F457576

General Info

Members Datasets Scaffolds Average Seq Length
513 197 513 225

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10523687|Ga0207684_105236872
Length 242
Sequence LNSREFQDRLGRRARRAGITVGAELAAKLEIYYRLLATWNRKINLTALNLTELAPDAVDRLLIEPLVAAKHVPSATRRMIDLGTGGGSPALPMALAVPGAHLLMVESKTRKSVFLQEAVRALELEAGVATARFEELLAKPDLHEAHDLVTIRAVRIEARVLMSIQAFARPGGLIFLFRGAAGEPAETVIPPLAWQATYPLVENLRSRLVVLEKRPTGRGVPRAVGGLRQRSGCQQCGGDERY

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
153 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.19
Rhizosphere 99.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_387710 2162886011 Bacteria 1016
2 JGI24746J21847_1004912 3300001977 Bacteria 2097
3 JGI25406J46586_10002845 3300003203 Bacteria 8157
4 JGI25406J46586_10007838 3300003203 Bacteria 4858
5 Ga0065704_10074016 3300005289 Bacteria 6600
6 Ga0065712_10068121 3300005290 Bacteria 14453
7 Ga0065712_10119834 3300005290 Bacteria 1685
8 Ga0065715_10002036 3300005293 Bacteria 6043
9 Ga0065715_10090848 3300005293 Bacteria 6387
10 Ga0070658_10083865 3300005327 Bacteria 2620
11 Ga0070676_10005401 3300005328 Bacteria 6807
12 Ga0070676_10366879 3300005328 Unclassified 994
13 Ga0070683_100033791 3300005329 Bacteria 4666
14 Ga0070683_100087106 3300005329 Bacteria 2929
15 Ga0070690_100024641 3300005330 Bacteria 3701
16 Ga0070690_100028865 3300005330 Bacteria 3438
17 Ga0070690_100092038 3300005330 Bacteria 1999
18 Ga0070670_100016940 3300005331 Bacteria 6255
19 Ga0070670_100050412 3300005331 Bacteria 3577
20 Ga0070677_10003668 3300005333 Bacteria 4961
21 Ga0070677_10015927 3300005333 Bacteria 2670
22 Ga0068869_100002360 3300005334 Bacteria 11371
23 Ga0068869_100052654 3300005334 Bacteria 2956
24 Ga0068869_100432012 3300005334 Unclassified 1088
25 Ga0070666_10074705 3300005335 Bacteria 2311
26 Ga0070680_100158146 3300005336 Bacteria 1904
27 Ga0068868_100004023 3300005338 Bacteria 10260
28 Ga0070660_100340030 3300005339 Bacteria 1235
29 Ga0070689_100009376 3300005340 Bacteria 6937
30 Ga0070689_100018126 3300005340 Bacteria 5181
31 Ga0070689_100094911 3300005340 Bacteria 2355
32 Ga0070689_100182716 3300005340 Bacteria 1704
33 Ga0070687_100036911 3300005343 Bacteria 2439
34 Ga0070661_100013223 3300005344 Bacteria 5794
35 Ga0070692_10229418 3300005345 Bacteria 1101
36 Ga0070669_100006055 3300005353 Bacteria 8727
37 Ga0070669_100017805 3300005353 Bacteria 5071
38 Ga0070669_100041443 3300005353 Bacteria 3348
39 Ga0070669_100318936 3300005353 Bacteria 1254
40 Ga0070669_100659193 3300005353 Bacteria 881
41 Ga0070669_100674245 3300005353 Unclassified 871
42 Ga0070675_100002287 3300005354 Bacteria 14212
43 Ga0070675_100005453 3300005354 Bacteria 9729
44 Ga0070675_100007958 3300005354 Bacteria 8216
45 Ga0070675_100014842 3300005354 Bacteria 6148
46 Ga0070675_100021825 3300005354 Bacteria 5115
47 Ga0070675_100046261 3300005354 Bacteria 3563
48 Ga0070675_100210132 3300005354 Bacteria 1691
49 Ga0070671_100064753 3300005355 Bacteria 3044
50 Ga0070674_100014835 3300005356 Bacteria 4849
51 Ga0070673_100012161 3300005364 Bacteria 5899
52 Ga0070673_100023619 3300005364 Bacteria 4494
53 Ga0070673_100030805 3300005364 Bacteria 4020
54 Ga0070673_100039537 3300005364 Bacteria 3611
55 Ga0070673_100209110 3300005364 Bacteria 1684
56 Ga0070688_100008733 3300005365 Bacteria 5509
57 Ga0070688_100010648 3300005365 Bacteria 5079
58 Ga0070688_100042927 3300005365 Bacteria 2784
59 Ga0070688_100059723 3300005365 Bacteria 2406
60 Ga0070667_100004379 3300005367 Bacteria 11911
61 Ga0070713_100008483 3300005436 Bacteria 7290
62 Ga0070701_10001027 3300005438 Bacteria 10169
63 Ga0070701_10002666 3300005438 Bacteria 6919
64 Ga0070705_100011096 3300005440 Bacteria 4533
65 Ga0070700_100033139 3300005441 Bacteria 3110
66 Ga0070700_100104246 3300005441 Bacteria 1874
67 Ga0070694_100001154 3300005444 Bacteria 15172
68 Ga0070694_100001406 3300005444 Bacteria 14087
69 Ga0070694_100241345 3300005444 Bacteria 1363
70 Ga0070694_100368568 3300005444 Unclassified 1117
71 Ga0070694_100420021 3300005444 Bacteria 1050
72 Ga0070708_100501216 3300005445 Unclassified 1145
73 Ga0070678_100065365 3300005456 Bacteria 2700
74 Ga0070678_100082415 3300005456 Bacteria 2442
75 Ga0070678_100154195 3300005456 Bacteria 1854
76 Ga0070662_100126340 3300005457 Bacteria 1966
77 Ga0070662_100473551 3300005457 Bacteria 1042
78 Ga0070681_10099697 3300005458 Bacteria 2850
79 Ga0068867_100002577 3300005459 Bacteria 12775
80 Ga0068867_100045769 3300005459 Bacteria 3211
81 Ga0068867_100060652 3300005459 Bacteria 2806
82 Ga0068867_100270101 3300005459 Unclassified 1390
83 Ga0070685_10067503 3300005466 Bacteria 2110
84 Ga0070706_100188460 3300005467 Bacteria 1928
85 Ga0070706_100479383 3300005467 Unclassified 1157
86 Ga0070698_100003115 3300005471 Bacteria 18284
87 Ga0070698_100040523 3300005471 Bacteria 4786
88 Ga0070698_100290835 3300005471 Unclassified 1565
89 Ga0070698_100442070 3300005471 Bacteria 1236
90 Ga0070699_100006579 3300005518 Bacteria 10112
91 Ga0070699_100026984 3300005518 Bacteria 4953
92 Ga0070699_100632033 3300005518 Bacteria 977
93 Ga0070679_100189094 3300005530 Bacteria 2029
94 Ga0070697_100096970 3300005536 Bacteria 2446
95 Ga0070672_100005404 3300005543 Bacteria 8461
96 Ga0070672_100051445 3300005543 Bacteria 3213
97 Ga0070672_100053626 3300005543 Bacteria 3153
98 Ga0070672_100096935 3300005543 Bacteria 2387
99 Ga0070672_100479672 3300005543 Bacteria 1074
100 Ga0070686_100284113 3300005544 Unclassified 1221
101 Ga0070686_100293645 3300005544 Unclassified 1203
102 Ga0070695_100000013 3300005545 Bacteria 69322
103 Ga0070695_100195099 3300005545 Bacteria 1443
104 Ga0070695_100341485 3300005545 Unclassified 1119
105 Ga0070696_100003152 3300005546 Bacteria 10977
106 Ga0070696_100021391 3300005546 Bacteria 4385
107 Ga0070696_100061035 3300005546 Bacteria 2637
108 Ga0070696_100135944 3300005546 Bacteria 1792
109 Ga0070696_100352547 3300005546 Unclassified 1140
110 Ga0070665_100031938 3300005548 Bacteria 5300
111 Ga0070704_100002422 3300005549 Bacteria 10469
112 Ga0070704_100004325 3300005549 Bacteria 8211
113 Ga0070704_100119681 3300005549 Bacteria 2020
114 Ga0070704_100288938 3300005549 Bacteria 1362
115 Ga0070664_100003952 3300005564 Bacteria 11940
116 Ga0070664_100020594 3300005564 Bacteria 5431
117 Ga0070664_100232466 3300005564 Bacteria 1653
118 Ga0070664_100359445 3300005564 Bacteria 1326
119 Ga0068857_100014860 3300005577 Bacteria 6790
120 Ga0070702_100036092 3300005615 Bacteria 2736
121 Ga0068859_100002987 3300005617 Bacteria 17148
122 Ga0068859_100005331 3300005617 Bacteria 13080
123 Ga0068859_100016066 3300005617 Bacteria 7521
124 Ga0068859_100118592 3300005617 Bacteria 2712
125 Ga0068859_100221686 3300005617 Bacteria 1979
126 Ga0068859_100293580 3300005617 Bacteria 1719
127 Ga0068859_100520671 3300005617 Bacteria 1284
128 Ga0068859_100614920 3300005617 Unclassified 1179
129 Ga0068864_100018454 3300005618 Bacteria 5829
130 Ga0068864_100023764 3300005618 Bacteria 5150
131 Ga0068864_100038389 3300005618 Bacteria 4090
132 Ga0068864_100046224 3300005618 Bacteria 3735
133 Ga0068864_100246155 3300005618 Bacteria 1658
134 Ga0068864_100483068 3300005618 Bacteria 1189
135 Ga0068866_10156646 3300005718 Bacteria 1324
136 Ga0068861_100010906 3300005719 Bacteria 6313
137 Ga0068861_100028966 3300005719 Bacteria 4045
138 Ga0068870_10001197 3300005840 Bacteria 10403
