F457560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 513 | 294 | 492 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10097266|Ga0105238_100972662 |
| Length | 214 |
| Sequence | LLPRKLGTGDSARQARRLEVLNIVRIVSGSFRGKTLAAPAGEATRPTSDRARQAIFNILEHAAWSPGLRDVRVIDLFAGSGALGFEALSRGAAFCLFVETDEAARGAIRENVEAMGLFGVTRVHRRDATDLGMRPGADGPAFDFAFLDPPYAKGLGETALDKLAAGGWLKPGATVVFERGAGEPDLDIAGFEPLDIRDYGAARVSFLRFAETPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 7 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 8 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 9 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 10 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 11 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 12 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 13 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 14 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 15 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 16 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 17 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 18 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 19 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 20 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 21 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 165 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 274 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 275 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 277 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 278 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 279 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 281 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 282 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 283 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 284 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 286 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 287 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 289 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.91 |
| Metatranscriptomes | 0 |
| Isolates | 4.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.94 |
| Nodule | 0 |
| Rhizoplane | 4.68 |
| Rhizosphere | 77.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10106005 | 3300003320 | Bacteria | 1200 |
| 2 | Ga0055536_1001003 | 3300003781 | Bacteria | 17938 |
| 3 | Ga0055530_10000337 | 3300003791 | Bacteria | 42372 |
| 4 | Ga0055530_10001846 | 3300003791 | Bacteria | 14564 |
| 5 | Ga0055530_10003612 | 3300003791 | Bacteria | 8681 |
| 6 | Ga0055531_10000820 | 3300003794 | Bacteria | 25755 |
| 7 | Ga0055531_10001142 | 3300003794 | Bacteria | 20555 |
| 8 | Ga0055543_1024023 | 3300004625 | Bacteria | 1096 |
| 9 | Ga0065165_1000171 | 3300005262 | Bacteria | 114917 |
| 10 | Ga0070658_10214714 | 3300005327 | Bacteria | 1626 |
| 11 | Ga0070658_10378802 | 3300005327 | Bacteria | 1213 |
| 12 | Ga0070670_100145858 | 3300005331 | Bacteria | 2048 |
| 13 | Ga0070670_100155670 | 3300005331 | Bacteria | 1979 |
| 14 | Ga0070670_100293181 | 3300005331 | Bacteria | 1422 |
| 15 | Ga0070666_10194976 | 3300005335 | Bacteria | 1424 |
| 16 | Ga0070680_100018418 | 3300005336 | Bacteria | 5517 |
| 17 | Ga0070680_100037522 | 3300005336 | Bacteria | 3915 |
| 18 | Ga0070682_100022064 | 3300005337 | Bacteria | 3766 |
| 19 | Ga0070682_100385777 | 3300005337 | Bacteria | 1055 |
| 20 | Ga0070660_100074290 | 3300005339 | Bacteria | 2660 |
| 21 | Ga0070660_100081723 | 3300005339 | Bacteria | 2537 |
| 22 | Ga0070691_10012514 | 3300005341 | Bacteria | 3886 |
| 23 | Ga0070687_100263958 | 3300005343 | Bacteria | 1076 |
| 24 | Ga0070661_100100169 | 3300005344 | Bacteria | 2154 |
| 25 | Ga0070668_100025547 | 3300005347 | Bacteria | 4479 |
| 26 | Ga0070668_100063153 | 3300005347 | Bacteria | 2870 |
| 27 | Ga0070671_100014187 | 3300005355 | Bacteria | 6433 |
| 28 | Ga0070671_100367153 | 3300005355 | Bacteria | 1229 |
| 29 | Ga0070671_101357076 | 3300005355 | Bacteria | 628 |
| 30 | Ga0070659_100000572 | 3300005366 | Bacteria | 26951 |
| 31 | Ga0070659_100012877 | 3300005366 | Bacteria | 6216 |
| 32 | Ga0070667_100010707 | 3300005367 | Bacteria | 7580 |
| 33 | Ga0070711_100561417 | 3300005439 | Bacteria | 948 |
| 34 | Ga0070705_100055287 | 3300005440 | Bacteria | 2332 |
| 35 | Ga0070705_100536724 | 3300005440 | Bacteria | 894 |
| 36 | Ga0070694_100035770 | 3300005444 | Bacteria | 3286 |
| 37 | Ga0070663_100001790 | 3300005455 | Bacteria | 11959 |
| 38 | Ga0070678_100029073 | 3300005456 | Bacteria | 3780 |
| 39 | Ga0070662_100174784 | 3300005457 | Bacteria | 1689 |
| 40 | Ga0070679_100082950 | 3300005530 | Bacteria | 3195 |
| 41 | Ga0068853_100038979 | 3300005539 | Bacteria | 4051 |
| 42 | Ga0068853_100092445 | 3300005539 | Bacteria | 2661 |
| 43 | Ga0068853_100595447 | 3300005539 | Bacteria | 1050 |
