300044735 Bacteria 1872
312 Ga0466968_0066351 3300044735 Bacteria 1563
313 Ga0466970_0009535 3300044765 Bacteria 4910
314 Ga0466970_0079124 3300044765 Bacteria 1774
315 Ga0466970_0211416 3300044765 Bacteria 1081
316 Ga0466957_0010475 3300044842 Bacteria 5328
317 Ga0466957_0061768 3300044842 Bacteria 2300
318 Ga0466960_0000254 3300044901 Bacteria 18334
319 Ga0466960_0000799 3300044901 Bacteria 11049
320 Ga0466959_0000771 3300045049 Bacteria 18752
321 Ga0466959_0036815 3300045049 Bacteria 3615
322 Ga0466959_0043093 3300045049 Bacteria 3328
323 Ga0466958_0012039 3300045836 Bacteria 4888
324 Ga0466958_0028861 3300045836 Bacteria 3292
325 Ga0466967_0010693 3300045976 Bacteria 6900
326 Ga0466967_0035878 3300045976 Bacteria 4226
327 Ga0466967_0039999 3300045976 Bacteria 4034
328 Ga0466967_0045913 3300045976 Bacteria 3800
329 Ga0466967_0047843 3300045976 Bacteria 3731
330 Ga0466967_0065229 3300045976 Bacteria 3240
331 Ga0466967_0096979 3300045976 Bacteria 2691
332 Ga0466967_0253004 3300045976 Bacteria 1683
333 Ga0495638_0018211 3300046460 Bacteria 4667
334 Ga0495638_0026813 3300046460 Bacteria 3733
335 Ga0495630_0088939 3300046517 Bacteria 2333
336 Ga0495676_0156710 3300047321 Bacteria 1615
337 Ga0495673_0000588 3300047469 Bacteria 36483
338 Ga0495686_0002574 3300047472 Bacteria 16882
339 Ga0495593_0021854 3300047673 Bacteria 3570
340 Ga0496100_0000026 3300048903 Bacteria 115873
341 Ga0496100_0001032 3300048903 Bacteria 13463
342 Ga0496100_0004301 3300048903 Bacteria 7536
343 Ga0496100_0095380 3300048903 Bacteria 2039
344 Ga0496100_0158515 3300048903 Bacteria 1620
345 Ga0496100_0303308 3300048903 Bacteria 1196
346 Ga0496101_0000002 3300048904 Bacteria 410971
347 Ga0496101_0000015 3300048904 Bacteria 252368
348 Ga0496101_0000176 3300048904 Bacteria 51135
349 Ga0496101_0002738 3300048904 Bacteria 10819
350 Ga0496101_0019400 3300048904 Bacteria 4642
351 Ga0496101_0031686 3300048904 Bacteria 3718
352 Ga0496102_0000009 3300048905 Bacteria 344149
353 Ga0496102_0000309 3300048905 Bacteria 62179
354 Ga0496102_0002494 3300048905 Bacteria 15714
355 Ga0496102_0003741 3300048905 Bacteria 12859
356 Ga0496102_0031027 3300048905 Bacteria 4789
357 Ga0496102_0045770 3300048905 Bacteria 3973
358 Ga0496102_0058147 3300048905 Bacteria 3532
359 Ga0496102_0181172 3300048905 Bacteria 1985
360 Ga0496102_0214553 3300048905 Bacteria 1814
361 Ga0496103_0000005 3300048906 Bacteria 505416
362 Ga0496103_0000542 3300048906 Bacteria 30319
363 Ga0496103_0002077 3300048906 Bacteria 12795
364 Ga0496103_0020654 3300048906 Bacteria 3957
365 Ga0496103_0131316 3300048906 Bacteria 1599
366 Ga0496103_0139610 3300048906 Bacteria 1549
367 Ga0496104_0000793 3300048907 Bacteria 27078
368 Ga0496104_0003046 3300048907 Bacteria 14441
369 Ga0496104_0181179 3300048907 Bacteria 2017
370 Ga0496105_0009360 3300048908 Bacteria 7660
371 Ga0496106_0001063 3300048909 Bacteria 20256
372 Ga0496106_0002417 3300048909 Bacteria 13913
373 Ga0496106_0004939 3300048909 Bacteria 9864
374 Ga0496106_0065228 3300048909 Bacteria 2772
375 Ga0496107_0000667 3300048910 Bacteria 19446
376 Ga0496107_0004005 3300048910 Bacteria 9921
377 Ga0496107_0014634 3300048910 Bacteria 5493
378 Ga0496108_0000189 3300048911 Bacteria 57428
379 Ga0496108_0014606 3300048911 Bacteria 6410
380 Ga0496108_0084019 3300048911 Bacteria 2701
381 Ga0496109_0000022 3300048912 Bacteria 188901
382 Ga0496109_0007174 3300048912 Bacteria 9417
383 Ga0496109_0043871 3300048912 Bacteria 4054
384 Ga0496109_0111488 3300048912 Bacteria 2544
385 Ga0496109_0218958 3300048912 Bacteria 1790
386 Ga0496109_0303321 3300048912 Bacteria 1506
387 Ga0496110_0017796 3300048913 Bacteria 5947
388 Ga0496110_0019055 3300048913 Bacteria 5768
389 Ga0496110_0044317 3300048913 Bacteria 3885
390 Ga0496110_0070155 3300048913 Bacteria 3104
391 Ga0496110_0164592 3300048913 Bacteria 2011
392 Ga0496111_0026381 3300048914 Bacteria 4102
393 Ga0496111_0100540 3300048914 Bacteria 2124
394 Ga0496111_0161768 3300048914 Bacteria 1662
395 Ga0496112_0013366 3300048915 Bacteria 7579
396 Ga0496112_0016658 3300048915 Bacteria 6891
397 Ga0496113_0025204 3300048916 Bacteria 4237
398 Ga0496113_0132347 3300048916 Bacteria 1958
399 Ga0496114_0000368 3300048917 Bacteria 33141
400 Ga0496114_0000761 3300048917 Bacteria 24061
401 Ga0496114_0002853 3300048917 Bacteria 13246
402 Ga0496114_0070750 3300048917 Bacteria 2931
403 Ga0496114_0492807 3300048917 Bacteria 1084
404 Ga0496115_0000346 3300048918 Bacteria 39328
405 Ga0496115_0011466 3300048918 Bacteria 6646
406 Ga0496115_0142258 3300048918 Bacteria 1979
407 Ga0496115_0150620 3300048918 Bacteria 1921
408 Ga0496116_0000104 3300048919 Bacteria 193416
409 Ga0496116_0015653 3300048919 Bacteria 5986
410 Ga0496116_0039928 3300048919 Bacteria 3237
411 Ga0496117_0000019 3300048920 Bacteria 469256
412 Ga0496117_0006672 3300048920 Bacteria 11564
413 Ga0496117_0033218 3300048920 Bacteria 3904
414 Ga0496118_0000020 3300048921 Bacteria 470521
415 Ga0496118_0014446 3300048921 Bacteria 7393
416 Ga0496118_0041104 3300048921 Bacteria 3665
417 Ga0496119_0005333 3300048922 Bacteria 12370
418 Ga0496119_0014803 3300048922 Bacteria 6069
419 Ga0496119_0073424 3300048922 Bacteria 1995
420 Ga0496120_0011949 3300048923 Bacteria 5939
421 Ga0496120_0016994 3300048923 Bacteria 4732
422 Ga0496120_0023571 3300048923 Bacteria 3851