139 Ga0068870_10004966 3300005840 Bacteria 5769
140 Ga0068870_10046106 3300005840 Bacteria 2284
141 Ga0068858_100024277 3300005842 Bacteria 5650
142 Ga0068860_100009524 3300005843 Bacteria 9647
143 Ga0068862_100001009 3300005844 Bacteria 27013
144 Ga0068862_100001050 3300005844 Bacteria 26495
145 Ga0068862_100241598 3300005844 Bacteria 1642
146 Ga0068862_100331778 3300005844 Unclassified 1407
147 Ga0068862_100549121 3300005844 Bacteria 1103
148 Ga0081539_10000029 3300005985 Bacteria 322399
149 Ga0081539_10000036 3300005985 Bacteria 296724
150 Ga0081539_10014628 3300005985 Bacteria 5780
151 Ga0068871_100139914 3300006358 Bacteria 2058
152 Ga0075428_100000825 3300006844 Bacteria 32443
153 Ga0075428_100003615 3300006844 Bacteria 16952
154 Ga0075428_100016682 3300006844 Bacteria 8110
155 Ga0075428_100029386 3300006844 Bacteria 6081
156 Ga0075428_100046453 3300006844 Bacteria 4770
157 Ga0075428_100049052 3300006844 Bacteria 4633
158 Ga0075428_100199992 3300006844 Bacteria 2161
159 Ga0075428_100564662 3300006844 Bacteria 1216
160 Ga0075428_100648822 3300006844 Bacteria 1126
161 Ga0075428_100977263 3300006844 Bacteria 897
162 Ga0075430_100000247 3300006846 Bacteria 37440
163 Ga0075430_100001103 3300006846 Bacteria 21464
164 Ga0075430_100016025 3300006846 Bacteria 6382
165 Ga0075430_100032651 3300006846 Bacteria 4419
166 Ga0075430_100094988 3300006846 Bacteria 2492
167 Ga0075430_100253983 3300006846 Bacteria 1456
168 Ga0075431_100001568 3300006847 Bacteria 21234
169 Ga0075431_100009315 3300006847 Bacteria 9852
170 Ga0075431_100013068 3300006847 Bacteria 8384
171 Ga0075431_100120213 3300006847 Bacteria 2710
172 Ga0075431_100217976 3300006847 Bacteria 1947
173 Ga0075433_10001195 3300006852 Bacteria 18904
174 Ga0075433_10004228 3300006852 Bacteria 11148
175 Ga0075433_10006958 3300006852 Bacteria 8965
176 Ga0075433_10052925 3300006852 Bacteria 3538
177 Ga0075433_10057220 3300006852 Bacteria 3408
178 Ga0075433_10238309 3300006852 Bacteria 1615
179 Ga0075433_10266782 3300006852 Bacteria 1517
180 Ga0075434_100001546 3300006871 Bacteria 19486
181 Ga0075434_100001899 3300006871 Bacteria 18102
182 Ga0075434_100003555 3300006871 Bacteria 13914
183 Ga0075434_100006985 3300006871 Bacteria 10407
184 Ga0075434_100043743 3300006871 Bacteria 4442
185 Ga0075434_100083687 3300006871 Bacteria 3188
186 Ga0075429_100000378 3300006880 Bacteria 32769
187 Ga0075429_100014940 3300006880 Bacteria 6734
188 Ga0075429_100016527 3300006880 Bacteria 6393
189 Ga0075429_100023485 3300006880 Bacteria 5351
190 Ga0075429_100039557 3300006880 Bacteria 4104
191 Ga0075429_100060258 3300006880 Bacteria 3306
192 Ga0075429_100107149 3300006880 Bacteria 2442
193 Ga0075429_100307833 3300006880 Bacteria 1387
194 Ga0075429_100313100 3300006880 Bacteria 1374
195 Ga0068865_100154011 3300006881 Bacteria 1747
196 Ga0068865_100305011 3300006881 Bacteria 1276
197 Ga0075436_100291428 3300006914 Bacteria 1168
198 Ga0097620_100002987 3300006931 Bacteria 17148
199 Ga0097620_100005331 3300006931 Bacteria 13080
200 Ga0097620_100016066 3300006931 Bacteria 7521
201 Ga0097620_100118598 3300006931 Bacteria 2712
202 Ga0097620_100221696 3300006931 Bacteria 1979
203 Ga0097620_100293568 3300006931 Bacteria 1719
204 Ga0097620_100520698 3300006931 Bacteria 1284
205 Ga0097620_100614934 3300006931 Unclassified 1179
206 Ga0075435_100009149 3300007076 Bacteria 7152
207 Ga0075435_100058984 3300007076 Bacteria 3110
208 Ga0075435_100180588 3300007076 Bacteria 1783
209 Ga0111539_10000134 3300009094 Bacteria 84765
210 Ga0111539_10000191 3300009094 Bacteria 71382
211 Ga0111539_10000596 3300009094 Bacteria 46666
212 Ga0111539_10002220 3300009094 Bacteria 25940
213 Ga0111539_10004160 3300009094 Bacteria 18970
214 Ga0111539_10008357 3300009094 Bacteria 13170
215 Ga0111539_10084466 3300009094 Bacteria 3732
216 Ga0111539_10099700 3300009094 Bacteria 3411
217 Ga0111539_10122699 3300009094 Bacteria 3045
218 Ga0111539_10342193 3300009094 Bacteria 1741
219 Ga0111539_10456904 3300009094 Bacteria 1487
220 Ga0105245_10500943 3300009098 Unclassified 1231
221 Ga0105245_10549384 3300009098 Bacteria 1177
222 Ga0114129_10000550 3300009147 Bacteria 45963
223 Ga0114129_10001213 3300009147 Bacteria 34237
224 Ga0114129_10025725 3300009147 Bacteria 8338
225 Ga0114129_10046452 3300009147 Bacteria 6102
226 Ga0114129_10061089 3300009147 Bacteria 5267
227 Ga0114129_10072301 3300009147 Bacteria 4808
228 Ga0114129_10092535 3300009147 Bacteria 4189
229 Ga0114129_10133480 3300009147 Bacteria 3408
230 Ga0114129_10427398 3300009147 Bacteria 1741
231 Ga0114129_10486722 3300009147 Bacteria 1613
232 Ga0114129_10893372 3300009147 Bacteria 1126
233 Ga0114129_11023884 3300009147 Unclassified 1038
234 Ga0114129_11221850 3300009147 Unclassified 935
235 Ga0105243_10039392 3300009148 Bacteria 3683
236 Ga0105243_10068266 3300009148 Bacteria 2865
237 Ga0105243_11279516 3300009148 Bacteria 750
238 Ga0105242_10124782 3300009176 Bacteria 2215
239 Ga0105249_10000828 3300009553 Bacteria 27861
240 Ga0105249_10001504 3300009553 Bacteria 20446
241 Ga0105249_10536814 3300009553 Bacteria 1219
242 Ga0105246_10685900 3300011119 Bacteria 896
243 Ga0157374_10456499 3300013296 Bacteria 1280
244 Ga0157378_10513204 3300013297 Bacteria 1199
245 Ga0163162_10006203 3300013306 Bacteria 11580
246 Ga0157375_10007218 3300013308 Bacteria 9718
247 Ga0157375_10139347 3300013308 Bacteria 2552
248 Ga0157375_10183063 3300013308 Bacteria 2247
249 Ga0157375_10246611 3300013308 Bacteria 1946
250 Ga0163163_10368893 3300014325 Bacteria 1492
251 Ga0163163_10419882 3300014325 Unclassified 1396
252 Ga0157380_10028740 3300014326 Bacteria 4243
253 Ga0157380_10077931 3300014326 Bacteria 2702
254 Ga0157380_10198379 3300014326 Bacteria 1778
255 Ga0157380_10255952 3300014326 Bacteria 1587
256 Ga0157380_10406904 3300014326 Bacteria 1293
257 Ga0157380_10702796 3300014326 Bacteria 1016
258 Ga0157380_11090746 3300014326 Unclassified 837
259 Ga0157377_10005232 3300014745 Bacteria 6074
260 Ga0157377_10028756 3300014745 Bacteria 2994
261 Ga0157377_10070293 3300014745 Bacteria 2022
262 Ga0157379_10074380 3300014968 Bacteria 3042
263 Ga0157376_10093131 3300014969 Bacteria 2615
264 Ga0157376_10920835 3300014969 Unclassified 893
265 Ga0157376_11006000 3300014969 Bacteria 856
266 Ga0163161_10053883 3300017792 Bacteria 2918
267 Ga0163161_10148198 3300017792 Bacteria 1782
268 Ga0163161_10626907 3300017792 Bacteria 889
269 Ga0207682_10002603 3300025893 Bacteria 8050
270 Ga0207682_10009938 3300025893 Bacteria 3738
271 Ga0207682_10017319 3300025893 Bacteria 2814
272 Ga0207688_10000665 3300025901 Bacteria 16968
273 Ga0207688_10090212 3300025901 Bacteria 1759
274 Ga0207688_10091041 3300025901 Bacteria 1752
275 Ga0207680_10012699 3300025903 Bacteria 4299
276 Ga0207647_10074887 3300025904 Bacteria 2038
277 Ga0207645_10000277 3300025907 Bacteria 42576
278 Ga0207645_10144844 3300025907 Bacteria 1549
279 Ga0207643_10000129 3300025908 Bacteria 51178
280 Ga0207643_10002219 3300025908 Bacteria 10585
281 Ga0207643_10004548 3300025908 Bacteria 7452
282 Ga0207705_10072823 3300025909 Bacteria 2493
283 Ga0207684_10523687 3300025910 Unclassified 1015
284 Ga0207707_10203216 3300025912 Bacteria 1727
285 Ga0207662_10001289 3300025918 Bacteria 12062
286 Ga0207662_10003301 3300025918 Bacteria 8280
287 Ga0207662_10062604 3300025918 Bacteria 2236
288 Ga0207657_10058837 3300025919 Bacteria 3305