| 44 | Ga0070672_100585561 | 3300005543 | Bacteria | 971 |
| 45 | Ga0070665_100000622 | 3300005548 | Bacteria | 48397 |
| 46 | Ga0070665_100075069 | 3300005548 | Bacteria | 3387 |
| 47 | Ga0068855_100055347 | 3300005563 | Bacteria | 4660 |
| 48 | Ga0068855_100209297 | 3300005563 | Bacteria | 2192 |
| 49 | Ga0068855_100230580 | 3300005563 | Bacteria | 2074 |
| 50 | Ga0068855_100243925 | 3300005563 | Bacteria | 2006 |
| 51 | Ga0070664_100214143 | 3300005564 | Bacteria | 1722 |
| 52 | Ga0068854_100326935 | 3300005578 | Bacteria | 1248 |
| 53 | Ga0068856_100494539 | 3300005614 | Bacteria | 1244 |
| 54 | Ga0070702_100116787 | 3300005615 | Bacteria | 1664 |
| 55 | Ga0068852_101100624 | 3300005616 | Bacteria | 815 |
| 56 | Ga0068859_100013721 | 3300005617 | Bacteria | 8124 |
| 57 | Ga0068864_100008710 | 3300005618 | Bacteria | 8367 |
| 58 | Ga0068864_100075368 | 3300005618 | Bacteria | 2946 |
| 59 | Ga0068864_100529412 | 3300005618 | Bacteria | 1137 |
| 60 | Ga0068864_101209508 | 3300005618 | Unclassified | 754 |
| 61 | Ga0068861_100051839 | 3300005719 | Bacteria | 3117 |
| 62 | Ga0068861_100257978 | 3300005719 | Bacteria | 1491 |
| 63 | Ga0068863_100000045 | 3300005841 | Bacteria | 147269 |
| 64 | Ga0068863_100026291 | 3300005841 | Bacteria | 5553 |
| 65 | Ga0068863_100049914 | 3300005841 | Bacteria | 3968 |
| 66 | Ga0068858_100033334 | 3300005842 | Bacteria | 4781 |
| 67 | Ga0068858_100109610 | 3300005842 | Bacteria | 2578 |
| 68 | Ga0068860_100028753 | 3300005843 | Bacteria | 5350 |
| 69 | Ga0068860_100177028 | 3300005843 | Bacteria | 2061 |
| 70 | Ga0068860_100244402 | 3300005843 | Bacteria | 1746 |
| 71 | Ga0068862_100008821 | 3300005844 | Bacteria | 8349 |
| 72 | Ga0068862_100012456 | 3300005844 | Bacteria | 7038 |
| 73 | Ga0068862_100030139 | 3300005844 | Bacteria | 4571 |
| 74 | Ga0068862_100496876 | 3300005844 | Bacteria | 1157 |
| 75 | Ga0081455_10000022 | 3300005937 | Bacteria | 159620 |
| 76 | Ga0081455_10093505 | 3300005937 | Bacteria | 2430 |
| 77 | Ga0070717_10168089 | 3300006028 | Bacteria | 1906 |
| 78 | Ga0070717_10529217 | 3300006028 | Bacteria | 1067 |
| 79 | Ga0075365_10379122 | 3300006038 | Bacteria | 998 |
| 80 | Ga0075365_10929178 | 3300006038 | Bacteria | 613 |
| 81 | Ga0075432_10046497 | 3300006058 | Bacteria | 1523 |
| 82 | Ga0075369_10003307 | 3300006186 | Bacteria | 5856 |
| 83 | Ga0075370_10049315 | 3300006353 | Bacteria | 2386 |
| 84 | Ga0068871_100880406 | 3300006358 | Unclassified | 829 |
| 85 | Ga0075428_100075472 | 3300006844 | Bacteria | 3681 |
| 86 | Ga0075428_100466011 | 3300006844 | Bacteria | 1353 |
| 87 | Ga0075430_100462244 | 3300006846 | Bacteria | 1047 |
| 88 | Ga0075431_100006746 | 3300006847 | Bacteria | 11400 |
| 89 | Ga0075431_100021213 | 3300006847 | Bacteria | 6638 |
| 90 | Ga0075431_100056098 | 3300006847 | Bacteria | 4064 |
| 91 | Ga0075431_100730527 | 3300006847 | Bacteria | 966 |
| 92 | Ga0075431_100781980 | 3300006847 | Bacteria | 928 |
| 93 | Ga0075433_10002806 | 3300006852 | Bacteria | 13350 |
| 94 | Ga0075434_100000682 | 3300006871 | Bacteria | 26436 |
| 95 | Ga0075429_100062430 | 3300006880 | Bacteria | 3246 |
| 96 | Ga0075429_100134798 | 3300006880 | Bacteria | 2161 |
| 97 | Ga0075429_100139804 | 3300006880 | Bacteria | 2119 |
| 98 | Ga0075429_100146387 | 3300006880 | Bacteria | 2067 |
| 99 | Ga0075429_100898724 | 3300006880 | Bacteria | 775 |
| 100 | Ga0068865_100017815 | 3300006881 | Bacteria | 4574 |
| 101 | Ga0097620_100013721 | 3300006931 | Bacteria | 8124 |
| 102 | Ga0097620_100107052 | 3300006931 | Unclassified | 2856 |
| 103 | Ga0105250_10241620 | 3300009092 | Bacteria | 770 |
| 104 | Ga0105240_10003686 | 3300009093 | Bacteria | 23693 |
| 105 | Ga0105240_10064756 | 3300009093 | Bacteria | 4540 |
| 106 | Ga0105240_10121519 | 3300009093 | Bacteria | 3144 |
| 107 | Ga0105240_10242094 | 3300009093 | Bacteria | 2091 |
| 108 | Ga0105240_10256190 | 3300009093 | Bacteria | 2021 |
| 109 | Ga0105240_10308820 | 3300009093 | Bacteria | 1807 |
| 110 | Ga0111539_10006439 | 3300009094 | Bacteria | 15133 |
| 111 | Ga0111539_10009047 | 3300009094 | Bacteria | 12605 |
| 112 | Ga0111539_10023642 | 3300009094 | Bacteria | 7551 |
| 113 | Ga0105245_10736653 | 3300009098 | Bacteria | 1021 |
| 114 | Ga0105247_10378016 | 3300009101 | Bacteria | 1003 |
| 115 | Ga0114129_10062433 | 3300009147 | Bacteria | 5205 |
| 116 | Ga0114129_10092906 | 3300009147 | Bacteria | 4180 |
| 117 | Ga0114129_10450331 | 3300009147 | Bacteria | 1688 |
| 118 | Ga0105241_10323671 | 3300009174 | Bacteria | 1330 |
| 119 | Ga0105248_10007277 | 3300009177 | Bacteria | 12142 |
| 120 | Ga0105248_10021669 | 3300009177 | Bacteria | 7118 |
| 121 | Ga0105248_10124089 | 3300009177 | Bacteria | 2913 |
| 122 | Ga0105248_10611401 | 3300009177 | Bacteria | 1230 |
| 123 | Ga0105248_10651147 | 3300009177 | Bacteria | 1189 |
| 124 | Ga0105237_10173262 | 3300009545 | Bacteria | 2158 |