423 Ga0496121_0000004 3300048924 Bacteria 1139011
424 Ga0496121_0000064 3300048924 Bacteria 272488
425 Ga0496121_0019091 3300048924 Bacteria 6876
426 Ga0496122_0000257 3300048925 Bacteria 120176
427 Ga0496123_0005326 3300048926 Bacteria 13012
428 Ga0496123_0009542 3300048926 Bacteria 8727
429 Ga0496124_0000012 3300048927 Bacteria 512581
430 Ga0496125_0000003 3300048928 Bacteria 1189767
431 Ga0496126_0000001 3300048929 Bacteria 1139011
432 Ga0496126_0000509 3300048929 Bacteria 76308
433 Ga0496126_0003149 3300048929 Bacteria 21263
434 Ga0501032_0001460 3300049569 Bacteria 18792
435 Ga0501032_0021479 3300049569 Bacteria 4486
436 Ga0501032_0040705 3300049569 Bacteria 3158
437 Ga0501033_0086362 3300049570 Bacteria 2297
438 Ga0501033_0121488 3300049570 Bacteria 1895
439 Ga0501034_0030072 3300049571 Bacteria 5521
440 Ga0501034_0090251 3300049571 Bacteria 3062
441 Ga0501034_0134056 3300049571 Bacteria 2459
442 Ga0501036_0026838 3300049572 Bacteria 4866
443 Ga0501036_0149204 3300049572 Bacteria 1972
444 Ga0501037_0000099 3300049573 Bacteria 81092
445 Ga0501038_0007897 3300049574 Bacteria 9807
446 Ga0501039_0009118 3300049575 Bacteria 7560
447 Ga0501043_0007592 3300049579 Bacteria 8598
448 Ga0501043_0156339 3300049579 Bacteria 1783
449 Ga0501047_0030658 3300049581 Bacteria 5184
450 Ga0501047_0032951 3300049581 Bacteria 5003
451 Ga0501047_0044334 3300049581 Bacteria 4297
452 Ga0501048_0030898 3300049582 Bacteria 3876
453 Ga0501069_0099607 3300049585 Bacteria 1649
454 Ga0501070_0002228 3300049586 Bacteria 17032
455 Ga0501070_0005465 3300049586 Bacteria 10846
456 Ga0501073_0015047 3300049589 Bacteria 5612
457 Ga0501077_0060634 3300049593 Bacteria 2401
458 Ga0501035_0009385 3300049822 Bacteria 9096
459 Ga0501035_0043605 3300049822 Bacteria 4041
460 Ga0501044_0003790 3300049823 Bacteria 16980
461 Ga0501044_0030548 3300049823 Bacteria 5677
462 Ga0501044_0053499 3300049823 Bacteria 4153
463 nmdc:mga03683_3262_c1 3300050489 Bacteria 3039
464 nmdc:mga03n38_1070_c1 3300050490 Bacteria 7556
465 nmdc:mga03n38_14355_c1 3300050490 Bacteria 3034
466 nmdc:mga03n38_16053_c1 3300050490 Bacteria 2906
467 nmdc:mga03n38_717_c1 3300050490 Bacteria 8705
468 nmdc:mga03n38_9463_c1 3300050490 Bacteria 3548
469 nmdc:mga00v17_15037_c1 3300050491 Bacteria 4337
470 nmdc:mga00v17_1663_c1 3300050491 Bacteria 11578
471 nmdc:mga00v17_19683_c1 3300050491 Bacteria 3859
472 nmdc:mga00v17_36398_c1 3300050491 Bacteria 2933
473 nmdc:mga00v17_76025_c1 3300050491 Bacteria 2089
474 nmdc:mga0yw44_109252_c1 3300050492 Bacteria 1770
475 nmdc:mga0yw44_45410_c1 3300050492 Bacteria 2633
476 nmdc:mga0yw44_6179_c1 3300050492 Bacteria 5759
477 nmdc:mga0yw44_7811_c1 3300050492 Bacteria 5291
478 nmdc:mga06z11_37635_c1 3300050494 Bacteria 2397
479 nmdc:mga07m45_176351_c1 3300050496 Bacteria 1243
480 nmdc:mga07m45_3576_c1 3300050496 Bacteria 7509
481 nmdc:mga07m45_5657_c1 3300050496 Bacteria 6248
482 nmdc:mga07m45_56693_c1 3300050496 Bacteria 2215
483 nmdc:mga07m45_7635_c1 3300050496 Bacteria 5533
484 nmdc:mga0qj67_14319_c1 3300050509 Bacteria 5993
485 nmdc:mga06r32_58109_c1 3300050510 Bacteria 3717
486 nmdc:mga0sz30_2565_c1 3300050516 Bacteria 6470
487 nmdc:mga0sz30_3908_c1 3300050516 Bacteria 5370
488 nmdc:mga0sz30_62291_c1 3300050516 Bacteria 1595
489 Ga0500635_0002266 3300053080 Bacteria 4740
490 Ga0500643_004472 3300053087 Bacteria 6316
491 Ga0500643_011158 3300053087 Bacteria 3296
492 Ga0500652_001095 3300053131 Bacteria 8743
493 Ga0500652_011481 3300053131 Bacteria 3070
494 Ga0500616_0029020 3300053153 Bacteria 3046
495 Ga0500627_0017218 3300053158 Bacteria 2835
496 Ga0500645_000023 3300053730 Bacteria 128995
497 Ga0466962_0016687 3300061719 Bacteria 3541
498 Ga0466962_0030658 3300061719 Bacteria 2576
499 Ga0466962_0057726 3300061719 Bacteria 1853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0030548 Ga0501044_0030548_2650_3594 311
2 3300044719 Ga0466971_0034419 Ga0466971_0034419_13_951 312
3 3300044706 Ga0466964_0026804 Ga0466964_0026804_1120_2064 314
4 3300013308 Ga0157375_10389158 Ga0157375_103891582 329
5 3300009148 Ga0105243_10167769 Ga0105243_101677692 330
6 3300009177 Ga0105248_10145599 Ga0105248_101455992 330
7 3300009553 Ga0105249_10013956 Ga0105249_100139563 330
8 3300013306 Ga0163162_10344938 Ga0163162_103449382 330
9 3300037418 Ga0395900_0137872 Ga0395900_0137872_85_1077 330
10 3300039447 Ga0436361_1005246 Ga0436361_1005246_12_1004 330
11 3300041413 Ga0439465_0022786 Ga0439465_0022786_921_1913 330
12 3300044658 Ga0466972_0016284 Ga0466972_0016284_2023_3015 330
13 3300044658 Ga0466972_0097468 Ga0466972_0097468_35_1027 330
14 3300044683 Ga0466965_0008416 Ga0466965_0008416_732_1724 330
15 3300044684 Ga0466966_0007287 Ga0466966_0007287_2698_3690 330
16 3300044684 Ga0466966_0011178 Ga0466966_0011178_3961_4953 330
17 3300044693 Ga0466961_0016498 Ga0466961_0016498_2887_3879 330
18 3300044693 Ga0466961_0035752 Ga0466961_0035752_1992_2984 330
19 3300044706 Ga0466964_0097572 Ga0466964_0097572_56_1048 330
20 3300044719 Ga0466971_0004566 Ga0466971_0004566_3767_4759 330
21 3300044735 Ga0466968_0004440 Ga0466968_0004440_2987_3979 330
22 3300044765 Ga0466970_0079124 Ga0466970_0079124_353_1345 330
23 3300045049 Ga0466959_0043093 Ga0466959_0043093_1010_2002 330
24 3300045836 Ga0466958_0012039 Ga0466958_0012039_3478_4470 330