289 Ga0207649_10089212 3300025920 Bacteria 2015
290 Ga0207646_10090535 3300025922 Bacteria 2739
291 Ga0207646_10485046 3300025922 Bacteria 1114
292 Ga0207681_10011317 3300025923 Bacteria 5480
293 Ga0207681_10282785 3300025923 Unclassified 1307
294 Ga0207650_10000653 3300025925 Bacteria 27547
295 Ga0207659_10029613 3300025926 Bacteria 3733
296 Ga0207690_10229629 3300025932 Bacteria 1424
297 Ga0207706_10027597 3300025933 Bacteria 5076
298 Ga0207706_10035227 3300025933 Bacteria 4451
299 Ga0207706_10158469 3300025933 Bacteria 1990
300 Ga0207706_10179096 3300025933 Bacteria 1862
301 Ga0207706_10272511 3300025933 Bacteria 1477
302 Ga0207670_10042153 3300025936 Bacteria 3006
303 Ga0207670_10077700 3300025936 Bacteria 2313
304 Ga0207670_10117243 3300025936 Bacteria 1929
305 Ga0207670_10179168 3300025936 Bacteria 1595
306 Ga0207669_10000173 3300025937 Bacteria 30195
307 Ga0207669_10038413 3300025937 Bacteria 2756
308 Ga0207704_10102813 3300025938 Bacteria 1909
309 Ga0207691_10002509 3300025940 Bacteria 17953
310 Ga0207691_10013481 3300025940 Bacteria 7821
311 Ga0207691_10094711 3300025940 Bacteria 2671
312 Ga0207691_10208459 3300025940 Bacteria 1699
313 Ga0207691_10272879 3300025940 Bacteria 1456
314 Ga0207689_10020574 3300025942 Bacteria 5553
315 Ga0207689_10065676 3300025942 Bacteria 2984
316 Ga0207689_10329225 3300025942 Bacteria 1268
317 Ga0207679_10016367 3300025945 Bacteria 4924
318 Ga0207679_10019165 3300025945 Bacteria 4594
319 Ga0207679_10050593 3300025945 Bacteria 3037
320 Ga0207679_10058898 3300025945 Bacteria 2848
321 Ga0207679_10294710 3300025945 Bacteria 1396
322 Ga0207651_10006701 3300025960 Bacteria 6065
323 Ga0207651_10013049 3300025960 Bacteria 4735
324 Ga0207651_10049633 3300025960 Bacteria 2844
325 Ga0207651_10059040 3300025960 Bacteria 2654
326 Ga0207651_10067615 3300025960 Bacteria 2515
327 Ga0207651_10415733 3300025960 Bacteria 1147
328 Ga0207712_10051468 3300025961 Bacteria 2881
329 Ga0207668_10066013 3300025972 Bacteria 2563
330 Ga0207668_10532859 3300025972 Bacteria 1015
331 Ga0207677_10317432 3300026023 Bacteria 1293
332 Ga0207708_10006372 3300026075 Bacteria 8742
333 Ga0207708_10022127 3300026075 Bacteria 4802
334 Ga0207708_10124550 3300026075 Bacteria 2011
335 Ga0207708_10142724 3300026075 Bacteria 1880
336 Ga0207708_10389628 3300026075 Bacteria 1150
337 Ga0207708_10526037 3300026075 Unclassified 994
338 Ga0207641_10020487 3300026088 Bacteria 5431
339 Ga0207641_10350505 3300026088 Bacteria 1407
340 Ga0207648_10000506 3300026089 Bacteria 43472
341 Ga0207648_10099589 3300026089 Bacteria 2545
342 Ga0207648_10151531 3300026089 Bacteria 2046
343 Ga0207648_10342766 3300026089 Unclassified 1346
344 Ga0207676_10017765 3300026095 Bacteria 5161
345 Ga0207676_10021739 3300026095 Bacteria 4709
346 Ga0207676_10037503 3300026095 Bacteria 3694
347 Ga0207676_10098290 3300026095 Bacteria 2420
348 Ga0207676_10403673 3300026095 Bacteria 1278
349 Ga0207674_10011761 3300026116 Bacteria 9820
350 Ga0207675_100002376 3300026118 Bacteria 18642
351 Ga0207675_100008956 3300026118 Bacteria 9390
352 Ga0207675_100732971 3300026118 Unclassified 999
353 Ga0207683_10144219 3300026121 Bacteria 2147
354 Ga0209971_1070810 3300027682 Unclassified 846
355 Ga0209974_10022202 3300027876 Bacteria 2102
356 Ga0207428_10000156 3300027907 Bacteria 93294
357 Ga0207428_10002283 3300027907 Bacteria 19243
358 Ga0207428_10003472 3300027907 Bacteria 15299
359 Ga0207428_10007107 3300027907 Bacteria 10244
360 Ga0207428_10010303 3300027907 Bacteria 8354
361 Ga0207428_10016525 3300027907 Bacteria 6345
362 Ga0207428_10048267 3300027907 Bacteria 3416
363 Ga0207428_10749854 3300027907 Unclassified 696
364 Ga0268265_10000135 3300028380 Bacteria 93986
365 Ga0268265_10025009 3300028380 Bacteria 4232
366 Ga0268265_10157492 3300028380 Bacteria 1924
367 Ga0268265_10214939 3300028380 Bacteria 1678
368 Ga0268264_10610179 3300028381 Bacteria 1076
369 Ga0307408_100035297 3300031548 Bacteria 3508
370 Ga0307408_100268856 3300031548 Bacteria 1414
371 Ga0307408_100420787 3300031548 Unclassified 1152
372 Ga0307405_10013421 3300031731 Bacteria 4369
373 Ga0307405_10257078 3300031731 Bacteria 1302
374 Ga0307405_10265323 3300031731 Bacteria 1285
375 Ga0307413_10006068 3300031824 Bacteria 5475
376 Ga0307410_10019350 3300031852 Bacteria 4140
377 Ga0307410_10118020 3300031852 Bacteria 1930
378 Ga0307410_10295867 3300031852 Bacteria 1275
379 Ga0307410_10501031 3300031852 Unclassified 999
380 Ga0307406_10598512 3300031901 Bacteria 909
381 Ga0307407_10003430 3300031903 Bacteria 6498
382 Ga0307407_10004644 3300031903 Bacteria 5860
383 Ga0307407_10009779 3300031903 Bacteria 4486
384 Ga0307412_10004084 3300031911 Bacteria 8133
385 Ga0307412_10117391 3300031911 Bacteria 1910
386 Ga0307409_100010618 3300031995 Bacteria 5741
387 Ga0307409_100348971 3300031995 Bacteria 1395
388 Ga0307416_100069342 3300032002 Bacteria 2917
389 Ga0307416_100234264 3300032002 Bacteria 1773
390 Ga0307414_10118708 3300032004 Bacteria 2029
391 Ga0307414_10616157 3300032004 Archaea 975
392 Ga0307411_10008874 3300032005 Bacteria 5242
393 Ga0307411_10028364 3300032005 Bacteria 3402
394 Ga0307411_10527781 3300032005 Bacteria 1003
395 Ga0307415_100012114 3300032126 Bacteria 4973
396 Ga0307415_100207199 3300032126 Bacteria 1561
397 Ga0373934_0106101 3300035086 Unclassified 1137
398 Ga0373956_0208925 3300035119 Unclassified 926
399 Ga0373943_0397683 3300035170 Unclassified 795
400 Ga0373946_0119054 3300035171 Unclassified 1204
401 Ga0373935_0035925 3300035692 Bacteria 3095
402 Ga0373937_0105036 3300036401 Bacteria 2624
403 Ga0373937_0184917 3300036401 Unclassified 1957
404 Ga0242420_036328 3300038996 Bacteria 930
405 Ga0439450_014135 3300042008 Bacteria 1614
406 Ga0439435_0136127 3300042436 Unclassified 779
407 Ga0439444_0035517 3300042437 Unclassified 956
408 Ga0439460_0014251 3300042461 Bacteria 2089
409 Ga0451577_0551304 3300042876 Bacteria 1047
410 Ga0451576_0010856 3300045051 Bacteria 10423
411 Ga0451576_0033794 3300045051 Bacteria 5434
412 Ga0451576_0087694 3300045051 Bacteria 3236
413 Ga0451576_0535414 3300045051 Bacteria 1230
414 Ga0451576_0868478 3300045051 Unclassified 947
415 Ga0495603_0015526 3300046455 Bacteria 4610
416 Ga0495629_0112232 3300046459 Bacteria 1900
417 Ga0495584_0014069 3300046491 Bacteria 4076
418 Ga0495594_0063371 3300046499 Bacteria 2048
419 Ga0495643_0005324 3300046522 Bacteria 8719
420 Ga0495644_0119007 3300046523 Unclassified 1004
421 Ga0495663_0027500 3300046525 Bacteria 1669
422 Ga0495609_0011821 3300046538 Bacteria 4150
423 Ga0495621_0007101 3300046539 Bacteria 3302
424 Ga0495621_0044557 3300046539 Bacteria 1569
425 Ga0495621_0081922 3300046539 Bacteria 1204
426 Ga0495659_0005360 3300046664 Bacteria 4034
427 Ga0495647_0157167 3300046681 Unclassified 978
428 Ga0496109_0062244 3300048912 Bacteria 3412
429 Ga0501039_0096630 3300049575 Bacteria 2303
430 Ga0501040_0011742 3300049576 Bacteria 5729
431 Ga0501041_0129895 3300049577 Unclassified 1569
432 Ga0501042_0043503 3300049578 Bacteria 3198
433 Ga0501042_0257515 3300049578 Bacteria 1259
434 Ga0501043_0270119 3300049579 Bacteria 1306
435 Ga0501043_0392653 3300049579 Unclassified 1049
436 Ga0501046_0395040 3300049580 Bacteria 999
437 Ga0501048_0075356 3300049582 Bacteria 2380
438 Ga0501067_0047038 3300049583 Bacteria 2394
439 Ga0501071_0199342 3300049587 Unclassified 1503