| 125 | Ga0105237_10850969 | 3300009545 | Bacteria | 919 |
| 126 | Ga0105238_10017608 | 3300009551 | Bacteria | 7263 |
| 127 | Ga0105238_10097266 | 3300009551 | Bacteria | 2929 |
| 128 | Ga0105238_10104420 | 3300009551 | Bacteria | 2814 |
| 129 | Ga0105238_10139157 | 3300009551 | Bacteria | 2405 |
| 130 | Ga0105238_10774850 | 3300009551 | Bacteria | 974 |
| 131 | Ga0105249_10104794 | 3300009553 | Bacteria | 2665 |
| 132 | Ga0105239_10229224 | 3300010375 | Bacteria | 2084 |
| 133 | Ga0157373_10003319 | 3300013100 | Bacteria | 12159 |
| 134 | Ga0157373_10013230 | 3300013100 | Bacteria | 6058 |
| 135 | Ga0157370_10245057 | 3300013104 | Bacteria | 1658 |
| 136 | Ga0157369_10296165 | 3300013105 | Bacteria | 1683 |
| 137 | Ga0157369_10443148 | 3300013105 | Bacteria | 1345 |
| 138 | Ga0163162_10449121 | 3300013306 | Bacteria | 1421 |
| 139 | Ga0163162_11031732 | 3300013306 | Unclassified | 930 |
| 140 | Ga0157375_10288392 | 3300013308 | Bacteria | 1804 |
| 141 | Ga0157375_10291033 | 3300013308 | Bacteria | 1796 |
| 142 | Ga0163163_10004247 | 3300014325 | Bacteria | 12211 |
| 143 | Ga0163163_11429630 | 3300014325 | Bacteria | 753 |
| 144 | Ga0157380_10189901 | 3300014326 | Bacteria | 1812 |
| 145 | Ga0157379_10017905 | 3300014968 | Bacteria | 6241 |
| 146 | Ga0157379_10261577 | 3300014968 | Bacteria | 1572 |
| 147 | Ga0182007_10191322 | 3300015262 | Bacteria | 712 |
| 148 | Ga0213872_10159098 | 3300021361 | Bacteria | 983 |
| 149 | Ga0213876_10158935 | 3300021384 | Bacteria | 1202 |
| 150 | Ga0213876_10212558 | 3300021384 | Bacteria | 1028 |
| 151 | Ga0209676_1000319 | 3300025292 | Bacteria | 93542 |
| 152 | Ga0209676_1000401 | 3300025292 | Bacteria | 78968 |
| 153 | Ga0209564_1002799 | 3300025295 | Bacteria | 12999 |
| 154 | Ga0209050_1000095 | 3300025298 | Bacteria | 242722 |
| 155 | Ga0209050_1000584 | 3300025298 | Bacteria | 59071 |
| 156 | Ga0209050_1001426 | 3300025298 | Bacteria | 25794 |
| 157 | Ga0209256_1005664 | 3300025299 | Bacteria | 7032 |
| 158 | Ga0209256_1024239 | 3300025299 | Bacteria | 1790 |
| 159 | Ga0209051_1001183 | 3300025303 | Bacteria | 23584 |
| 160 | Ga0209257_1000106 | 3300025304 | Bacteria | 242634 |
| 161 | Ga0209257_1001595 | 3300025304 | Bacteria | 25963 |
| 162 | Ga0209257_1005570 | 3300025304 | Bacteria | 8760 |
| 163 | Ga0207647_10022869 | 3300025904 | Bacteria | 4146 |
| 164 | Ga0207705_10008259 | 3300025909 | Bacteria | 7609 |
| 165 | Ga0207705_10184113 | 3300025909 | Bacteria | 1577 |
| 166 | Ga0207654_10059012 | 3300025911 | Bacteria | 2236 |
| 167 | Ga0207695_10001379 | 3300025913 | Bacteria | 41077 |
| 168 | Ga0207695_10002462 | 3300025913 | Bacteria | 27332 |
| 169 | Ga0207695_10004860 | 3300025913 | Bacteria | 18139 |
| 170 | Ga0207695_10056450 | 3300025913 | Bacteria | 4085 |
| 171 | Ga0207695_10116274 | 3300025913 | Bacteria | 2648 |
| 172 | Ga0207695_10254425 | 3300025913 | Bacteria | 1655 |
| 173 | Ga0207660_10016818 | 3300025917 | Bacteria | 4849 |
| 174 | Ga0207660_10051773 | 3300025917 | Bacteria | 2920 |
| 175 | Ga0207660_10148875 | 3300025917 | Bacteria | 1797 |
| 176 | Ga0207662_10391997 | 3300025918 | Bacteria | 940 |
| 177 | Ga0207657_10003963 | 3300025919 | Bacteria | 15722 |
| 178 | Ga0207657_10046357 | 3300025919 | Bacteria | 3808 |
| 179 | Ga0207657_10068026 | 3300025919 | Bacteria | 3027 |
| 180 | Ga0207657_10517770 | 3300025919 | Bacteria | 934 |
| 181 | Ga0207649_10554035 | 3300025920 | Bacteria | 880 |
| 182 | Ga0207652_10007396 | 3300025921 | Bacteria | 8855 |
| 183 | Ga0207681_10131239 | 3300025923 | Bacteria | 1853 |
| 184 | Ga0207694_10158317 | 3300025924 | Bacteria | 1828 |
| 185 | Ga0207694_10688938 | 3300025924 | Bacteria | 862 |
| 186 | Ga0207650_10116285 | 3300025925 | Bacteria | 2077 |
| 187 | Ga0207650_10259365 | 3300025925 | Bacteria | 1410 |
| 188 | Ga0207644_10217717 | 3300025931 | Bacteria | 1512 |
| 189 | Ga0207644_11229913 | 3300025931 | Bacteria | 629 |
| 190 | Ga0207690_10000721 | 3300025932 | Bacteria | 21295 |
| 191 | Ga0207690_10056777 | 3300025932 | Bacteria | 2642 |
| 192 | Ga0207706_10209343 | 3300025933 | Bacteria | 1709 |
| 193 | Ga0207686_10028536 | 3300025934 | Bacteria | 3282 |
| 194 | Ga0207704_10021207 | 3300025938 | Bacteria | 3455 |
| 195 | Ga0207711_10005253 | 3300025941 | Bacteria | 10980 |
| 196 | Ga0207711_10006201 | 3300025941 | Bacteria | 10103 |
| 197 | Ga0207711_10321228 | 3300025941 | Bacteria | 1431 |
| 198 | Ga0207679_10041597 | 3300025945 | Bacteria | 3297 |
| 199 | Ga0207679_10162650 | 3300025945 | Bacteria | 1829 |
| 200 | Ga0207667_10013404 | 3300025949 | Bacteria | 9379 |
| 201 | Ga0207667_10043017 | 3300025949 | Bacteria | 4796 |
| 202 | Ga0207667_10163729 | 3300025949 | Bacteria | 2287 |
| 203 | Ga0207667_10246038 | 3300025949 | Bacteria | 1830 |
| 204 | Ga0207667_10948200 | 3300025949 | Bacteria | 850 |
| 205 | Ga0207668_10001987 | 3300025972 | Bacteria | 11946 |