25 3300045836 Ga0466958_0028861 Ga0466958_0028861_1731_2723 330
26 3300045976 Ga0466967_0039999 Ga0466967_0039999_2463_3455 330
27 3300045976 Ga0466967_0045913 Ga0466967_0045913_355_1347 330
28 3300045976 Ga0466967_0047843 Ga0466967_0047843_1329_2321 330
29 3300048903 Ga0496100_0004301 Ga0496100_0004301_5431_6423 330
30 3300048904 Ga0496101_0000176 Ga0496101_0000176_14745_15737 330
31 3300048905 Ga0496102_0181172 Ga0496102_0181172_77_1069 330
32 3300048906 Ga0496103_0139610 Ga0496103_0139610_207_1199 330
33 3300048907 Ga0496104_0000793 Ga0496104_0000793_11324_12316 330
34 3300048908 Ga0496105_0009360 Ga0496105_0009360_859_1851 330
35 3300048909 Ga0496106_0001063 Ga0496106_0001063_15887_16879 330
36 3300048912 Ga0496109_0007174 Ga0496109_0007174_5362_6354 330
37 3300048913 Ga0496110_0044317 Ga0496110_0044317_2568_3560 330
38 3300048915 Ga0496112_0016658 Ga0496112_0016658_3176_4168 330
39 3300048917 Ga0496114_0002853 Ga0496114_0002853_6587_7579 330
40 3300048918 Ga0496115_0142258 Ga0496115_0142258_290_1282 330
41 3300049823 Ga0501044_0053499 Ga0501044_0053499_3072_4064 330
42 3300050491 nmdc:mga00v17_76025_c1 nmdc:mga00v17_76025_c1_49_1041 330
43 3300050496 nmdc:mga07m45_176351_c1 nmdc:mga07m45_176351_c1_53_1045 330
44 3300061719 Ga0466962_0016687 Ga0466962_0016687_1083_2075 330
45 3300006048 Ga0075363_100000105 Ga0075363_1000001057 332
46 3300006051 Ga0075364_10008915 Ga0075364_100089154 332
47 3300006186 Ga0075369_10005809 Ga0075369_100058092 332
48 3300006353 Ga0075370_10022688 Ga0075370_100226882 332
49 3300044658 Ga0466972_0030085 Ga0466972_0030085_203_1201 332
50 3300044735 Ga0466968_0006629 Ga0466968_0006629_203_1201 332
51 3300044765 Ga0466970_0009535 Ga0466970_0009535_748_1746 332
52 3300045049 Ga0466959_0036815 Ga0466959_0036815_1302_2300 332
53 3300050490 nmdc:mga03n38_1070_c1 nmdc:mga03n38_1070_c1_3194_4192 332
54 3300050491 nmdc:mga00v17_15037_c1 nmdc:mga00v17_15037_c1_14_1012 332
55 3300050492 nmdc:mga0yw44_109252_c1 nmdc:mga0yw44_109252_c1_483_1481 332
56 3300050496 nmdc:mga07m45_5657_c1 nmdc:mga07m45_5657_c1_2832_3830 332
57 3300031251 Ga0265327_10000454 Ga0265327_1000045425 334
58 3300014325 Ga0163163_10150919 Ga0163163_101509193 338
59 3300039437 Ga0436365_0546930 Ga0436365_0546930_17210_18226 338
60 3300044735 Ga0466968_0045029 Ga0466968_0045029_843_1859 338
61 3300044735 Ga0466968_0066351 Ga0466968_0066351_429_1445 338
62 3300044765 Ga0466970_0211416 Ga0466970_0211416_18_1034 338
63 3300046460 Ga0495638_0018211 Ga0495638_0018211_2508_3524 338
64 3300048903 Ga0496100_0303308 Ga0496100_0303308_54_1070 338
65 3300048911 Ga0496108_0084019 Ga0496108_0084019_1647_2663 338
66 3300048912 Ga0496109_0043871 Ga0496109_0043871_2309_3325 338
67 3300048912 Ga0496109_0303321 Ga0496109_0303321_112_1128 338
68 3300048913 Ga0496110_0164592 Ga0496110_0164592_373_1389 338
69 3300048914 Ga0496111_0100540 Ga0496111_0100540_1047_2063 338
70 3300048916 Ga0496113_0132347 Ga0496113_0132347_642_1658 338
71 3300049570 Ga0501033_0086362 Ga0501033_0086362_72_1088 338
72 3300049570 Ga0501033_0121488 Ga0501033_0121488_681_1697 338
73 3300050490 nmdc:mga03n38_9463_c1 nmdc:mga03n38_9463_c1_1613_2629 338
74 3300053087 Ga0500643_011158 Ga0500643_011158_779_1795 338
75 3300053131 Ga0500652_011481 Ga0500652_011481_691_1707 338
76 3300053158 Ga0500627_0017218 Ga0500627_0017218_782_1798 338
77 3300048904 Ga0496101_0019400 Ga0496101_0019400_1781_2812 343
78 3300048905 Ga0496102_0000309 Ga0496102_0000309_59393_60424 343
79 3300048905 Ga0496102_0045770 Ga0496102_0045770_2881_3912 343
80 3300048906 Ga0496103_0020654 Ga0496103_0020654_2081_3112 343
81 3300048917 Ga0496114_0492807 Ga0496114_0492807_40_1071 343
82 3300048919 Ga0496116_0039928 Ga0496116_0039928_1232_2263 343
83 3300048920 Ga0496117_0033218 Ga0496117_0033218_1769_2800 343
84 3300048921 Ga0496118_0041104 Ga0496118_0041104_1773_2804 343
85 3300048922 Ga0496119_0014803 Ga0496119_0014803_3280_4311 343
86 3300048923 Ga0496120_0011949 Ga0496120_0011949_2137_3168 343
87 3300048924 Ga0496121_0019091 Ga0496121_0019091_4065_5096 343
88 3300050491 nmdc:mga00v17_1663_c1 nmdc:mga00v17_1663_c1_3251_4384 353
89 3300014325 Ga0163163_10008072 Ga0163163_100080727 361
90 3300036712 Ga0316584_0302658 Ga0316584_0302658_12_1097 361
91 3300048905 Ga0496102_0002494 Ga0496102_0002494_2413_3498 361
92 3300048906 Ga0496103_0002077 Ga0496103_0002077_1628_2713 361
93 3300048922 Ga0496119_0005333 Ga0496119_0005333_8653_9738 361
94 3300050494 nmdc:mga06z11_37635_c1 nmdc:mga06z11_37635_c1_33_1118 361
95 iso_pu_bacteria 2738541308 2738886717 366
96 iso_pu_bacteria 2870782633 2870789933 366
97 3300044684 Ga0466966_0031084 Ga0466966_0031084_241_1347 368
98 3300049569 Ga0501032_0021479 Ga0501032_0021479_3187_4293 368
99 3300049571 Ga0501034_0090251 Ga0501034_0090251_10_1116 368
100 3300049582 Ga0501048_0030898 Ga0501048_0030898_2546_3652 368
101 3300049585 Ga0501069_0099607 Ga0501069_0099607_456_1562 368
102 3300049586 Ga0501070_0002228 Ga0501070_0002228_14391_15497 368
103 3300049822 Ga0501035_0043605 Ga0501035_0043605_806_1912 368
104 iso_pu_bacteria 2643221687 2644490509 368
105 iso_pu_bacteria 2902837492 2902839661 368
106 3300048917 Ga0496114_0070750 Ga0496114_0070750_536_1648 369
107 iso_pu_bacteria 2738541274 2738702380 369
108 iso_pu_bacteria 2738543028 2739331635 369