440 Ga0501073_0460830 3300049589 Bacteria 879
441 Ga0501075_0095681 3300049591 Bacteria 2253
442 Ga0501076_0025420 3300049592 Bacteria 4582
443 Ga0501076_0050355 3300049592 Bacteria 3295
444 Ga0501077_0194536 3300049593 Bacteria 1288
445 Ga0501077_0238672 3300049593 Unclassified 1155
446 Ga0501081_0044739 3300049743 Bacteria 3040
447 Ga0501081_0380825 3300049743 Bacteria 1042
448 Ga0501045_0138765 3300049824 Unclassified 1808
449 Ga0501045_0206845 3300049824 Bacteria 1462
450 nmdc:mga05p37_100039_c1 3300050507 Bacteria 3571
451 nmdc:mga05p37_1854_c1 3300050507 Bacteria 24613
452 nmdc:mga05p37_221497_c1 3300050507 Bacteria 2283
453 nmdc:mga05p37_231266_c1 3300050507 Bacteria 2227
454 nmdc:mga05p37_245821_c1 3300050507 Bacteria 2148
455 nmdc:mga05p37_256239_c1 3300050507 Bacteria 2096
456 nmdc:mga05p37_278878_c1 3300050507 Unclassified 1994
457 nmdc:mga05p37_35283_c1 3300050507 Bacteria 6130
458 nmdc:mga05p37_43996_c1 3300050507 Bacteria 5494
459 nmdc:mga05p37_541244_c1 3300050507 Bacteria 1328
460 nmdc:mga05p37_76590_c1 3300050507 Bacteria 4117
461 nmdc:mga05p37_769768_c1 3300050507 Bacteria 1058
462 nmdc:mga09592_101627_c1 3300050508 Bacteria 2463
463 nmdc:mga09592_157585_c1 3300050508 Bacteria 1960
464 nmdc:mga09592_252_c1 3300050508 Bacteria 39064
465 nmdc:mga09592_26536_c1 3300050508 Bacteria 4800
466 nmdc:mga09592_27446_c1 3300050508 Bacteria 4724
467 nmdc:mga09592_302938_c1 3300050508 Bacteria 1386
468 nmdc:mga09592_333401_c1 3300050508 Bacteria 1313
469 nmdc:mga09592_419660_c1 3300050508 Unclassified 1156
470 nmdc:mga09592_4536_c1 3300050508 Bacteria 11230
471 nmdc:mga0qj67_307775_c1 3300050509 Bacteria 1283
472 nmdc:mga0qj67_8836_c1 3300050509 Bacteria 7476
473 nmdc:mga0qj67_9418_c1 3300050509 Bacteria 7267
474 nmdc:mga06r32_148444_c1 3300050510 Bacteria 2322
475 nmdc:mga06r32_168473_c1 3300050510 Bacteria 2174
476 nmdc:mga06r32_187318_c1 3300050510 Bacteria 2056
477 nmdc:mga06r32_48299_c1 3300050510 Bacteria 4067
478 nmdc:mga06r32_504_c1 3300050510 Bacteria 33617
479 nmdc:mga06r32_69967_c1 3300050510 Bacteria 3393
480 nmdc:mga06r32_793904_c1 3300050510 Bacteria 908
481 nmdc:mga08y16_1568_c1 3300050511 Bacteria 23067
482 nmdc:mga08y16_167722_c1 3300050511 Bacteria 2281
483 nmdc:mga08y16_2643_c1 3300050511 Bacteria 18424
484 nmdc:mga08y16_6025_c1 3300050511 Bacteria 12707
485 nmdc:mga08y16_614_c1 3300050511 Bacteria 33280
486 nmdc:mga08y16_624036_c1 3300050511 Bacteria 1085
487 nmdc:mga08y16_690655_c1 3300050511 Bacteria 1021
488 nmdc:mga08y16_70963_c1 3300050511 Bacteria 3630
489 nmdc:mga08y16_72077_c1 3300050511 Bacteria 3600
490 nmdc:mga08y16_812_c1 3300050511 Bacteria 29900
491 nmdc:mga0n895_112801_c1 3300050512 Bacteria 2736
492 nmdc:mga0n895_1515_c1 3300050512 Bacteria 17423
493 nmdc:mga0n895_380386_c1 3300050512 Viruses 1429
494 nmdc:mga0n895_38713_c1 3300050512 Bacteria 4621
495 nmdc:mga0n895_985_c1 3300050512 Bacteria 20624
496 nmdc:mga0rr50_100757_c1 3300050513 Bacteria 2269
497 nmdc:mga0rr50_73072_c1 3300050513 Bacteria 2621
498 nmdc:mga0a205_10401_c1 3300050515 Bacteria 8551
499 nmdc:mga0a205_120835_c1 3300050515 Bacteria 2519
500 nmdc:mga0a205_196100_c1 3300050515 Bacteria 1910
501 nmdc:mga0a205_613_c1 3300050515 Bacteria 28395
502 nmdc:mga0a205_64046_c1 3300050515 Bacteria 3551
503 nmdc:mga0a205_742454_c1 3300050515 Unclassified 830
504 Ga0495601_0153898 3300053077 Unclassified 1502
505 Ga0501084_0019155 3300054114 Bacteria 5701
506 Ga0590071_000123 3300059421 Bacteria 21754
507 Ga0590071_000480 3300059421 Bacteria 11665
508 Ga0590074_000763 3300059423 Bacteria 4916
509 Ga0590074_000955 3300059423 Bacteria 4542
510 Ga0590075_004273 3300059424 Bacteria 3380
511 Ga0590075_013282 3300059424 Bacteria 2006
512 Ga0590077_000341 3300059426 Bacteria 13241
513 Ga0530510_0009458 3300061734 Bacteria 6833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038996 Ga0242420_036328 Ga0242420_036328_158_709 181
2 3300035171 Ga0373946_0119054 Ga0373946_0119054_62_706 190
3 3300036401 Ga0373937_0184917 Ga0373937_0184917_844_1488 190
4 3300053077 Ga0495601_0153898 Ga0495601_0153898_461_1105 190
5 3300006844 Ga0075428_100003615 Ga0075428_10000361510 193
6 3300006847 Ga0075431_100013068 Ga0075431_1000130689 193
7 3300006880 Ga0075429_100014940 Ga0075429_1000149404 193
8 3300009147 Ga0114129_10133480 Ga0114129_101334802 193
9 3300050507 nmdc:mga05p37_35283_c1 nmdc:mga05p37_35283_c1_5131_5727 193
10 3300050508 nmdc:mga09592_4536_c1 nmdc:mga09592_4536_c1_5808_6404 193
11 3300050510 nmdc:mga06r32_168473_c1 nmdc:mga06r32_168473_c1_540_1136 193
12 3300009094 Ga0111539_10000191 Ga0111539_1000019150 196
13 3300027907 Ga0207428_10016525 Ga0207428_100165256 196
14 3300050511 nmdc:mga08y16_614_c1 nmdc:mga08y16_614_c1_18693_19337 196
15 3300005327 Ga0070658_10083865 Ga0070658_100838652 197
16 3300025909 Ga0207705_10072823 Ga0207705_100728232 197
17 3300031901 Ga0307406_10598512 Ga0307406_105985121 197
18 3300009553 Ga0105249_10536814 Ga0105249_105368142 198
19 3300005353 Ga0070669_100674245 Ga0070669_1006742451 199
20 3300006844 Ga0075428_100564662 Ga0075428_1005646622 199
21 3300006846 Ga0075430_100094988 Ga0075430_1000949882 199
22 3300009094 Ga0111539_10000596 Ga0111539_1000059633 199
23 3300014326 Ga0157380_11090746 Ga0157380_110907461 199
24 3300025933 Ga0207706_10272511 Ga0207706_102725112 199
25 3300027907 Ga0207428_10010303 Ga0207428_100103032 199
26 3300031548 Ga0307408_100268856 Ga0307408_1002688562 199
27 3300031731 Ga0307405_10257078 Ga0307405_102570782 199
28 3300031731 Ga0307405_10265323 Ga0307405_102653232 199
29 3300031852 Ga0307410_10295867 Ga0307410_102958672 199
30 3300031852 Ga0307410_10501031 Ga0307410_105010311 199
31 3300031903 Ga0307407_10009779 Ga0307407_100097793 199
32 3300031911 Ga0307412_10117391 Ga0307412_101173912 199
33 3300031995 Ga0307409_100348971 Ga0307409_1003489711 199
34 3300032002 Ga0307416_100234264 Ga0307416_1002342642 199
35 3300032004 Ga0307414_10118708 Ga0307414_101187082 199
36 3300032004 Ga0307414_10616157 Ga0307414_106161571 199
37 3300032005 Ga0307411_10028364 Ga0307411_100283643 199
38 3300046522 Ga0495643_0005324 Ga0495643_0005324_7569_8225 199
39 3300050508 nmdc:mga09592_101627_c1 nmdc:mga09592_101627_c1_1383_1988 199
40 3300050510 nmdc:mga06r32_48299_c1 nmdc:mga06r32_48299_c1_1575_2180 199
41 3300050511 nmdc:mga08y16_6025_c1 nmdc:mga08y16_6025_c1_11471_12145 199
42 3300059421 Ga0590071_000123 Ga0590071_000123_1067_1723 199
43 3300059421 Ga0590071_000480 Ga0590071_000480_9424_10080 199
44 3300059423 Ga0590074_000763 Ga0590074_000763_2560_3216 199
45 3300059423 Ga0590074_000955 Ga0590074_000955_3053_3709 199
46 3300059424 Ga0590075_004273 Ga0590075_004273_1550_2206 199
47 3300059424 Ga0590075_013282 Ga0590075_013282_942_1598 199
48 3300059426 Ga0590077_000341 Ga0590077_000341_10392_11048 199
49 3300005290 Ga0065712_10119834 Ga0065712_101198343 200
50 3300005331 Ga0070670_100016940 Ga0070670_1000169407 200
51 3300005353 Ga0070669_100659193 Ga0070669_1006591931 200
52 3300005354 Ga0070675_100014842 Ga0070675_1000148425 200
53 3300005466 Ga0070685_10067503 Ga0070685_100675032 200
54 3300005518 Ga0070699_100632033 Ga0070699_1006320332 200
55 3300005543 Ga0070672_100096935 Ga0070672_1000969351 200
56 3300005544 Ga0070686_100293645 Ga0070686_1002936452 200
57 3300005564 Ga0070664_100020594 Ga0070664_1000205945 200