| 206 | Ga0207668_10002033 | 3300025972 | Bacteria | 11801 |
| 207 | Ga0207668_10187234 | 3300025972 | Bacteria | 1637 |
| 208 | Ga0207640_10293933 | 3300025981 | Bacteria | 1282 |
| 209 | Ga0207658_10171879 | 3300025986 | Bacteria | 1786 |
| 210 | Ga0207703_10000049 | 3300026035 | Bacteria | 149817 |
| 211 | Ga0207703_10030770 | 3300026035 | Bacteria | 4241 |
| 212 | Ga0207639_10061509 | 3300026041 | Bacteria | 2901 |
| 213 | Ga0207639_10486921 | 3300026041 | Bacteria | 1125 |
| 214 | Ga0207639_10529852 | 3300026041 | Bacteria | 1079 |
| 215 | Ga0207678_10000101 | 3300026067 | Bacteria | 70507 |
| 216 | Ga0207708_10266981 | 3300026075 | Bacteria | 1383 |
| 217 | Ga0207708_10433485 | 3300026075 | Bacteria | 1092 |
| 218 | Ga0207708_10697532 | 3300026075 | Bacteria | 867 |
| 219 | Ga0207702_10417110 | 3300026078 | Bacteria | 1297 |
| 220 | Ga0207702_10740224 | 3300026078 | Bacteria | 970 |
| 221 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 222 | Ga0207641_10114400 | 3300026088 | Bacteria | 2397 |
| 223 | Ga0207676_10000739 | 3300026095 | Bacteria | 25569 |
| 224 | Ga0207676_10019096 | 3300026095 | Bacteria | 4995 |
| 225 | Ga0207676_10136684 | 3300026095 | Bacteria | 2092 |
| 226 | Ga0207676_10269342 | 3300026095 | Bacteria | 1542 |
| 227 | Ga0207674_10186980 | 3300026116 | Bacteria | 2021 |
| 228 | Ga0207675_100031205 | 3300026118 | Bacteria | 4963 |
| 229 | Ga0207675_100148954 | 3300026118 | Bacteria | 2227 |
| 230 | Ga0207698_10232326 | 3300026142 | Bacteria | 1675 |
| 231 | Ga0207698_11119414 | 3300026142 | Bacteria | 800 |
| 232 | Ga0209981_1001429 | 3300027378 | Bacteria | 3016 |
| 233 | Ga0207428_10010757 | 3300027907 | Bacteria | 8160 |
| 234 | Ga0268266_10000621 | 3300028379 | Bacteria | 48218 |
| 235 | Ga0268266_10055286 | 3300028379 | Bacteria | 3412 |
| 236 | Ga0268265_10008744 | 3300028380 | Bacteria | 6844 |
| 237 | Ga0268265_10042312 | 3300028380 | Bacteria | 3379 |
| 238 | Ga0268265_10065151 | 3300028380 | Bacteria | 2810 |
| 239 | Ga0268265_10321637 | 3300028380 | Bacteria | 1401 |
| 240 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 241 | Ga0268264_10040882 | 3300028381 | Bacteria | 3832 |
| 242 | Ga0268264_10230984 | 3300028381 | Bacteria | 1708 |
| 243 | Ga0268264_10597222 | 3300028381 | Bacteria | 1087 |
| 244 | Ga0265337_1010051 | 3300028556 | Bacteria | 3337 |
| 245 | Ga0265319_1024073 | 3300028563 | Bacteria | 2197 |
| 246 | Ga0307517_10002263 | 3300028786 | Bacteria | 31025 |
| 247 | Ga0307517_10037458 | 3300028786 | Bacteria | 5415 |
| 248 | Ga0307515_10041864 | 3300028794 | Bacteria | 7187 |
| 249 | Ga0307515_10068754 | 3300028794 | Bacteria | 4858 |
| 250 | Ga0307511_10218015 | 3300030521 | Bacteria | 963 |
| 251 | Ga0265320_10164525 | 3300031240 | Bacteria | 998 |
| 252 | Ga0265331_10195860 | 3300031250 | Bacteria | 911 |
| 253 | Ga0265327_10001380 | 3300031251 | Bacteria | 31060 |
| 254 | Ga0265327_10002320 | 3300031251 | Bacteria | 20341 |
| 255 | Ga0265327_10065134 | 3300031251 | Bacteria | 1844 |
| 256 | Ga0307513_10000127 | 3300031456 | Bacteria | 107100 |
| 257 | Ga0307513_10005398 | 3300031456 | Bacteria | 16908 |
| 258 | Ga0307513_10006008 | 3300031456 | Bacteria | 15948 |
| 259 | Ga0307513_10022294 | 3300031456 | Bacteria | 7448 |
| 260 | Ga0307408_100769862 | 3300031548 | Bacteria | 871 |
| 261 | Ga0307508_10254968 | 3300031616 | Bacteria | 1350 |
| 262 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 263 | Ga0307406_10842294 | 3300031901 | Bacteria | 777 |
| 264 | Ga0307407_10355261 | 3300031903 | Bacteria | 1039 |
| 265 | Ga0307407_10923165 | 3300031903 | Bacteria | 671 |
| 266 | Ga0307412_10341554 | 3300031911 | Bacteria | 1199 |
| 267 | Ga0307412_10346371 | 3300031911 | Unclassified | 1191 |
| 268 | Ga0307411_10695977 | 3300032005 | Bacteria | 885 |
| 269 | Ga0307415_101103179 | 3300032126 | Bacteria | 743 |
| 270 | Ga0307510_10010349 | 3300033180 | Bacteria | 11077 |
| 271 | Ga0373938_0033450 | 3300034957 | Bacteria | 1112 |
| 272 | Ga0373928_0011830 | 3300035084 | Bacteria | 1734 |
| 273 | Ga0373928_0100594 | 3300035084 | Bacteria | 753 |
| 274 | Ga0373940_0032401 | 3300035088 | Bacteria | 1400 |
| 275 | Ga0373944_0017015 | 3300035089 | Bacteria | 2058 |
| 276 | Ga0373949_0014335 | 3300035090 | Bacteria | 1764 |
| 277 | Ga0373952_0004126 | 3300035092 | Bacteria | 2625 |
| 278 | Ga0373936_0010127 | 3300035113 | Bacteria | 3560 |
| 279 | Ga0373960_0038567 | 3300035121 | Bacteria | 1370 |
| 280 | Ga0373943_0332009 | 3300035170 | Bacteria | 868 |
| 281 | Ga0373962_0008661 | 3300035242 | Bacteria | 2508 |
| 282 | Ga0373962_0017799 | 3300035242 | Bacteria | 1844 |
| 283 | Ga0373931_0001236 | 3300035691 | Bacteria | 10921 |
| 284 | Ga0373935_0321375 | 3300035692 | Bacteria | 1098 |
| 285 | Ga0373927_0001687 | 3300035695 | Bacteria | 16504 |
| 286 | Ga0373927_0088035 | 3300035695 | Bacteria | 2016 |