109 iso_pu_bacteria 2902799365 2902802659 369
110 3300005844 Ga0068862_100206083 Ga0068862_1002060833 370
111 3300009553 Ga0105249_10014506 Ga0105249_100145063 370
112 3300025961 Ga0207712_10020138 Ga0207712_100201381 370
113 3300049581 Ga0501047_0032951 Ga0501047_0032951_3443_4558 370
114 3300049571 Ga0501034_0134056 Ga0501034_0134056_1231_2346 371
115 3300049581 Ga0501047_0030658 Ga0501047_0030658_3599_4714 371
116 3300003792 Ga0055540_1000913 Ga0055540_100091316 372
117 3300003792 Ga0055540_1003234 Ga0055540_10032347 372
118 3300003792 Ga0055540_1015201 Ga0055540_10152011 372
119 3300005337 Ga0070682_100161188 Ga0070682_1001611881 372
120 3300006186 Ga0075369_10053409 Ga0075369_100534092 372
121 3300025273 Ga0209673_1037285 Ga0209673_10372852 372
122 3300025303 Ga0209051_1000706 Ga0209051_10007069 372
123 3300025303 Ga0209051_1000949 Ga0209051_100094919 372
124 3300025303 Ga0209051_1019303 Ga0209051_10193034 372
125 3300041443 Ga0451789_1092202 Ga0451789_1092202_167_1285 372
126 3300041456 Ga0451795_0794350 Ga0451795_0794350_453_1571 372
127 3300050492 nmdc:mga0yw44_45410_c1 nmdc:mga0yw44_45410_c1_1072_2190 372
128 3300050516 nmdc:mga0sz30_62291_c1 nmdc:mga0sz30_62291_c1_332_1450 372
129 3300006186 Ga0075369_10003968 Ga0075369_100039683 373
130 3300031251 Ga0265327_10000125 Ga0265327_10000125114 373
131 3300050492 nmdc:mga0yw44_7811_c1 nmdc:mga0yw44_7811_c1_1047_2168 373
132 3300053080 Ga0500635_0002266 Ga0500635_0002266_2922_4067 373
133 3300053131 Ga0500652_001095 Ga0500652_001095_722_1867 373
134 3300053730 Ga0500645_000023 Ga0500645_000023_12827_13948 373
135 iso_pu_bacteria 2643221715 2644639255 373
136 iso_pu_bacteria 2902810491 2902816086 373
137 iso_pu_bacteria 2939582691 2939589206 373
138 3300031251 Ga0265327_10003691 Ga0265327_100036915 374
139 3300037853 Ga0436364_0041310 Ga0436364_0041310_8565_9689 374
140 3300039437 Ga0436365_0793443 Ga0436365_0793443_255_1379 374
141 iso_pu_bacteria 2929212328 2929212890 374
142 iso_pu_bacteria 2738541264 2738667955 375
143 iso_pu_bacteria 2738541356 2739147025 375
144 3300031731 Ga0307405_10140483 Ga0307405_101404832 376
145 3300031903 Ga0307407_10037106 Ga0307407_100371062 376
146 3300041410 Ga0439461_0000666 Ga0439461_0000666_2896_4029 376
147 3300041997 Ga0439431_0000977 Ga0439431_0000977_4013_5146 376
148 3300044658 Ga0466972_0001579 Ga0466972_0001579_3176_4309 376
149 3300044735 Ga0466968_0000462 Ga0466968_0000462_7573_8706 376
150 3300044842 Ga0466957_0061768 Ga0466957_0061768_443_1576 376
151 3300044901 Ga0466960_0000254 Ga0466960_0000254_16823_17956 376
152 3300044901 Ga0466960_0000799 Ga0466960_0000799_6433_7563 376
153 3300045049 Ga0466959_0000771 Ga0466959_0000771_14653_15786 376
154 3300045976 Ga0466967_0010693 Ga0466967_0010693_2831_3961 376
155 3300045976 Ga0466967_0065229 Ga0466967_0065229_2092_3222 376
156 3300045976 Ga0466967_0096979 Ga0466967_0096979_1331_2464 376
157 3300048904 Ga0496101_0031686 Ga0496101_0031686_1329_2462 376
158 3300048922 Ga0496119_0073424 Ga0496119_0073424_600_1733 376
159 3300048926 Ga0496123_0005326 Ga0496123_0005326_4638_5771 376
160 3300061719 Ga0466962_0030658 Ga0466962_0030658_419_1549 376
161 3300061719 Ga0466962_0057726 Ga0466962_0057726_246_1379 376
162 iso_pu_bacteria 2902792274 2902794097 376
163 3300005434 Ga0070709_10019293 Ga0070709_100192933 377
164 3300005435 Ga0070714_100094294 Ga0070714_1000942941 377
165 3300005937 Ga0081455_10130845 Ga0081455_101308454 377
166 3300009148 Ga0105243_10001612 Ga0105243_100016127 377
167 3300021384 Ga0213876_10002493 Ga0213876_100024939 377
168 3300021384 Ga0213876_10021309 Ga0213876_100213092 377
169 3300037853 Ga0436364_0149565 Ga0436364_0149565_8463_9596 377
170 3300039437 Ga0436365_1061792 Ga0436365_1061792_3384_4517 377
171 3300039450 Ga0436363_0791519 Ga0436363_0791519_874_2007 377
172 3300044656 Ga0466969_0042068 Ga0466969_0042068_488_1621 377
173 3300044684 Ga0466966_0004929 Ga0466966_0004929_3626_4759 377
174 3300044693 Ga0466961_0010419 Ga0466961_0010419_3583_4716 377
175 3300044842 Ga0466957_0010475 Ga0466957_0010475_4060_5193 377
176 3300048921 Ga0496118_0014446 Ga0496118_0014446_3374_4507 377
177 3300048929 Ga0496126_0003149 Ga0496126_0003149_12464_13597 377
178 3300049569 Ga0501032_0040705 Ga0501032_0040705_397_1530 377
179 3300049572 Ga0501036_0149204 Ga0501036_0149204_772_1905 377
180 3300049581 Ga0501047_0044334 Ga0501047_0044334_2571_3704 377
181 3300049822 Ga0501035_0009385 Ga0501035_0009385_4003_5136 377
182 3300049823 Ga0501044_0003790 Ga0501044_0003790_13530_14663 377
183 3300005548 Ga0070665_100389696 Ga0070665_1003896961 378
184 3300028379 Ga0268266_10194763 Ga0268266_101947631 378
185 3300045976 Ga0466967_0253004 Ga0466967_0253004_208_1344 378
186 3300003792 Ga0055540_1000207 Ga0055540_100020739 379
187 3300005354 Ga0070675_100202245 Ga0070675_1002022452 379
188 3300005367 Ga0070667_100000549 Ga0070667_10000054910 379
189 3300005456 Ga0070678_100090734 Ga0070678_1000907342 379
190 3300006048 Ga0075363_100009769 Ga0075363_1000097693 379
191 3300010375 Ga0105239_10085448 Ga0105239_100854484 379
192 3300010375 Ga0105239_10401495 Ga0105239_104014952 379
193 3300025303 Ga0209051_1000158 Ga0209051_1000158107 379
194 3300025903 Ga0207680_10021178 Ga0207680_100211783 379