58 3300005617 Ga0068859_100293580 Ga0068859_1002935802 200
59 3300005618 Ga0068864_100018454 Ga0068864_1000184542 200
60 3300005844 Ga0068862_100549121 Ga0068862_1005491212 200
61 3300006844 Ga0075428_100029386 Ga0075428_1000293865 200
62 3300006852 Ga0075433_10001195 Ga0075433_100011958 200
63 3300006871 Ga0075434_100006985 Ga0075434_1000069857 200
64 3300006931 Ga0097620_100293568 Ga0097620_1002935682 200
65 3300009094 Ga0111539_10122699 Ga0111539_101226992 200
66 3300009098 Ga0105245_10500943 Ga0105245_105009431 200
67 3300009147 Ga0114129_11023884 Ga0114129_110238842 200
68 3300009147 Ga0114129_11221850 Ga0114129_112218501 200
69 3300014325 Ga0163163_10368893 Ga0163163_103688932 200
70 3300025925 Ga0207650_10000653 Ga0207650_1000065321 200
71 3300025936 Ga0207670_10179168 Ga0207670_101791682 200
72 3300025940 Ga0207691_10094711 Ga0207691_100947112 200
73 3300025945 Ga0207679_10050593 Ga0207679_100505933 200
74 3300025972 Ga0207668_10532859 Ga0207668_105328592 200
75 3300026075 Ga0207708_10526037 Ga0207708_105260371 200
76 3300026088 Ga0207641_10350505 Ga0207641_103505052 200
77 3300026095 Ga0207676_10037503 Ga0207676_100375032 200
78 3300027682 Ga0209971_1070810 Ga0209971_10708101 200
79 3300031548 Ga0307408_100035297 Ga0307408_1000352973 200
80 3300031731 Ga0307405_10013421 Ga0307405_100134212 200
81 3300031824 Ga0307413_10006068 Ga0307413_100060685 200
82 3300031852 Ga0307410_10019350 Ga0307410_100193503 200
83 3300031852 Ga0307410_10118020 Ga0307410_101180202 200
84 3300031903 Ga0307407_10003430 Ga0307407_100034302 200
85 3300031903 Ga0307407_10004644 Ga0307407_100046443 200
86 3300031911 Ga0307412_10004084 Ga0307412_100040847 200
87 3300031995 Ga0307409_100010618 Ga0307409_1000106181 200
88 3300032002 Ga0307416_100069342 Ga0307416_1000693424 200
89 3300032005 Ga0307411_10008874 Ga0307411_100088744 200
90 3300032005 Ga0307411_10527781 Ga0307411_105277812 200
91 3300032126 Ga0307415_100012114 Ga0307415_1000121143 200
92 3300042437 Ga0439444_0035517 Ga0439444_0035517_29_688 200
93 3300042461 Ga0439460_0014251 Ga0439460_0014251_651_1316 200
94 3300045051 Ga0451576_0868478 Ga0451576_0868478_178_786 200
95 3300050511 nmdc:mga08y16_70963_c1 nmdc:mga08y16_70963_c1_786_1448 200
96 3300003203 JGI25406J46586_10007838 JGI25406J46586_100078385 201
97 3300005334 Ga0068869_100432012 Ga0068869_1004320122 201
98 3300005985 Ga0081539_10000029 Ga0081539_10000029222 201
99 3300005985 Ga0081539_10014628 Ga0081539_100146282 201
100 3300006844 Ga0075428_100046453 Ga0075428_1000464533 201
101 3300006846 Ga0075430_100016025 Ga0075430_1000160253 201
102 3300006847 Ga0075431_100217976 Ga0075431_1002179762 201
103 3300006852 Ga0075433_10238309 Ga0075433_102383092 201
104 3300006880 Ga0075429_100039557 Ga0075429_1000395572 201
105 3300009094 Ga0111539_10000134 Ga0111539_100001342 201
106 3300009094 Ga0111539_10099700 Ga0111539_100997003 201
107 3300025942 Ga0207689_10329225 Ga0207689_103292252 201
108 3300027907 Ga0207428_10000156 Ga0207428_1000015659 201
109 3300027907 Ga0207428_10749854 Ga0207428_107498541 201
110 3300050507 nmdc:mga05p37_541244_c1 nmdc:mga05p37_541244_c1_419_1078 201
111 3300050508 nmdc:mga09592_302938_c1 nmdc:mga09592_302938_c1_478_1137 201
112 3300050509 nmdc:mga0qj67_307775_c1 nmdc:mga0qj67_307775_c1_438_1103 201
113 3300050511 nmdc:mga08y16_1568_c1 nmdc:mga08y16_1568_c1_5293_5952 201
114 3300050511 nmdc:mga08y16_167722_c1 nmdc:mga08y16_167722_c1_418_1080 201
115 3300050512 nmdc:mga0n895_985_c1 nmdc:mga0n895_985_c1_868_1479 201
116 3300050515 nmdc:mga0a205_10401_c1 nmdc:mga0a205_10401_c1_5157_5768 201
117 3300050515 nmdc:mga0a205_196100_c1 nmdc:mga0a205_196100_c1_406_1065 201
118 3300050515 nmdc:mga0a205_742454_c1 nmdc:mga0a205_742454_c1_88_750 201
119 3300003203 JGI25406J46586_10002845 JGI25406J46586_100028456 202
120 3300005617 Ga0068859_100614920 Ga0068859_1006149201 202
121 3300005985 Ga0081539_10000036 Ga0081539_10000036125 202
122 3300006931 Ga0097620_100614934 Ga0097620_1006149341 202
123 3300009147 Ga0114129_10001213 Ga0114129_1000121323 202
124 3300009147 Ga0114129_10061089 Ga0114129_100610895 202
125 3300014326 Ga0157380_10198379 Ga0157380_101983792 202
126 3300026075 Ga0207708_10142724 Ga0207708_101427242 202
127 3300031548 Ga0307408_100420787 Ga0307408_1004207871 202
128 3300032126 Ga0307415_100207199 Ga0307415_1002071991 202
129 3300050507 nmdc:mga05p37_231266_c1 nmdc:mga05p37_231266_c1_864_1526 202
130 3300005467 Ga0070706_100479383 Ga0070706_1004793831 203
131 3300005471 Ga0070698_100442070 Ga0070698_1004420702 203
132 3300025910 Ga0207684_10523687 Ga0207684_105236872 203
133 3300049576 Ga0501040_0011742 Ga0501040_0011742_1261_1881 203
134 3300049577 Ga0501041_0129895 Ga0501041_0129895_805_1425 203
135 3300049578 Ga0501042_0043503 Ga0501042_0043503_1733_2353 203
136 3300049579 Ga0501043_0392653 Ga0501043_0392653_76_696 203
137 3300049582 Ga0501048_0075356 Ga0501048_0075356_609_1229 203
138 3300049587 Ga0501071_0199342 Ga0501071_0199342_400_1020 203
139 3300049592 Ga0501076_0025420 Ga0501076_0025420_817_1437 203
140 3300049593 Ga0501077_0238672 Ga0501077_0238672_524_1144 203
141 3300049743 Ga0501081_0044739 Ga0501081_0044739_981_1601 203
142 3300049824 Ga0501045_0138765 Ga0501045_0138765_901_1521 203
143 3300054114 Ga0501084_0019155 Ga0501084_0019155_1006_1626 203
144 3300061734 Ga0530510_0009458 Ga0530510_0009458_888_1508 203
145 3300001977 JGI24746J21847_1004912 JGI24746J21847_10049122 204
146 3300005293 Ga0065715_10002036 Ga0065715_100020361 204
147 3300005293 Ga0065715_10090848 Ga0065715_100908483 204
148 3300005328 Ga0070676_10005401 Ga0070676_100054013 204
149 3300005330 Ga0070690_100028865 Ga0070690_1000288652 204
150 3300005331 Ga0070670_100050412 Ga0070670_1000504123 204
151 3300005333 Ga0070677_10003668 Ga0070677_100036681 204
152 3300005333 Ga0070677_10015927 Ga0070677_100159272 204
153 3300005334 Ga0068869_100002360 Ga0068869_1000023605 204
154 3300005334 Ga0068869_100052654 Ga0068869_1000526543 204
155 3300005335 Ga0070666_10074705 Ga0070666_100747052 204
156 3300005338 Ga0068868_100004023 Ga0068868_1000040238 204
157 3300005340 Ga0070689_100094911 Ga0070689_1000949112 204
158 3300005343 Ga0070687_100036911 Ga0070687_1000369112 204
159 3300005344 Ga0070661_100013223 Ga0070661_1000132235 204
160 3300005353 Ga0070669_100017805 Ga0070669_1000178055 204
161 3300005353 Ga0070669_100041443 Ga0070669_1000414433 204
162 3300005353 Ga0070669_100318936 Ga0070669_1003189362 204
163 3300005354 Ga0070675_100021825 Ga0070675_1000218255 204
164 3300005354 Ga0070675_100210132 Ga0070675_1002101322 204
165 3300005356 Ga0070674_100014835 Ga0070674_1000148351 204
166 3300005365 Ga0070688_100008733 Ga0070688_1000087332 204
167 3300005365 Ga0070688_100010648 Ga0070688_1000106485 204
168 3300005367 Ga0070667_100004379 Ga0070667_1000043798 204
169 3300005438 Ga0070701_10002666 Ga0070701_100026665 204
170 3300005444 Ga0070694_100368568 Ga0070694_1003685681 204
171 3300005444 Ga0070694_100420021 Ga0070694_1004200211 204
172 3300005456 Ga0070678_100065365 Ga0070678_1000653652 204
173 3300005456 Ga0070678_100082415 Ga0070678_1000824152 204
174 3300005456 Ga0070678_100154195 Ga0070678_1001541952 204
175 3300005457 Ga0070662_100473551 Ga0070662_1004735512 204
176 3300005459 Ga0068867_100045769 Ga0068867_1000457693 204
177 3300005459 Ga0068867_100060652 Ga0068867_1000606522 204