| 287 | Ga0373925_0000089 | 3300037068 | Bacteria | 98449 |
| 288 | Ga0395905_0058274 | 3300037471 | Bacteria | 3612 |
| 289 | Ga0395905_0552312 | 3300037471 | Bacteria | 1053 |
| 290 | Ga0395901_0057916 | 3300038443 | Bacteria | 4030 |
| 291 | Ga0395901_0273604 | 3300038443 | Bacteria | 1756 |
| 292 | Ga0436365_0706118 | 3300039437 | Bacteria | 4548 |
| 293 | Ga0436365_1521295 | 3300039437 | Bacteria | 1202 |
| 294 | Ga0436361_1040436 | 3300039447 | Bacteria | 6464 |
| 295 | Ga0439446_0001768 | 3300042156 | Bacteria | 5035 |
| 296 | Ga0439435_0010130 | 3300042436 | Bacteria | 2229 |
| 297 | Ga0466966_0317403 | 3300044684 | Bacteria | 936 |
| 298 | Ga0466964_0169345 | 3300044706 | Bacteria | 1027 |
| 299 | Ga0466964_0200141 | 3300044706 | Bacteria | 958 |
| 300 | Ga0466960_0167240 | 3300044901 | Bacteria | 1185 |
| 301 | Ga0466959_0056213 | 3300045049 | Bacteria | 2872 |
| 302 | Ga0495627_000513 | 3300046453 | Bacteria | 32122 |
| 303 | Ga0495590_0000309 | 3300046457 | Bacteria | 25577 |
| 304 | Ga0495638_0000782 | 3300046460 | Bacteria | 33588 |
| 305 | Ga0495638_0002789 | 3300046460 | Bacteria | 14025 |
| 306 | Ga0495638_0006168 | 3300046460 | Bacteria | 8755 |
| 307 | Ga0495638_0028472 | 3300046460 | Bacteria | 3607 |
| 308 | Ga0495650_0113576 | 3300046471 | Bacteria | 1003 |
| 309 | Ga0495585_0209027 | 3300046492 | Bacteria | 990 |
| 310 | Ga0495583_0026122 | 3300046506 | Bacteria | 2902 |
| 311 | Ga0495606_0102859 | 3300046507 | Bacteria | 1736 |
| 312 | Ga0495610_0001981 | 3300046512 | Bacteria | 17476 |
| 313 | Ga0495610_0002726 | 3300046512 | Bacteria | 14517 |
| 314 | Ga0495616_0001022 | 3300046513 | Bacteria | 20016 |
| 315 | Ga0495628_0084804 | 3300046516 | Bacteria | 2458 |
| 316 | Ga0495631_0001982 | 3300046518 | Bacteria | 11977 |
| 317 | Ga0495637_0071977 | 3300046520 | Bacteria | 1393 |
| 318 | Ga0495643_0150994 | 3300046522 | Bacteria | 1150 |
| 319 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 320 | Ga0495642_0006363 | 3300046528 | Bacteria | 4525 |
| 321 | Ga0495642_0041196 | 3300046528 | Bacteria | 1878 |
| 322 | Ga0495652_0506838 | 3300046529 | Bacteria | 836 |
| 323 | Ga0495587_0340430 | 3300046536 | Bacteria | 837 |
| 324 | Ga0495609_0028061 | 3300046538 | Bacteria | 2570 |
| 325 | Ga0495621_0183181 | 3300046539 | Bacteria | 837 |
| 326 | Ga0495621_0208636 | 3300046539 | Bacteria | 788 |
| 327 | Ga0495597_0001061 | 3300046542 | Bacteria | 20987 |
| 328 | Ga0495668_0000221 | 3300046616 | Bacteria | 82680 |
| 329 | Ga0495668_0008696 | 3300046616 | Bacteria | 6307 |
| 330 | Ga0495668_0058663 | 3300046616 | Bacteria | 2124 |
| 331 | Ga0495668_0064493 | 3300046616 | Bacteria | 2016 |
| 332 | Ga0495668_0124997 | 3300046616 | Bacteria | 1408 |
| 333 | Ga0495668_0282440 | 3300046616 | Bacteria | 909 |
| 334 | Ga0495668_0489660 | 3300046616 | Bacteria | 677 |
| 335 | Ga0495668_0505391 | 3300046616 | Bacteria | 666 |
| 336 | Ga0495611_0022340 | 3300046648 | Bacteria | 2737 |
| 337 | Ga0495625_0000034 | 3300046660 | Bacteria | 225120 |
| 338 | Ga0495625_0087248 | 3300046660 | Bacteria | 2163 |
| 339 | Ga0495625_0142100 | 3300046660 | Bacteria | 1618 |
| 340 | Ga0495625_0253950 | 3300046660 | Bacteria | 1140 |
| 341 | Ga0495659_0039063 | 3300046664 | Bacteria | 1687 |
| 342 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 343 | Ga0495669_0000317 | 3300046684 | Bacteria | 26674 |
| 344 | Ga0495669_0002819 | 3300046684 | Bacteria | 7129 |
| 345 | Ga0495669_0112053 | 3300046684 | Bacteria | 1274 |
| 346 | Ga0495613_0001433 | 3300046689 | Bacteria | 18206 |
| 347 | Ga0495589_0185232 | 3300046794 | Bacteria | 986 |
| 348 | Ga0495660_0011161 | 3300046810 | Bacteria | 5217 |
| 349 | Ga0495674_0184948 | 3300047319 | Bacteria | 1734 |
| 350 | Ga0495672_0000778 | 3300047320 | Bacteria | 34618 |
| 351 | Ga0495687_104978 | 3300047443 | Bacteria | 1051 |
| 352 | Ga0495677_0006171 | 3300047445 | Bacteria | 4528 |
| 353 | Ga0495677_0012380 | 3300047445 | Bacteria | 3112 |
| 354 | Ga0495677_0012403 | 3300047445 | Bacteria | 3109 |
| 355 | Ga0495679_003359 | 3300047446 | Bacteria | 7727 |
| 356 | Ga0495673_0000223 | 3300047469 | Bacteria | 84150 |
| 357 | Ga0495673_0001949 | 3300047469 | Bacteria | 15315 |
| 358 | Ga0495673_0194278 | 3300047469 | Bacteria | 762 |
| 359 | Ga0495686_0001197 | 3300047472 | Bacteria | 29986 |
| 360 | Ga0495686_0031613 | 3300047472 | Bacteria | 3431 |
| 361 | Ga0496100_0510224 | 3300048903 | Bacteria | 927 |
| 362 | Ga0496101_0430426 | 3300048904 | Bacteria | 1040 |
| 363 | Ga0496102_0044272 | 3300048905 | Bacteria | 4039 |
| 364 | Ga0496102_0138713 | 3300048905 | Bacteria | 2279 |
| 365 | Ga0496102_0228999 | 3300048905 | Bacteria | 1752 |
| 366 | Ga0496103_0160935 | 3300048906 | Bacteria | 1440 |
| 367 | Ga0496106_0357863 | 3300048909 | Bacteria | 1172 |
| 368 | Ga0496107_0000029 | 3300048910 | Bacteria | 102345 |