195 3300025914 Ga0207671_10013754 Ga0207671_100137545 379
196 3300025915 Ga0207693_10047230 Ga0207693_100472302 379
197 3300025986 Ga0207658_10004623 Ga0207658_100046239 379
198 3300026023 Ga0207677_10088735 Ga0207677_100887352 379
199 3300026067 Ga0207678_10023345 Ga0207678_100233453 379
200 3300026121 Ga0207683_10173794 Ga0207683_101737942 379
201 3300031251 Ga0265327_10000912 Ga0265327_1000091229 379
202 3300046517 Ga0495630_0088939 Ga0495630_0088939_675_1814 379
203 3300047321 Ga0495676_0156710 Ga0495676_0156710_371_1510 379
204 3300047673 Ga0495593_0021854 Ga0495593_0021854_571_1710 379
205 3300048903 Ga0496100_0000026 Ga0496100_0000026_15719_16858 379
206 3300048904 Ga0496101_0000015 Ga0496101_0000015_233674_234813 379
207 3300048909 Ga0496106_0004939 Ga0496106_0004939_1527_2666 379
208 3300048910 Ga0496107_0004005 Ga0496107_0004005_7075_8214 379
209 3300048911 Ga0496108_0014606 Ga0496108_0014606_4148_5287 379
210 3300048912 Ga0496109_0000022 Ga0496109_0000022_185775_186914 379
211 3300048913 Ga0496110_0017796 Ga0496110_0017796_1071_2210 379
212 3300048914 Ga0496111_0026381 Ga0496111_0026381_970_2109 379
213 3300048917 Ga0496114_0000368 Ga0496114_0000368_11181_12320 379
214 3300048918 Ga0496115_0011466 Ga0496115_0011466_2538_3677 379
215 3300048919 Ga0496116_0015653 Ga0496116_0015653_4006_5145 379
216 3300048920 Ga0496117_0006672 Ga0496117_0006672_1575_2714 379
217 3300048923 Ga0496120_0023571 Ga0496120_0023571_1595_2734 379
218 3300048924 Ga0496121_0000004 Ga0496121_0000004_768804_769943 379
219 3300048925 Ga0496122_0000257 Ga0496122_0000257_17528_18667 379
220 3300048926 Ga0496123_0009542 Ga0496123_0009542_5899_7038 379
221 3300048927 Ga0496124_0000012 Ga0496124_0000012_493597_494736 379
222 3300048928 Ga0496125_0000003 Ga0496125_0000003_419825_420964 379
223 3300048929 Ga0496126_0000001 Ga0496126_0000001_768804_769943 379
224 3300001978 JGI24747J21853_1001999 JGI24747J21853_10019991 380
225 3300001991 JGI24743J22301_10008347 JGI24743J22301_100083472 380
226 3300002073 JGI24745J21846_1000833 JGI24745J21846_10008331 380
227 3300002075 JGI24738J21930_10013340 JGI24738J21930_100133402 380
228 3300002076 JGI24749J21850_1001430 JGI24749J21850_10014305 380
229 3300002077 JGI24744J21845_10000539 JGI24744J21845_100005397 380
230 3300002077 JGI24744J21845_10003218 JGI24744J21845_100032185 380
231 3300002239 JGI24034J26672_10001158 JGI24034J26672_100011582 380
232 3300002244 JGI24742J22300_10000756 JGI24742J22300_100007563 380
233 3300002459 JGI24751J29686_10015418 JGI24751J29686_100154182 380
234 3300005328 Ga0070676_10005410 Ga0070676_100054102 380
235 3300005330 Ga0070690_100003998 Ga0070690_1000039982 380
236 3300005334 Ga0068869_100009419 Ga0068869_1000094192 380
237 3300005338 Ga0068868_100017004 Ga0068868_1000170042 380
238 3300005343 Ga0070687_100021525 Ga0070687_1000215252 380
239 3300005343 Ga0070687_100084715 Ga0070687_1000847151 380
240 3300005345 Ga0070692_10033191 Ga0070692_100331912 380
241 3300005347 Ga0070668_100000533 Ga0070668_10000053312 380
242 3300005347 Ga0070668_100012064 Ga0070668_1000120645 380
243 3300005353 Ga0070669_100016152 Ga0070669_1000161524 380
244 3300005353 Ga0070669_100033426 Ga0070669_1000334264 380
245 3300005355 Ga0070671_100007032 Ga0070671_1000070326 380
246 3300005355 Ga0070671_100017910 Ga0070671_1000179105 380
247 3300005355 Ga0070671_100108748 Ga0070671_1001087482 380
248 3300005364 Ga0070673_100069288 Ga0070673_1000692881 380
249 3300005365 Ga0070688_100013315 Ga0070688_1000133152 380
250 3300005365 Ga0070688_100081132 Ga0070688_1000811321 380
251 3300005366 Ga0070659_100018434 Ga0070659_1000184342 380
252 3300005366 Ga0070659_100251912 Ga0070659_1002519122 380
253 3300005367 Ga0070667_100004882 Ga0070667_1000048826 380
254 3300005367 Ga0070667_100009437 Ga0070667_1000094374 380
255 3300005367 Ga0070667_100045631 Ga0070667_1000456312 380
256 3300005367 Ga0070667_100255860 Ga0070667_1002558602 380
257 3300005367 Ga0070667_100314559 Ga0070667_1003145592 380
258 3300005437 Ga0070710_10002894 Ga0070710_100028947 380
259 3300005438 Ga0070701_10001164 Ga0070701_100011648 380
260 3300005439 Ga0070711_100003817 Ga0070711_1000038177 380
261 3300005439 Ga0070711_100013666 Ga0070711_1000136663 380
262 3300005440 Ga0070705_100045658 Ga0070705_1000456582 380
263 3300005441 Ga0070700_100005156 Ga0070700_1000051567 380
264 3300005441 Ga0070700_100100002 Ga0070700_1001000022 380
265 3300005444 Ga0070694_100086627 Ga0070694_1000866272 380
266 3300005455 Ga0070663_100023566 Ga0070663_1000235663 380
267 3300005456 Ga0070678_100008757 Ga0070678_1000087577 380
268 3300005457 Ga0070662_100022649 Ga0070662_1000226493 380
269 3300005459 Ga0068867_100006883 Ga0068867_1000068837 380
270 3300005459 Ga0068867_100132397 Ga0068867_1001323972 380
271 3300005466 Ga0070685_10012068 Ga0070685_100120683 380
272 3300005466 Ga0070685_10013883 Ga0070685_100138835 380
273 3300005539 Ga0068853_100032706 Ga0068853_1000327064 380
274 3300005539 Ga0068853_100119925 Ga0068853_1001199251 380
275 3300005543 Ga0070672_100039234 Ga0070672_1000392344 380
276 3300005544 Ga0070686_100017981 Ga0070686_1000179814 380
277 3300005546 Ga0070696_100001922 Ga0070696_1000019224 380
278 3300005548 Ga0070665_100013574 Ga0070665_1000135744 380
279 3300005548 Ga0070665_100041096 Ga0070665_1000410964 380