178 3300005543 Ga0070672_100005404 Ga0070672_1000054043 204
179 3300005543 Ga0070672_100479672 Ga0070672_1004796722 204
180 3300005548 Ga0070665_100031938 Ga0070665_1000319386 204
181 3300005549 Ga0070704_100119681 Ga0070704_1001196812 204
182 3300005564 Ga0070664_100003952 Ga0070664_10000395210 204
183 3300005617 Ga0068859_100016066 Ga0068859_1000160663 204
184 3300005617 Ga0068859_100118592 Ga0068859_1001185922 204
185 3300005617 Ga0068859_100221686 Ga0068859_1002216861 204
186 3300005618 Ga0068864_100023764 Ga0068864_1000237646 204
187 3300005618 Ga0068864_100038389 Ga0068864_1000383891 204
188 3300005718 Ga0068866_10156646 Ga0068866_101566462 204
189 3300005719 Ga0068861_100010906 Ga0068861_1000109065 204
190 3300005840 Ga0068870_10001197 Ga0068870_100011972 204
191 3300005840 Ga0068870_10046106 Ga0068870_100461061 204
192 3300005842 Ga0068858_100024277 Ga0068858_1000242775 204
193 3300005844 Ga0068862_100001009 Ga0068862_10000100916 204
194 3300005844 Ga0068862_100241598 Ga0068862_1002415982 204
195 3300006844 Ga0075428_100000825 Ga0075428_10000082515 204
196 3300006844 Ga0075428_100049052 Ga0075428_1000490525 204
197 3300006846 Ga0075430_100000247 Ga0075430_10000024710 204
198 3300006847 Ga0075431_100001568 Ga0075431_10000156812 204
199 3300006852 Ga0075433_10004228 Ga0075433_100042285 204
200 3300006871 Ga0075434_100003555 Ga0075434_1000035555 204
201 3300006880 Ga0075429_100000378 Ga0075429_10000037825 204
202 3300006880 Ga0075429_100016527 Ga0075429_1000165272 204
203 3300006881 Ga0068865_100305011 Ga0068865_1003050112 204
204 3300006931 Ga0097620_100016066 Ga0097620_1000160663 204
205 3300006931 Ga0097620_100118598 Ga0097620_1001185982 204
206 3300006931 Ga0097620_100221696 Ga0097620_1002216961 204
207 3300007076 Ga0075435_100058984 Ga0075435_1000589842 204
208 3300009094 Ga0111539_10002220 Ga0111539_100022203 204
209 3300009094 Ga0111539_10084466 Ga0111539_100844662 204
210 3300009147 Ga0114129_10427398 Ga0114129_104273981 204
211 3300009553 Ga0105249_10000828 Ga0105249_100008285 204
212 3300011119 Ga0105246_10685900 Ga0105246_106859002 204
213 3300013296 Ga0157374_10456499 Ga0157374_104564992 204
214 3300013306 Ga0163162_10006203 Ga0163162_100062032 204
215 3300013308 Ga0157375_10246611 Ga0157375_102466112 204
216 3300014325 Ga0163163_10419882 Ga0163163_104198822 204
217 3300014326 Ga0157380_10077931 Ga0157380_100779311 204
218 3300014326 Ga0157380_10255952 Ga0157380_102559522 204
219 3300014745 Ga0157377_10005232 Ga0157377_100052325 204
220 3300014745 Ga0157377_10070293 Ga0157377_100702932 204
221 3300014968 Ga0157379_10074380 Ga0157379_100743802 204
222 3300014969 Ga0157376_10920835 Ga0157376_109208352 204
223 3300017792 Ga0163161_10053883 Ga0163161_100538832 204
224 3300017792 Ga0163161_10148198 Ga0163161_101481982 204
225 3300025893 Ga0207682_10002603 Ga0207682_100026035 204
226 3300025893 Ga0207682_10009938 Ga0207682_100099382 204
227 3300025893 Ga0207682_10017319 Ga0207682_100173192 204
228 3300025901 Ga0207688_10000665 Ga0207688_1000066511 204
229 3300025901 Ga0207688_10091041 Ga0207688_100910411 204
230 3300025903 Ga0207680_10012699 Ga0207680_100126992 204
231 3300025907 Ga0207645_10000277 Ga0207645_1000027737 204
232 3300025908 Ga0207643_10000129 Ga0207643_1000012941 204
233 3300025908 Ga0207643_10004548 Ga0207643_100045482 204
234 3300025918 Ga0207662_10001289 Ga0207662_100012892 204
235 3300025919 Ga0207657_10058837 Ga0207657_100588372 204
236 3300025920 Ga0207649_10089212 Ga0207649_100892123 204
237 3300025923 Ga0207681_10282785 Ga0207681_102827852 204
238 3300025926 Ga0207659_10029613 Ga0207659_100296133 204
239 3300025933 Ga0207706_10027597 Ga0207706_100275975 204
240 3300025933 Ga0207706_10179096 Ga0207706_101790962 204
241 3300025936 Ga0207670_10117243 Ga0207670_101172431 204
242 3300025937 Ga0207669_10000173 Ga0207669_100001735 204
243 3300025937 Ga0207669_10038413 Ga0207669_100384133 204
244 3300025940 Ga0207691_10002509 Ga0207691_100025097 204
245 3300025940 Ga0207691_10013481 Ga0207691_100134814 204
246 3300025940 Ga0207691_10208459 Ga0207691_102084592 204
247 3300025942 Ga0207689_10020574 Ga0207689_100205742 204
248 3300025942 Ga0207689_10065676 Ga0207689_100656762 204
249 3300025945 Ga0207679_10016367 Ga0207679_100163675 204
250 3300025960 Ga0207651_10006701 Ga0207651_100067012 204
251 3300025960 Ga0207651_10059040 Ga0207651_100590402 204
252 3300025972 Ga0207668_10066013 Ga0207668_100660133 204
253 3300026023 Ga0207677_10317432 Ga0207677_103174322 204
254 3300026075 Ga0207708_10389628 Ga0207708_103896281 204
255 3300026088 Ga0207641_10020487 Ga0207641_100204872 204
256 3300026089 Ga0207648_10099589 Ga0207648_100995893 204
257 3300026089 Ga0207648_10151531 Ga0207648_101515312 204
258 3300026089 Ga0207648_10342766 Ga0207648_103427662 204
259 3300026095 Ga0207676_10021739 Ga0207676_100217393 204
260 3300026095 Ga0207676_10403673 Ga0207676_104036732 204
261 3300026118 Ga0207675_100008956 Ga0207675_1000089565 204
262 3300026121 Ga0207683_10144219 Ga0207683_101442192 204
263 3300027876 Ga0209974_10022202 Ga0209974_100222022 204
264 3300027907 Ga0207428_10003472 Ga0207428_1000347213 204
265 3300028380 Ga0268265_10025009 Ga0268265_100250092 204
266 3300028380 Ga0268265_10157492 Ga0268265_101574922 204
267 3300028381 Ga0268264_10610179 Ga0268264_106101791 204
268 3300042008 Ga0439450_014135 Ga0439450_014135_342_1049 204
269 3300042436 Ga0439435_0136127 Ga0439435_0136127_23_712 204
270 3300045051 Ga0451576_0087694 Ga0451576_0087694_1112_1819 204
271 3300050507 nmdc:mga05p37_278878_c1 nmdc:mga05p37_278878_c1_92_799 204
272 3300050508 nmdc:mga09592_252_c1 nmdc:mga09592_252_c1_19261_19968 204
273 3300050509 nmdc:mga0qj67_9418_c1 nmdc:mga0qj67_9418_c1_1189_1896 204
274 3300050510 nmdc:mga06r32_148444_c1 nmdc:mga06r32_148444_c1_1514_2215 204
275 3300050510 nmdc:mga06r32_504_c1 nmdc:mga06r32_504_c1_17114_17821 204
276 3300050511 nmdc:mga08y16_624036_c1 nmdc:mga08y16_624036_c1_341_1048 204
277 3300050511 nmdc:mga08y16_690655_c1 nmdc:mga08y16_690655_c1_47_754 204
278 3300050512 nmdc:mga0n895_1515_c1 nmdc:mga0n895_1515_c1_2447_3154 204
279 3300050515 nmdc:mga0a205_613_c1 nmdc:mga0a205_613_c1_1930_2637 204
280 2162886011 MRS1b_contig_387710 MRS1b_0281.00003140 205
281 3300005289 Ga0065704_10074016 Ga0065704_100740167 205
282 3300005290 Ga0065712_10068121 Ga0065712_100681213 205
283 3300005328 Ga0070676_10366879 Ga0070676_103668792 205
284 3300005329 Ga0070683_100033791 Ga0070683_1000337913 205
285 3300005329 Ga0070683_100087106 Ga0070683_1000871063 205
286 3300005330 Ga0070690_100024641 Ga0070690_1000246412 205
287 3300005330 Ga0070690_100092038 Ga0070690_1000920382 205
288 3300005336 Ga0070680_100158146 Ga0070680_1001581462 205
289 3300005339 Ga0070660_100340030 Ga0070660_1003400302 205
290 3300005340 Ga0070689_100009376 Ga0070689_1000093764 205
291 3300005340 Ga0070689_100018126 Ga0070689_1000181262 205
292 3300005340 Ga0070689_100182716 Ga0070689_1001827161 205
293 3300005345 Ga0070692_10229418 Ga0070692_102294182 205
294 3300005353 Ga0070669_100006055 Ga0070669_1000060552 205
295 3300005354 Ga0070675_100002287 Ga0070675_1000022876 205
296 3300005354 Ga0070675_100005453 Ga0070675_1000054535 205
297 3300005354 Ga0070675_100007958 Ga0070675_1000079585 205
298 3300005354 Ga0070675_100046261 Ga0070675_1000462611 205
299 3300005355 Ga0070671_100064753 Ga0070671_1000647532 205