| 369 | Ga0496109_0036566 | 3300048912 | Bacteria | 4433 |
| 370 | Ga0496109_0146299 | 3300048912 | Bacteria | 2211 |
| 371 | Ga0496110_0007268 | 3300048913 | Bacteria | 8829 |
| 372 | Ga0496110_0397169 | 3300048913 | Bacteria | 1257 |
| 373 | Ga0496111_0030793 | 3300048914 | Bacteria | 3817 |
| 374 | Ga0496111_0246494 | 3300048914 | Bacteria | 1326 |
| 375 | Ga0496112_0017333 | 3300048915 | Bacteria | 6765 |
| 376 | Ga0496112_0061990 | 3300048915 | Bacteria | 3688 |
| 377 | Ga0496112_0248011 | 3300048915 | Bacteria | 1732 |
| 378 | Ga0496112_0558968 | 3300048915 | Bacteria | 1078 |
| 379 | Ga0496112_1188071 | 3300048915 | Bacteria | 680 |
| 380 | Ga0496113_0729097 | 3300048916 | Bacteria | 790 |
| 381 | Ga0496115_0000771 | 3300048918 | Bacteria | 23514 |
| 382 | Ga0496115_0007037 | 3300048918 | Bacteria | 8265 |
| 383 | Ga0496115_0027262 | 3300048918 | Bacteria | 4467 |
| 384 | Ga0496115_0751946 | 3300048918 | Bacteria | 762 |
| 385 | Ga0496116_0134897 | 3300048919 | Bacteria | 1400 |
| 386 | Ga0496117_0007978 | 3300048920 | Bacteria | 10167 |
| 387 | Ga0496118_0010336 | 3300048921 | Bacteria | 9251 |
| 388 | Ga0496121_0000397 | 3300048924 | Bacteria | 87422 |
| 389 | Ga0496121_0006516 | 3300048924 | Bacteria | 14437 |
| 390 | Ga0496121_0065129 | 3300048924 | Bacteria | 2967 |
| 391 | Ga0496121_0226863 | 3300048924 | Bacteria | 1311 |
| 392 | Ga0496125_0212402 | 3300048928 | Bacteria | 1255 |
| 393 | Ga0496126_0289480 | 3300048929 | Bacteria | 1355 |
| 394 | Ga0496126_0414284 | 3300048929 | Bacteria | 1090 |
| 395 | Ga0496126_0888096 | 3300048929 | Bacteria | 677 |
| 396 | Ga0495678_000773 | 3300049459 | Bacteria | 28865 |
| 397 | Ga0495682_0071270 | 3300049460 | Bacteria | 1251 |
| 398 | Ga0501033_0599339 | 3300049570 | Bacteria | 756 |
| 399 | Ga0501034_0075750 | 3300049571 | Bacteria | 3371 |
| 400 | Ga0501038_0528512 | 3300049574 | Bacteria | 899 |
| 401 | Ga0501039_0109899 | 3300049575 | Bacteria | 2155 |
| 402 | Ga0501039_0259693 | 3300049575 | Bacteria | 1365 |
| 403 | Ga0501039_0276945 | 3300049575 | Bacteria | 1319 |
| 404 | Ga0501040_0234622 | 3300049576 | Bacteria | 1307 |
| 405 | Ga0501041_0138876 | 3300049577 | Bacteria | 1515 |
| 406 | Ga0501046_0039248 | 3300049580 | Bacteria | 3793 |
| 407 | Ga0501046_0265837 | 3300049580 | Bacteria | 1259 |
| 408 | Ga0501047_0001352 | 3300049581 | Bacteria | 24079 |
| 409 | Ga0501047_0001827 | 3300049581 | Bacteria | 20573 |
| 410 | Ga0501047_0091648 | 3300049581 | Bacteria | 2918 |
| 411 | Ga0501047_0313823 | 3300049581 | Bacteria | 1408 |
| 412 | Ga0501048_0090698 | 3300049582 | Bacteria | 2156 |
| 413 | Ga0501068_0467188 | 3300049584 | Bacteria | 817 |
| 414 | Ga0501068_0468115 | 3300049584 | Bacteria | 816 |
| 415 | Ga0501070_0080286 | 3300049586 | Bacteria | 2699 |
| 416 | Ga0501071_0349566 | 3300049587 | Bacteria | 1125 |
| 417 | Ga0501072_0048835 | 3300049588 | Bacteria | 3331 |
| 418 | Ga0501072_0095088 | 3300049588 | Bacteria | 2368 |
| 419 | Ga0501072_0199399 | 3300049588 | Bacteria | 1596 |
| 420 | Ga0501072_0398834 | 3300049588 | Bacteria | 1091 |
| 421 | Ga0501073_0059724 | 3300049589 | Bacteria | 2662 |
| 422 | Ga0501073_0349407 | 3300049589 | Bacteria | 1021 |
| 423 | Ga0501073_0510956 | 3300049589 | Bacteria | 831 |
| 424 | Ga0501076_0089577 | 3300049592 | Bacteria | 2473 |
| 425 | Ga0501076_0657026 | 3300049592 | Bacteria | 865 |
| 426 | Ga0501076_0851396 | 3300049592 | Bacteria | 752 |
| 427 | Ga0501079_0899469 | 3300049741 | Bacteria | 697 |
| 428 | Ga0501080_0006464 | 3300049742 | Bacteria | 10525 |
| 429 | Ga0501080_0010727 | 3300049742 | Bacteria | 8381 |
| 430 | Ga0501081_0018566 | 3300049743 | Bacteria | 4621 |
| 431 | Ga0501081_0181751 | 3300049743 | Bacteria | 1521 |
| 432 | Ga0501081_0365756 | 3300049743 | Bacteria | 1064 |
| 433 | Ga0501081_0911524 | 3300049743 | Bacteria | 663 |
| 434 | Ga0501083_0002798 | 3300049744 | Bacteria | 12050 |
| 435 | Ga0501083_0102287 | 3300049744 | Bacteria | 1889 |
| 436 | Ga0501035_0614645 | 3300049822 | Bacteria | 884 |
| 437 | Ga0501035_0665376 | 3300049822 | Bacteria | 843 |
| 438 | Ga0501044_0326402 | 3300049823 | Unclassified | 1458 |
| 439 | Ga0501045_0095419 | 3300049824 | Bacteria | 2200 |
| 440 | nmdc:mga07m45_134555_c1 | 3300050496 | Bacteria | 1430 |
| 441 | nmdc:mga05p37_74423_c1 | 3300050507 | Bacteria | 4180 |
| 442 | nmdc:mga05p37_929376_c1 | 3300050507 | Bacteria | 934 |
| 443 | nmdc:mga09592_132006_c1 | 3300050508 | Bacteria | 2149 |
| 444 | nmdc:mga09592_6522_c2 | 3300050508 | Bacteria | 7610 |
| 445 | nmdc:mga09592_716428_c1 | 3300050508 | Bacteria | 851 |
| 446 | nmdc:mga0qj67_416040_c1 | 3300050509 | Bacteria | 1084 |
| 447 | nmdc:mga06r32_120185_c1 | 3300050510 | Bacteria | 2591 |
| 448 | nmdc:mga06r32_36778_c1 | 3300050510 | Bacteria | 4629 |
| 449 | nmdc:mga06r32_579677_c1 | 3300050510 | Bacteria | 1094 |