280 3300005548 Ga0070665_100081375 Ga0070665_1000813751 380
281 3300005549 Ga0070704_100000324 Ga0070704_10000032420 380
282 3300005549 Ga0070704_100080695 Ga0070704_1000806953 380
283 3300005563 Ga0068855_100116574 Ga0068855_1001165744 380
284 3300005617 Ga0068859_100002116 Ga0068859_10000211618 380
285 3300005617 Ga0068859_100014430 Ga0068859_1000144303 380
286 3300005618 Ga0068864_100018243 Ga0068864_1000182434 380
287 3300005718 Ga0068866_10001959 Ga0068866_100019599 380
288 3300005719 Ga0068861_100004359 Ga0068861_1000043593 380
289 3300005719 Ga0068861_100090016 Ga0068861_1000900163 380
290 3300005719 Ga0068861_100110812 Ga0068861_1001108123 380
291 3300005841 Ga0068863_100006579 Ga0068863_1000065793 380
292 3300005841 Ga0068863_100030504 Ga0068863_1000305046 380
293 3300005841 Ga0068863_100119432 Ga0068863_1001194322 380
294 3300005841 Ga0068863_100426762 Ga0068863_1004267622 380
295 3300005842 Ga0068858_100006263 Ga0068858_1000062638 380
296 3300005842 Ga0068858_100249851 Ga0068858_1002498512 380
297 3300005843 Ga0068860_100000207 Ga0068860_1000002073 380
298 3300005843 Ga0068860_100007584 Ga0068860_1000075845 380
299 3300005844 Ga0068862_100000030 Ga0068862_100000030150 380
300 3300005844 Ga0068862_100000958 Ga0068862_10000095828 380
301 3300005937 Ga0081455_10016939 Ga0081455_100169392 380
302 3300005981 Ga0081538_10093185 Ga0081538_100931852 380
303 3300006038 Ga0075365_10001569 Ga0075365_100015697 380
304 3300006038 Ga0075365_10003033 Ga0075365_100030336 380
305 3300006048 Ga0075363_100000685 Ga0075363_1000006856 380
306 3300006048 Ga0075363_100002874 Ga0075363_1000028743 380
307 3300006048 Ga0075363_100004240 Ga0075363_1000042402 380
308 3300006051 Ga0075364_10000429 Ga0075364_100004291 380
309 3300006051 Ga0075364_10002054 Ga0075364_100020543 380
310 3300006051 Ga0075364_10016556 Ga0075364_100165562 380
311 3300006051 Ga0075364_10050655 Ga0075364_100506552 380
312 3300006163 Ga0070715_10023763 Ga0070715_100237632 380
313 3300006173 Ga0070716_100006291 Ga0070716_1000062915 380
314 3300006173 Ga0070716_100007144 Ga0070716_1000071445 380
315 3300006175 Ga0070712_100005385 Ga0070712_1000053852 380
316 3300006175 Ga0070712_100018276 Ga0070712_1000182764 380
317 3300006177 Ga0075362_10012950 Ga0075362_100129502 380
318 3300006177 Ga0075362_10043543 Ga0075362_100435432 380
319 3300006178 Ga0075367_10000979 Ga0075367_100009799 380
320 3300006186 Ga0075369_10018948 Ga0075369_100189482 380
321 3300006186 Ga0075369_10022555 Ga0075369_100225553 380
322 3300006186 Ga0075369_10071116 Ga0075369_100711162 380
323 3300006237 Ga0097621_100104329 Ga0097621_1001043293 380
324 3300006353 Ga0075370_10000892 Ga0075370_100008927 380
325 3300006353 Ga0075370_10018539 Ga0075370_100185392 380
326 3300006353 Ga0075370_10021326 Ga0075370_100213262 380
327 3300006353 Ga0075370_10127055 Ga0075370_101270552 380
328 3300006358 Ga0068871_100060031 Ga0068871_1000600314 380
329 3300006358 Ga0068871_100103636 Ga0068871_1001036362 380
330 3300006844 Ga0075428_100000609 Ga0075428_1000006094 380
331 3300006846 Ga0075430_100010710 Ga0075430_1000107109 380
332 3300006847 Ga0075431_100061091 Ga0075431_1000610914 380
333 3300006881 Ga0068865_100004001 Ga0068865_1000040017 380
334 3300006931 Ga0097620_100002116 Ga0097620_10000211618 380
335 3300006931 Ga0097620_100014430 Ga0097620_1000144303 380
336 3300007788 Ga0099795_10004050 Ga0099795_100040503 380
337 3300009092 Ga0105250_10017687 Ga0105250_100176874 380
338 3300009098 Ga0105245_10005692 Ga0105245_1000569210 380
339 3300009101 Ga0105247_10000008 Ga0105247_100000083 380
340 3300009101 Ga0105247_10000265 Ga0105247_1000026525 380
341 3300009101 Ga0105247_10019046 Ga0105247_100190462 380
342 3300009148 Ga0105243_10001541 Ga0105243_100015414 380
343 3300009148 Ga0105243_10193948 Ga0105243_101939482 380
344 3300009176 Ga0105242_10000329 Ga0105242_1000032921 380
345 3300009177 Ga0105248_10000217 Ga0105248_1000021762 380
346 3300009177 Ga0105248_10003997 Ga0105248_100039977 380
347 3300009545 Ga0105237_10012791 Ga0105237_100127914 380
348 3300009553 Ga0105249_10000036 Ga0105249_10000036164 380
349 3300009553 Ga0105249_10000892 Ga0105249_1000089224 380
350 3300010375 Ga0105239_10019243 Ga0105239_100192435 380
351 3300010375 Ga0105239_10058234 Ga0105239_100582343 380
352 3300011119 Ga0105246_10008600 Ga0105246_100086006 380
353 3300013296 Ga0157374_10022036 Ga0157374_100220366 380
354 3300013296 Ga0157374_10307494 Ga0157374_103074942 380
355 3300013297 Ga0157378_10000356 Ga0157378_1000035614 380
356 3300013297 Ga0157378_10019684 Ga0157378_100196843 380
357 3300013306 Ga0163162_10002067 Ga0163162_1000206718 380
358 3300013306 Ga0163162_10009917 Ga0163162_1000991710 380
359 3300013307 Ga0157372_10001106 Ga0157372_1000110610 380
360 3300013308 Ga0157375_10000760 Ga0157375_1000076027 380
361 3300014326 Ga0157380_10001851 Ga0157380_1000185114 380
362 3300014326 Ga0157380_10030651 Ga0157380_100306512 380
363 3300014745 Ga0157377_10003791 Ga0157377_100037913 380
364 3300014968 Ga0157379_10035386 Ga0157379_100353864 380
365 3300014968 Ga0157379_10112277 Ga0157379_101122772 380
366 3300025898 Ga0207692_10004970 Ga0207692_100049702 380
367 3300025899 Ga0207642_10000993 Ga0207642_100009938 380
368 3300025900 Ga0207710_10000006 Ga0207710_10000006544 380