300 3300005364 Ga0070673_100012161 Ga0070673_1000121611 205
301 3300005364 Ga0070673_100023619 Ga0070673_1000236193 205
302 3300005364 Ga0070673_100030805 Ga0070673_1000308052 205
303 3300005364 Ga0070673_100039537 Ga0070673_1000395372 205
304 3300005364 Ga0070673_100209110 Ga0070673_1002091102 205
305 3300005365 Ga0070688_100042927 Ga0070688_1000429272 205
306 3300005365 Ga0070688_100059723 Ga0070688_1000597232 205
307 3300005436 Ga0070713_100008483 Ga0070713_1000084832 205
308 3300005438 Ga0070701_10001027 Ga0070701_100010275 205
309 3300005440 Ga0070705_100011096 Ga0070705_1000110962 205
310 3300005441 Ga0070700_100033139 Ga0070700_1000331392 205
311 3300005441 Ga0070700_100104246 Ga0070700_1001042461 205
312 3300005444 Ga0070694_100001154 Ga0070694_1000011549 205
313 3300005444 Ga0070694_100001406 Ga0070694_10000140613 205
314 3300005444 Ga0070694_100241345 Ga0070694_1002413451 205
315 3300005445 Ga0070708_100501216 Ga0070708_1005012162 205
316 3300005457 Ga0070662_100126340 Ga0070662_1001263402 205
317 3300005458 Ga0070681_10099697 Ga0070681_100996973 205
318 3300005459 Ga0068867_100002577 Ga0068867_1000025773 205
319 3300005459 Ga0068867_100270101 Ga0068867_1002701012 205
320 3300005467 Ga0070706_100188460 Ga0070706_1001884602 205
321 3300005471 Ga0070698_100003115 Ga0070698_10000311516 205
322 3300005471 Ga0070698_100040523 Ga0070698_1000405232 205
323 3300005471 Ga0070698_100290835 Ga0070698_1002908352 205
324 3300005518 Ga0070699_100006579 Ga0070699_1000065793 205
325 3300005518 Ga0070699_100026984 Ga0070699_1000269845 205
326 3300005530 Ga0070679_100189094 Ga0070679_1001890942 205
327 3300005536 Ga0070697_100096970 Ga0070697_1000969702 205
328 3300005543 Ga0070672_100051445 Ga0070672_1000514453 205
329 3300005543 Ga0070672_100053626 Ga0070672_1000536263 205
330 3300005544 Ga0070686_100284113 Ga0070686_1002841132 205
331 3300005545 Ga0070695_100000013 Ga0070695_1000000133 205
332 3300005545 Ga0070695_100195099 Ga0070695_1001950992 205
333 3300005545 Ga0070695_100341485 Ga0070695_1003414852 205
334 3300005546 Ga0070696_100003152 Ga0070696_1000031523 205
335 3300005546 Ga0070696_100021391 Ga0070696_1000213913 205
336 3300005546 Ga0070696_100061035 Ga0070696_1000610352 205
337 3300005546 Ga0070696_100135944 Ga0070696_1001359442 205
338 3300005546 Ga0070696_100352547 Ga0070696_1003525471 205
339 3300005549 Ga0070704_100002422 Ga0070704_1000024222 205
340 3300005549 Ga0070704_100004325 Ga0070704_1000043251 205
341 3300005549 Ga0070704_100288938 Ga0070704_1002889381 205
342 3300005564 Ga0070664_100232466 Ga0070664_1002324662 205
343 3300005564 Ga0070664_100359445 Ga0070664_1003594451 205
344 3300005577 Ga0068857_100014860 Ga0068857_1000148604 205
345 3300005615 Ga0070702_100036092 Ga0070702_1000360921 205
346 3300005617 Ga0068859_100002987 Ga0068859_1000029878 205
347 3300005617 Ga0068859_100005331 Ga0068859_1000053319 205
348 3300005617 Ga0068859_100520671 Ga0068859_1005206712 205
349 3300005618 Ga0068864_100046224 Ga0068864_1000462243 205
350 3300005618 Ga0068864_100246155 Ga0068864_1002461552 205
351 3300005618 Ga0068864_100483068 Ga0068864_1004830682 205
352 3300005719 Ga0068861_100028966 Ga0068861_1000289662 205
353 3300005840 Ga0068870_10004966 Ga0068870_100049663 205
354 3300005843 Ga0068860_100009524 Ga0068860_1000095247 205
355 3300005844 Ga0068862_100001050 Ga0068862_1000010506 205
356 3300005844 Ga0068862_100331778 Ga0068862_1003317782 205
357 3300006358 Ga0068871_100139914 Ga0068871_1001399142 205
358 3300006844 Ga0075428_100016682 Ga0075428_1000166825 205
359 3300006844 Ga0075428_100199992 Ga0075428_1001999922 205
360 3300006844 Ga0075428_100648822 Ga0075428_1006488221 205
361 3300006844 Ga0075428_100977263 Ga0075428_1009772632 205
362 3300006846 Ga0075430_100001103 Ga0075430_1000011033 205
363 3300006846 Ga0075430_100032651 Ga0075430_1000326512 205
364 3300006846 Ga0075430_100253983 Ga0075430_1002539832 205
365 3300006847 Ga0075431_100009315 Ga0075431_1000093153 205
366 3300006847 Ga0075431_100120213 Ga0075431_1001202132 205
367 3300006852 Ga0075433_10006958 Ga0075433_100069585 205
368 3300006852 Ga0075433_10052925 Ga0075433_100529253 205
369 3300006852 Ga0075433_10057220 Ga0075433_100572202 205
370 3300006852 Ga0075433_10266782 Ga0075433_102667822 205
371 3300006871 Ga0075434_100001546 Ga0075434_10000154610 205
372 3300006871 Ga0075434_100001899 Ga0075434_1000018995 205
373 3300006871 Ga0075434_100043743 Ga0075434_1000437432 205
374 3300006871 Ga0075434_100083687 Ga0075434_1000836873 205
375 3300006880 Ga0075429_100023485 Ga0075429_1000234855 205
376 3300006880 Ga0075429_100060258 Ga0075429_1000602582 205
377 3300006880 Ga0075429_100107149 Ga0075429_1001071492 205
378 3300006880 Ga0075429_100307833 Ga0075429_1003078332 205
379 3300006880 Ga0075429_100313100 Ga0075429_1003131002 205
380 3300006881 Ga0068865_100154011 Ga0068865_1001540112 205
381 3300006914 Ga0075436_100291428 Ga0075436_1002914282 205
382 3300006931 Ga0097620_100002987 Ga0097620_10000298711 205
383 3300006931 Ga0097620_100005331 Ga0097620_1000053319 205
384 3300006931 Ga0097620_100520698 Ga0097620_1005206982 205
385 3300007076 Ga0075435_100009149 Ga0075435_1000091496 205
386 3300007076 Ga0075435_100180588 Ga0075435_1001805882 205
387 3300009094 Ga0111539_10004160 Ga0111539_1000416014 205
388 3300009094 Ga0111539_10008357 Ga0111539_1000835712 205
389 3300009094 Ga0111539_10342193 Ga0111539_103421933 205
390 3300009094 Ga0111539_10456904 Ga0111539_104569042 205
391 3300009098 Ga0105245_10549384 Ga0105245_105493842 205
392 3300009147 Ga0114129_10000550 Ga0114129_1000055030 205
393 3300009147 Ga0114129_10025725 Ga0114129_100257253 205
394 3300009147 Ga0114129_10046452 Ga0114129_100464523 205
395 3300009147 Ga0114129_10072301 Ga0114129_100723015 205
396 3300009147 Ga0114129_10092535 Ga0114129_100925354 205
397 3300009147 Ga0114129_10486722 Ga0114129_104867222 205
398 3300009147 Ga0114129_10893372 Ga0114129_108933722 205
399 3300009148 Ga0105243_10039392 Ga0105243_100393922 205
400 3300009148 Ga0105243_10068266 Ga0105243_100682662 205
401 3300009148 Ga0105243_11279516 Ga0105243_112795161 205
402 3300009176 Ga0105242_10124782 Ga0105242_101247823 205
403 3300009553 Ga0105249_10001504 Ga0105249_1000150415 205
404 3300013297 Ga0157378_10513204 Ga0157378_105132042 205
405 3300013308 Ga0157375_10007218 Ga0157375_100072187 205
406 3300013308 Ga0157375_10139347 Ga0157375_101393472 205
407 3300013308 Ga0157375_10183063 Ga0157375_101830632 205
408 3300014326 Ga0157380_10028740 Ga0157380_100287404 205
409 3300014326 Ga0157380_10406904 Ga0157380_104069042 205
410 3300014326 Ga0157380_10702796 Ga0157380_107027961 205
411 3300014745 Ga0157377_10028756 Ga0157377_100287562 205
412 3300014969 Ga0157376_10093131 Ga0157376_100931313 205
413 3300014969 Ga0157376_11006000 Ga0157376_110060001 205
414 3300017792 Ga0163161_10626907 Ga0163161_106269072 205
415 3300025901 Ga0207688_10090212 Ga0207688_100902122 205
416 3300025904 Ga0207647_10074887 Ga0207647_100748872 205
417 3300025907 Ga0207645_10144844 Ga0207645_101448442 205
418 3300025908 Ga0207643_10002219 Ga0207643_100022196 205
419 3300025912 Ga0207707_10203216 Ga0207707_102032162 205
420 3300025918 Ga0207662_10003301 Ga0207662_100033018 205
421 3300025918 Ga0207662_10062604 Ga0207662_100626042 205
422 3300025922 Ga0207646_10090535 Ga0207646_100905352 205