| 450 | nmdc:mga06r32_82932_c1 | 3300050510 | Bacteria | 3124 |
| 451 | nmdc:mga08y16_112215_c1 | 3300050511 | Bacteria | 2838 |
| 452 | nmdc:mga08y16_144719_c1 | 3300050511 | Bacteria | 2471 |
| 453 | nmdc:mga0n895_3101_c1 | 3300050512 | Bacteria | 13235 |
| 454 | nmdc:mga0a205_3468_c1 | 3300050515 | Bacteria | 14083 |
| 455 | Ga0500578_0001117 | 3300053086 | Bacteria | 28820 |
| 456 | Ga0500578_0464524 | 3300053086 | Bacteria | 718 |
| 457 | Ga0500643_003852 | 3300053087 | Bacteria | 6984 |
| 458 | Ga0500643_020813 | 3300053087 | Bacteria | 2136 |
| 459 | Ga0500644_0000822 | 3300053088 | Bacteria | 10480 |
| 460 | Ga0500644_0048316 | 3300053088 | Bacteria | 1447 |
| 461 | Ga0500647_0076122 | 3300053091 | Bacteria | 1610 |
| 462 | Ga0500651_0380679 | 3300053093 | Bacteria | 796 |
| 463 | Ga0500554_104451 | 3300053102 | Bacteria | 949 |
| 464 | Ga0500572_000561 | 3300053111 | Bacteria | 12671 |
| 465 | Ga0500594_0000093 | 3300053118 | Bacteria | 27296 |
| 466 | Ga0500595_057501 | 3300053119 | Bacteria | 1185 |
| 467 | Ga0500608_000188 | 3300053122 | Bacteria | 24796 |
| 468 | Ga0500608_002326 | 3300053122 | Bacteria | 6896 |
| 469 | Ga0500608_117025 | 3300053122 | Bacteria | 1214 |
| 470 | Ga0500614_021634 | 3300053123 | Bacteria | 1494 |
| 471 | Ga0500618_000152 | 3300053125 | Bacteria | 57055 |
| 472 | Ga0500642_0088580 | 3300053130 | Bacteria | 1429 |
| 473 | Ga0500652_034298 | 3300053131 | Bacteria | 2010 |
| 474 | Ga0500655_068862 | 3300053133 | Bacteria | 720 |
| 475 | Ga0500559_0000054 | 3300053136 | Bacteria | 90695 |
| 476 | Ga0500559_0002200 | 3300053136 | Bacteria | 10307 |
| 477 | Ga0500559_0004821 | 3300053136 | Bacteria | 6301 |
| 478 | Ga0500564_000094 | 3300053138 | Bacteria | 22644 |
| 479 | Ga0500590_054907 | 3300053148 | Bacteria | 2016 |
| 480 | Ga0500622_0001162 | 3300053156 | Bacteria | 21873 |
| 481 | Ga0501084_0010424 | 3300054114 | Bacteria | 7684 |
| 482 | Ga0501084_0057061 | 3300054114 | Bacteria | 3268 |
| 483 | Ga0501084_0432981 | 3300054114 | Bacteria | 1112 |
| 484 | Ga0501082_0003782 | 3300060353 | Bacteria | 13228 |
| 485 | Ga0501082_0009285 | 3300060353 | Bacteria | 8477 |
| 486 | Ga0501082_0077766 | 3300060353 | Bacteria | 2861 |
| 487 | Ga0501082_0245384 | 3300060353 | Bacteria | 1559 |
| 488 | Ga0501082_0245403 | 3300060353 | Bacteria | 1558 |
| 489 | Ga0501082_0415192 | 3300060353 | Bacteria | 1175 |
| 490 | Ga0530510_0048406 | 3300061734 | Bacteria | 3073 |
| 491 | Ga0530510_0215322 | 3300061734 | Bacteria | 1427 |
| 492 | Ga0530510_0245248 | 3300061734 | Bacteria | 1334 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100012456 | Ga0068862_1000124562 | 172 |
| 2 | 3300006880 | Ga0075429_100134798 | Ga0075429_1001347983 | 172 |
| 3 | 3300028380 | Ga0268265_10065151 | Ga0268265_100651513 | 172 |
| 4 | 3300050508 | nmdc:mga09592_132006_c1 | nmdc:mga09592_132006_c1_1519_2073 | 172 |
| 5 | 3300039447 | Ga0436361_1040436 | Ga0436361_1040436_4715_5245 | 173 |
| 6 | 3300046538 | Ga0495609_0028061 | Ga0495609_0028061_643_1179 | 174 |
| 7 | 3300049581 | Ga0501047_0313823 | Ga0501047_0313823_795_1325 | 174 |
| 8 | 3300006038 | Ga0075365_10379122 | Ga0075365_103791222 | 179 |
| 9 | 3300010375 | Ga0105239_10229224 | Ga0105239_102292242 | 180 |
| 10 | iso_pu_bacteria | 2510917020 | 2511121917 | 181 |
| 11 | iso_pu_bacteria | 2582581279 | 2585148282 | 181 |
| 12 | iso_pu_bacteria | 2582581280 | 2585150970 | 181 |
| 13 | iso_pu_bacteria | 2582581293 | 2585196369 | 181 |
| 14 | iso_pu_bacteria | 2585428106 | 2587919184 | 181 |
| 15 | iso_pu_bacteria | 2643221583 | 2643926982 | 181 |
| 16 | iso_pu_bacteria | 2643221598 | 2643998829 | 181 |
| 17 | iso_pu_bacteria | 2643221614 | 2644087142 | 181 |
| 18 | iso_pu_bacteria | 2643221640 | 2644227409 | 181 |
| 19 | iso_pu_bacteria | 2643221642 | 2644237072 | 181 |
| 20 | iso_pu_bacteria | 2643221661 | 2644342096 | 181 |
| 21 | iso_pu_bacteria | 2643221666 | 2644368383 | 181 |
| 22 | iso_pu_bacteria | 2791355048 | 2792461282 | 181 |
| 23 | iso_pu_bacteria | 2843744320 | 2843745352 | 181 |
| 24 | iso_pu_bacteria | 2849560528 | 2849564632 | 181 |
| 25 | iso_pu_bacteria | 2849573788 | 2849577738 | 181 |
| 26 | iso_pu_bacteria | 2851153111 | 2851155635 | 181 |
| 27 | iso_pu_bacteria | 2857504554 | 2857508426 | 181 |
| 28 | iso_pu_bacteria | 2884960567 | 2884961228 | 181 |
| 29 | iso_pu_bacteria | 2898329390 | 2898331105 | 181 |
| 30 | iso_pu_bacteria | 2928531327 | 2928534551 | 181 |
| 31 | 3300005844 | Ga0068862_100496876 | Ga0068862_1004968761 | 184 |
| 32 | 3300005937 | Ga0081455_10093505 | Ga0081455_100935054 | 184 |
| 33 | 3300006846 | Ga0075430_100462244 | Ga0075430_1004622442 | 184 |
| 34 | 3300009553 | Ga0105249_10104794 | Ga0105249_101047943 | 184 |
| 35 | 3300031901 | Ga0307406_10842294 | Ga0307406_108422941 | 184 |
| 36 | 3300031903 | Ga0307407_10923165 | Ga0307407_109231652 | 184 |