369 3300025900 Ga0207710_10002330 Ga0207710_100023307 380
370 3300025901 Ga0207688_10000235 Ga0207688_100002352 380
371 3300025901 Ga0207688_10001745 Ga0207688_100017454 380
372 3300025904 Ga0207647_10048638 Ga0207647_100486383 380
373 3300025905 Ga0207685_10001595 Ga0207685_100015952 380
374 3300025907 Ga0207645_10029822 Ga0207645_100298222 380
375 3300025914 Ga0207671_10020639 Ga0207671_100206392 380
376 3300025915 Ga0207693_10008540 Ga0207693_100085402 380
377 3300025915 Ga0207693_10014667 Ga0207693_100146673 380
378 3300025916 Ga0207663_10004494 Ga0207663_100044942 380
379 3300025918 Ga0207662_10053039 Ga0207662_100530392 380
380 3300025923 Ga0207681_10005867 Ga0207681_100058676 380
381 3300025923 Ga0207681_10050619 Ga0207681_100506194 380
382 3300025926 Ga0207659_10037203 Ga0207659_100372032 380
383 3300025927 Ga0207687_10002188 Ga0207687_100021884 380
384 3300025931 Ga0207644_10027049 Ga0207644_100270493 380
385 3300025931 Ga0207644_10044361 Ga0207644_100443613 380
386 3300025933 Ga0207706_10009420 Ga0207706_100094204 380
387 3300025933 Ga0207706_10017506 Ga0207706_100175067 380
388 3300025934 Ga0207686_10001775 Ga0207686_1000177510 380
389 3300025935 Ga0207709_10133806 Ga0207709_101338062 380
390 3300025936 Ga0207670_10018014 Ga0207670_100180142 380
391 3300025937 Ga0207669_10003990 Ga0207669_100039908 380
392 3300025938 Ga0207704_10004093 Ga0207704_100040932 380
393 3300025939 Ga0207665_10001216 Ga0207665_100012163 380
394 3300025939 Ga0207665_10009410 Ga0207665_100094103 380
395 3300025940 Ga0207691_10059412 Ga0207691_100594124 380
396 3300025941 Ga0207711_10000184 Ga0207711_100001844 380
397 3300025941 Ga0207711_10010451 Ga0207711_100104514 380
398 3300025941 Ga0207711_10091749 Ga0207711_100917492 380
399 3300025942 Ga0207689_10030834 Ga0207689_100308343 380
400 3300025961 Ga0207712_10000036 Ga0207712_100000363 380
401 3300025961 Ga0207712_10007922 Ga0207712_100079222 380
402 3300025961 Ga0207712_10150216 Ga0207712_101502162 380
403 3300025972 Ga0207668_10004026 Ga0207668_100040268 380
404 3300025972 Ga0207668_10004242 Ga0207668_100042424 380
405 3300025972 Ga0207668_10056488 Ga0207668_100564882 380
406 3300025981 Ga0207640_10087616 Ga0207640_100876161 380
407 3300025986 Ga0207658_10000102 Ga0207658_1000010285 380
408 3300025986 Ga0207658_10034693 Ga0207658_100346933 380
409 3300025986 Ga0207658_10057188 Ga0207658_100571882 380
410 3300025986 Ga0207658_10061903 Ga0207658_100619032 380
411 3300025986 Ga0207658_10066017 Ga0207658_100660172 380
412 3300025986 Ga0207658_10086405 Ga0207658_100864052 380
413 3300026023 Ga0207677_10012361 Ga0207677_100123613 380
414 3300026035 Ga0207703_10027683 Ga0207703_100276832 380
415 3300026041 Ga0207639_10010300 Ga0207639_100103007 380
416 3300026041 Ga0207639_10011187 Ga0207639_100111872 380
417 3300026067 Ga0207678_10008422 Ga0207678_100084223 380
418 3300026067 Ga0207678_10186942 Ga0207678_101869422 380
419 3300026075 Ga0207708_10002539 Ga0207708_100025394 380
420 3300026075 Ga0207708_10046208 Ga0207708_100462084 380
421 3300026088 Ga0207641_10001722 Ga0207641_1000172219 380
422 3300026088 Ga0207641_10014518 Ga0207641_100145183 380
423 3300026089 Ga0207648_10009712 Ga0207648_100097123 380
424 3300026089 Ga0207648_10013633 Ga0207648_100136339 380
425 3300026118 Ga0207675_100000865 Ga0207675_1000008654 380
426 3300026118 Ga0207675_100015347 Ga0207675_1000153473 380
427 3300026121 Ga0207683_10000809 Ga0207683_1000080928 380
428 3300026142 Ga0207698_10007041 Ga0207698_100070418 380
429 3300026142 Ga0207698_10088934 Ga0207698_100889343 380
430 3300028379 Ga0268266_10004994 Ga0268266_100049942 380
431 3300028379 Ga0268266_10012439 Ga0268266_100124395 380
432 3300028379 Ga0268266_10028704 Ga0268266_100287042 380
433 3300028380 Ga0268265_10000038 Ga0268265_10000038162 380
434 3300028380 Ga0268265_10123682 Ga0268265_101236822 380
435 3300028381 Ga0268264_10000263 Ga0268264_1000026384 380
436 3300028381 Ga0268264_10022877 Ga0268264_100228776 380
437 3300031731 Ga0307405_10153586 Ga0307405_101535862 380
438 3300031852 Ga0307410_10001796 Ga0307410_100017968 380
439 3300031903 Ga0307407_10072542 Ga0307407_100725422 380
440 3300032002 Ga0307416_100026770 Ga0307416_1000267705 380
441 3300032126 Ga0307415_100130036 Ga0307415_1001300361 380
442 3300035691 Ga0373931_0106997 Ga0373931_0106997_67_1209 380
443 3300041411 Ga0439466_0013595 Ga0439466_0013595_480_1622 380
444 3300041413 Ga0439465_0000054 Ga0439465_0000054_7536_8678 380
445 3300041997 Ga0439431_0009385 Ga0439431_0009385_875_2017 380
446 3300042435 Ga0439434_0017589 Ga0439434_0017589_844_1986 380
447 3300045976 Ga0466967_0035878 Ga0466967_0035878_2839_3981 380
448 3300046460 Ga0495638_0026813 Ga0495638_0026813_2344_3486 380
449 3300047469 Ga0495673_0000588 Ga0495673_0000588_20049_21191 380
450 3300047472 Ga0495686_0002574 Ga0495686_0002574_1436_2578 380
451 3300048903 Ga0496100_0001032 Ga0496100_0001032_4942_6084 380
452 3300048903 Ga0496100_0095380 Ga0496100_0095380_139_1281 380
453 3300048903 Ga0496100_0158515 Ga0496100_0158515_376_1518 380
454 3300048904 Ga0496101_0000002 Ga0496101_0000002_136846_137988 380
455 3300048904 Ga0496101_0002738 Ga0496101_0002738_1924_3066 380
456 3300048905 Ga0496102_0000009 Ga0496102_0000009_206626_207768 380
457 3300048905 Ga0496102_0003741 Ga0496102_0003741_8411_9553 380