423 3300025922 Ga0207646_10485046 Ga0207646_104850462 205
424 3300025923 Ga0207681_10011317 Ga0207681_100113173 205
425 3300025932 Ga0207690_10229629 Ga0207690_102296292 205
426 3300025933 Ga0207706_10035227 Ga0207706_100352275 205
427 3300025933 Ga0207706_10158469 Ga0207706_101584692 205
428 3300025936 Ga0207670_10042153 Ga0207670_100421532 205
429 3300025936 Ga0207670_10077700 Ga0207670_100777002 205
430 3300025938 Ga0207704_10102813 Ga0207704_101028132 205
431 3300025940 Ga0207691_10272879 Ga0207691_102728792 205
432 3300025945 Ga0207679_10019165 Ga0207679_100191653 205
433 3300025945 Ga0207679_10058898 Ga0207679_100588983 205
434 3300025945 Ga0207679_10294710 Ga0207679_102947101 205
435 3300025960 Ga0207651_10013049 Ga0207651_100130492 205
436 3300025960 Ga0207651_10049633 Ga0207651_100496333 205
437 3300025960 Ga0207651_10067615 Ga0207651_100676152 205
438 3300025960 Ga0207651_10415733 Ga0207651_104157331 205
439 3300025961 Ga0207712_10051468 Ga0207712_100514682 205
440 3300026075 Ga0207708_10006372 Ga0207708_100063723 205
441 3300026075 Ga0207708_10022127 Ga0207708_100221273 205
442 3300026075 Ga0207708_10124550 Ga0207708_101245502 205
443 3300026089 Ga0207648_10000506 Ga0207648_100005065 205
444 3300026095 Ga0207676_10017765 Ga0207676_100177652 205
445 3300026095 Ga0207676_10098290 Ga0207676_100982903 205
446 3300026116 Ga0207674_10011761 Ga0207674_100117614 205
447 3300026118 Ga0207675_100002376 Ga0207675_10000237614 205
448 3300026118 Ga0207675_100732971 Ga0207675_1007329711 205
449 3300027907 Ga0207428_10002283 Ga0207428_100022832 205
450 3300027907 Ga0207428_10007107 Ga0207428_100071079 205
451 3300027907 Ga0207428_10048267 Ga0207428_100482672 205
452 3300028380 Ga0268265_10000135 Ga0268265_1000013540 205
453 3300028380 Ga0268265_10214939 Ga0268265_102149392 205
454 3300035086 Ga0373934_0106101 Ga0373934_0106101_182_856 205
455 3300035119 Ga0373956_0208925 Ga0373956_0208925_104_778 205
456 3300035170 Ga0373943_0397683 Ga0373943_0397683_62_736 205
457 3300035692 Ga0373935_0035925 Ga0373935_0035925_188_862 205
458 3300036401 Ga0373937_0105036 Ga0373937_0105036_77_751 205
459 3300042876 Ga0451577_0551304 Ga0451577_0551304_303_1007 205
460 3300045051 Ga0451576_0010856 Ga0451576_0010856_455_1129 205
461 3300045051 Ga0451576_0033794 Ga0451576_0033794_1932_2606 205
462 3300045051 Ga0451576_0535414 Ga0451576_0535414_59_751 205
463 3300046455 Ga0495603_0015526 Ga0495603_0015526_2839_3513 205
464 3300046459 Ga0495629_0112232 Ga0495629_0112232_928_1602 205
465 3300046491 Ga0495584_0014069 Ga0495584_0014069_1419_2111 205
466 3300046499 Ga0495594_0063371 Ga0495594_0063371_577_1251 205
467 3300046523 Ga0495644_0119007 Ga0495644_0119007_97_780 205
468 3300046525 Ga0495663_0027500 Ga0495663_0027500_313_1005 205
469 3300046538 Ga0495609_0011821 Ga0495609_0011821_2389_3081 205
470 3300046539 Ga0495621_0007101 Ga0495621_0007101_2222_2896 205
471 3300046539 Ga0495621_0044557 Ga0495621_0044557_201_884 205
472 3300046539 Ga0495621_0081922 Ga0495621_0081922_415_1089 205
473 3300046664 Ga0495659_0005360 Ga0495659_0005360_3125_3829 205
474 3300046681 Ga0495647_0157167 Ga0495647_0157167_163_837 205
475 3300048912 Ga0496109_0062244 Ga0496109_0062244_1841_2458 205
476 3300049575 Ga0501039_0096630 Ga0501039_0096630_801_1424 205
477 3300049578 Ga0501042_0257515 Ga0501042_0257515_512_1135 205
478 3300049579 Ga0501043_0270119 Ga0501043_0270119_605_1228 205
479 3300049580 Ga0501046_0395040 Ga0501046_0395040_260_883 205
480 3300049583 Ga0501067_0047038 Ga0501067_0047038_449_1153 205
481 3300049589 Ga0501073_0460830 Ga0501073_0460830_223_846 205
482 3300049591 Ga0501075_0095681 Ga0501075_0095681_427_1050 205
483 3300049592 Ga0501076_0050355 Ga0501076_0050355_2624_3247 205
484 3300049593 Ga0501077_0194536 Ga0501077_0194536_514_1137 205
485 3300049743 Ga0501081_0380825 Ga0501081_0380825_363_986 205
486 3300049824 Ga0501045_0206845 Ga0501045_0206845_75_698 205
487 3300050507 nmdc:mga05p37_100039_c1 nmdc:mga05p37_100039_c1_2761_3435 205
488 3300050507 nmdc:mga05p37_1854_c1 nmdc:mga05p37_1854_c1_22020_22724 205
489 3300050507 nmdc:mga05p37_221497_c1 nmdc:mga05p37_221497_c1_1214_1888 205
490 3300050507 nmdc:mga05p37_245821_c1 nmdc:mga05p37_245821_c1_1393_2082 205
491 3300050507 nmdc:mga05p37_256239_c1 nmdc:mga05p37_256239_c1_1232_1924 205
492 3300050507 nmdc:mga05p37_43996_c1 nmdc:mga05p37_43996_c1_84_758 205
493 3300050507 nmdc:mga05p37_76590_c1 nmdc:mga05p37_76590_c1_283_966 205
494 3300050507 nmdc:mga05p37_769768_c1 nmdc:mga05p37_769768_c1_158_775 205
495 3300050508 nmdc:mga09592_157585_c1 nmdc:mga09592_157585_c1_123_740 205
496 3300050508 nmdc:mga09592_26536_c1 nmdc:mga09592_26536_c1_3230_3913 205
497 3300050508 nmdc:mga09592_27446_c1 nmdc:mga09592_27446_c1_1532_2236 205
498 3300050508 nmdc:mga09592_333401_c1 nmdc:mga09592_333401_c1_535_1209 205
499 3300050508 nmdc:mga09592_419660_c1 nmdc:mga09592_419660_c1_436_1110 205
500 3300050509 nmdc:mga0qj67_8836_c1 nmdc:mga0qj67_8836_c1_3336_4019 205
501 3300050510 nmdc:mga06r32_187318_c1 nmdc:mga06r32_187318_c1_1324_1998 205
502 3300050510 nmdc:mga06r32_69967_c1 nmdc:mga06r32_69967_c1_307_990 205
503 3300050510 nmdc:mga06r32_793904_c1 nmdc:mga06r32_793904_c1_155_832 205
504 3300050511 nmdc:mga08y16_2643_c1 nmdc:mga08y16_2643_c1_15484_16161 205
505 3300050511 nmdc:mga08y16_72077_c1 nmdc:mga08y16_72077_c1_1920_2594 205
506 3300050511 nmdc:mga08y16_812_c1 nmdc:mga08y16_812_c1_27944_28648 205
507 3300050512 nmdc:mga0n895_112801_c1 nmdc:mga0n895_112801_c1_551_1243 205
508 3300050512 nmdc:mga0n895_380386_c1 nmdc:mga0n895_380386_c1_268_942 205
509 3300050512 nmdc:mga0n895_38713_c1 nmdc:mga0n895_38713_c1_929_1633 205
510 3300050513 nmdc:mga0rr50_100757_c1 nmdc:mga0rr50_100757_c1_10_702 205
511 3300050513 nmdc:mga0rr50_73072_c1 nmdc:mga0rr50_73072_c1_1253_1945 205
512 3300050515 nmdc:mga0a205_120835_c1 nmdc:mga0a205_120835_c1_550_1254 205
513 3300050515 nmdc:mga0a205_64046_c1 nmdc:mga0a205_64046_c1_1218_1892 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

25

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8334 1 197
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8288 5 197
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.8201 1 197
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8076 57 196
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.7992 57 197
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8522 59 119 3.40.50.150
af_A0A1D6LW08_103_253_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8493 82 197 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8334 1 197 3.40.50.150
3g8bB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8256 9 197 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8253 3 197 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2G4JM36-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9714 1 197 GO:0005829
GO:0070043
AF-A0A2D9M476-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9538 1 205 GO:0005829
GO:0070043
AF-A0A3N5PIC8-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9495 1 197 GO:0005829
GO:0070043
AF-A0A2D9M476-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9403 1 205 GO:0005829
GO:0070043
AF-A0A2G4JM36-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9297 1 197 GO:0005829
GO:0070043

Feature Viewer

pLDDT pTM Quality
89.56 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map