458 3300048905 Ga0496102_0031027 Ga0496102_0031027_1615_2757 380
459 3300048905 Ga0496102_0058147 Ga0496102_0058147_1010_2152 380
460 3300048905 Ga0496102_0214553 Ga0496102_0214553_509_1651 380
461 3300048906 Ga0496103_0000005 Ga0496103_0000005_367893_369035 380
462 3300048906 Ga0496103_0000542 Ga0496103_0000542_23092_24234 380
463 3300048906 Ga0496103_0131316 Ga0496103_0131316_72_1214 380
464 3300048907 Ga0496104_0003046 Ga0496104_0003046_7165_8307 380
465 3300048907 Ga0496104_0181179 Ga0496104_0181179_855_1997 380
466 3300048909 Ga0496106_0002417 Ga0496106_0002417_10923_12065 380
467 3300048909 Ga0496106_0065228 Ga0496106_0065228_358_1500 380
468 3300048910 Ga0496107_0000667 Ga0496107_0000667_8961_10103 380
469 3300048910 Ga0496107_0014634 Ga0496107_0014634_3603_4745 380
470 3300048911 Ga0496108_0000189 Ga0496108_0000189_13030_14172 380
471 3300048912 Ga0496109_0111488 Ga0496109_0111488_682_1824 380
472 3300048912 Ga0496109_0218958 Ga0496109_0218958_514_1656 380
473 3300048913 Ga0496110_0019055 Ga0496110_0019055_2018_3160 380
474 3300048913 Ga0496110_0070155 Ga0496110_0070155_967_2109 380
475 3300048914 Ga0496111_0161768 Ga0496111_0161768_51_1193 380
476 3300048915 Ga0496112_0013366 Ga0496112_0013366_367_1509 380
477 3300048916 Ga0496113_0025204 Ga0496113_0025204_2398_3540 380
478 3300048917 Ga0496114_0000761 Ga0496114_0000761_16237_17379 380
479 3300048918 Ga0496115_0000346 Ga0496115_0000346_1819_2961 380
480 3300048918 Ga0496115_0150620 Ga0496115_0150620_427_1569 380
481 3300048919 Ga0496116_0000104 Ga0496116_0000104_136543_137685 380
482 3300048920 Ga0496117_0000019 Ga0496117_0000019_261489_262631 380
483 3300048921 Ga0496118_0000020 Ga0496118_0000020_206626_207768 380
484 3300048923 Ga0496120_0016994 Ga0496120_0016994_2668_3810 380
485 3300048924 Ga0496121_0000064 Ga0496121_0000064_8461_9603 380
486 3300048929 Ga0496126_0000509 Ga0496126_0000509_69752_70894 380
487 3300049569 Ga0501032_0001460 Ga0501032_0001460_4033_5175 380
488 3300049571 Ga0501034_0030072 Ga0501034_0030072_3476_4618 380
489 3300049572 Ga0501036_0026838 Ga0501036_0026838_1587_2729 380
490 3300049573 Ga0501037_0000099 Ga0501037_0000099_11894_13036 380
491 3300049574 Ga0501038_0007897 Ga0501038_0007897_2430_3572 380
492 3300049575 Ga0501039_0009118 Ga0501039_0009118_5282_6424 380
493 3300049579 Ga0501043_0007592 Ga0501043_0007592_1344_2486 380
494 3300049579 Ga0501043_0156339 Ga0501043_0156339_32_1174 380
495 3300049586 Ga0501070_0005465 Ga0501070_0005465_4978_6120 380
496 3300049589 Ga0501073_0015047 Ga0501073_0015047_1458_2600 380
497 3300049593 Ga0501077_0060634 Ga0501077_0060634_681_1823 380
498 3300050489 nmdc:mga03683_3262_c1 nmdc:mga03683_3262_c1_208_1350 380
499 3300050490 nmdc:mga03n38_14355_c1 nmdc:mga03n38_14355_c1_605_1747 380
500 3300050490 nmdc:mga03n38_16053_c1 nmdc:mga03n38_16053_c1_837_1979 380
501 3300050490 nmdc:mga03n38_717_c1 nmdc:mga03n38_717_c1_3846_4988 380
502 3300050491 nmdc:mga00v17_19683_c1 nmdc:mga00v17_19683_c1_2278_3420 380
503 3300050491 nmdc:mga00v17_36398_c1 nmdc:mga00v17_36398_c1_867_2009 380
504 3300050492 nmdc:mga0yw44_6179_c1 nmdc:mga0yw44_6179_c1_4499_5641 380
505 3300050496 nmdc:mga07m45_3576_c1 nmdc:mga07m45_3576_c1_3482_4624 380
506 3300050496 nmdc:mga07m45_56693_c1 nmdc:mga07m45_56693_c1_94_1236 380
507 3300050496 nmdc:mga07m45_7635_c1 nmdc:mga07m45_7635_c1_2148_3290 380
508 3300050509 nmdc:mga0qj67_14319_c1 nmdc:mga0qj67_14319_c1_863_2005 380
509 3300050510 nmdc:mga06r32_58109_c1 nmdc:mga06r32_58109_c1_1162_2304 380
510 3300050516 nmdc:mga0sz30_2565_c1 nmdc:mga0sz30_2565_c1_325_1467 380
511 3300050516 nmdc:mga0sz30_3908_c1 nmdc:mga0sz30_3908_c1_1649_2800 380
512 3300053087 Ga0500643_004472 Ga0500643_004472_2335_3477 380
513 3300053153 Ga0500616_0029020 Ga0500616_0029020_281_1423 380

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.7769 312 352
4ao7-assembly1.cif.gz_A-2 zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library 0.7406 12 380
5cml-assembly2.cif.gz_B crystal structure of the esterase domain from rhodothermus marinus rmar_1206 protein 0.7401 14 377
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7336 15 380
7xtt-assembly2.cif.gz_B the structure of engineered tfcut s130a in complex with mhet 0.7294 13 377
ID Description Score Start End Superfamily
af_P95229_1_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9839 6 271 3.40.50.1820
af_P95229_1_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.973 6 271 3.40.50.1820
af_A0A1D6PYN0_10_142_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8722 309 357 3.40.50.1820
af_A0A1D6J713_2_151_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7711 309 351 3.40.50.1820
af_P77538_37_280_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7618 15 377 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7I7RJE1-F1-model_v4 Alpha/beta hydrolase 0.9955 51 380 GO:0016787
AF-A0A7I7RJE1-F1-model_v4 Alpha/beta hydrolase 0.9925 51 380 GO:0016787
AF-A0A1V3WRD6-F1-model_v4 Bacterial regulatory s, tetR family protein 0.9914 11 380 GO:0003677
GO:0006355
AF-A0A1A3I5C7-F1-model_v4 Alpha/beta hydrolase 0.9907 14 380 GO:0016787
AF-A0A1V3WP61-F1-model_v4 Prolyl oligopeptidase family protein 0.9907 104 380

Feature Viewer

pLDDT pTM Quality
91.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map