| 37 | 3300035084 | Ga0373928_0100594 | Ga0373928_0100594_73_633 | 184 |
| 38 | 3300035242 | Ga0373962_0017799 | Ga0373962_0017799_509_1069 | 184 |
| 39 | 3300047469 | Ga0495673_0194278 | Ga0495673_0194278_20_580 | 184 |
| 40 | 3300049581 | Ga0501047_0001352 | Ga0501047_0001352_6449_7054 | 184 |
| 41 | 3300049589 | Ga0501073_0059724 | Ga0501073_0059724_785_1510 | 184 |
| 42 | 3300049742 | Ga0501080_0006464 | Ga0501080_0006464_4443_5003 | 184 |
| 43 | 3300049744 | Ga0501083_0002798 | Ga0501083_0002798_11115_11675 | 184 |
| 44 | 3300050509 | nmdc:mga0qj67_416040_c1 | nmdc:mga0qj67_416040_c1_354_914 | 184 |
| 45 | 3300060353 | Ga0501082_0003782 | Ga0501082_0003782_2231_2791 | 184 |
| 46 | 3300003781 | Ga0055536_1001003 | Ga0055536_100100313 | 185 |
| 47 | 3300003791 | Ga0055530_10000337 | Ga0055530_1000033738 | 185 |
| 48 | 3300003791 | Ga0055530_10001846 | Ga0055530_100018465 | 185 |
| 49 | 3300003791 | Ga0055530_10003612 | Ga0055530_100036127 | 185 |
| 50 | 3300003794 | Ga0055531_10000820 | Ga0055531_1000082013 | 185 |
| 51 | 3300003794 | Ga0055531_10001142 | Ga0055531_1000114213 | 185 |
| 52 | 3300004625 | Ga0055543_1024023 | Ga0055543_10240232 | 185 |
| 53 | 3300005262 | Ga0065165_1000171 | Ga0065165_100017118 | 185 |
| 54 | 3300005327 | Ga0070658_10214714 | Ga0070658_102147143 | 185 |
| 55 | 3300005327 | Ga0070658_10378802 | Ga0070658_103788022 | 185 |
| 56 | 3300005331 | Ga0070670_100145858 | Ga0070670_1001458583 | 185 |
| 57 | 3300005331 | Ga0070670_100155670 | Ga0070670_1001556702 | 185 |
| 58 | 3300005331 | Ga0070670_100293181 | Ga0070670_1002931812 | 185 |
| 59 | 3300005335 | Ga0070666_10194976 | Ga0070666_101949762 | 185 |
| 60 | 3300005336 | Ga0070680_100018418 | Ga0070680_1000184188 | 185 |
| 61 | 3300005336 | Ga0070680_100037522 | Ga0070680_1000375222 | 185 |
| 62 | 3300005337 | Ga0070682_100385777 | Ga0070682_1003857772 | 185 |
| 63 | 3300005339 | Ga0070660_100074290 | Ga0070660_1000742902 | 185 |
| 64 | 3300005341 | Ga0070691_10012514 | Ga0070691_100125143 | 185 |
| 65 | 3300005343 | Ga0070687_100263958 | Ga0070687_1002639582 | 185 |
| 66 | 3300005344 | Ga0070661_100100169 | Ga0070661_1001001692 | 185 |
| 67 | 3300005347 | Ga0070668_100025547 | Ga0070668_1000255475 | 185 |
| 68 | 3300005347 | Ga0070668_100063153 | Ga0070668_1000631533 | 185 |
| 69 | 3300005355 | Ga0070671_100014187 | Ga0070671_1000141879 | 185 |
| 70 | 3300005355 | Ga0070671_100367153 | Ga0070671_1003671532 | 185 |
| 71 | 3300005355 | Ga0070671_101357076 | Ga0070671_1013570761 | 185 |
| 72 | 3300005366 | Ga0070659_100000572 | Ga0070659_10000057216 | 185 |
| 73 | 3300005366 | Ga0070659_100012877 | Ga0070659_1000128773 | 185 |
| 74 | 3300005367 | Ga0070667_100010707 | Ga0070667_1000107075 | 185 |
| 75 | 3300005440 | Ga0070705_100536724 | Ga0070705_1005367241 | 185 |
| 76 | 3300005456 | Ga0070678_100029073 | Ga0070678_1000290731 | 185 |
| 77 | 3300005457 | Ga0070662_100174784 | Ga0070662_1001747842 | 185 |
| 78 | 3300005539 | Ga0068853_100092445 | Ga0068853_1000924452 | 185 |
| 79 | 3300005539 | Ga0068853_100595447 | Ga0068853_1005954472 | 185 |
| 80 | 3300005543 | Ga0070672_100585561 | Ga0070672_1005855612 | 185 |
| 81 | 3300005548 | Ga0070665_100000622 | Ga0070665_10000062231 | 185 |
| 82 | 3300005548 | Ga0070665_100075069 | Ga0070665_1000750693 | 185 |
| 83 | 3300005563 | Ga0068855_100055347 | Ga0068855_1000553473 | 185 |
| 84 | 3300005563 | Ga0068855_100209297 | Ga0068855_1002092973 | 185 |
| 85 | 3300005563 | Ga0068855_100243925 | Ga0068855_1002439253 | 185 |
| 86 | 3300005564 | Ga0070664_100214143 | Ga0070664_1002141432 | 185 |
| 87 | 3300005578 | Ga0068854_100326935 | Ga0068854_1003269352 | 185 |
| 88 | 3300005614 | Ga0068856_100494539 | Ga0068856_1004945392 | 185 |
| 89 | 3300005616 | Ga0068852_101100624 | Ga0068852_1011006242 | 185 |
| 90 | 3300005617 | Ga0068859_100013721 | Ga0068859_1000137216 | 185 |
| 91 | 3300005618 | Ga0068864_100008710 | Ga0068864_1000087109 | 185 |
| 92 | 3300005618 | Ga0068864_100075368 | Ga0068864_1000753682 | 185 |
| 93 | 3300005618 | Ga0068864_100529412 | Ga0068864_1005294122 | 185 |
| 94 | 3300005719 | Ga0068861_100051839 | Ga0068861_1000518394 | 185 |
| 95 | 3300005719 | Ga0068861_100257978 | Ga0068861_1002579782 | 185 |
| 96 | 3300005841 | Ga0068863_100000045 | Ga0068863_1000000458 | 185 |
| 97 | 3300005841 | Ga0068863_100026291 | Ga0068863_1000262913 | 185 |
| 98 | 3300005841 | Ga0068863_100049914 | Ga0068863_1000499145 | 185 |
| 99 | 3300005842 | Ga0068858_100109610 | Ga0068858_1001096102 | 185 |
| 100 | 3300005843 | Ga0068860_100028753 | Ga0068860_1000287533 | 185 |
| 101 | 3300005843 | Ga0068860_100177028 | Ga0068860_1001770282 | 185 |
| 102 | 3300005843 | Ga0068860_100244402 | Ga0068860_1002444022 | 185 |
| 103 | 3300005844 | Ga0068862_100008821 | Ga0068862_1000088213 | 185 |
| 104 | 3300005844 | Ga0068862_100030139 | Ga0068862_1000301394 | 185 |
| 105 | 3300005937 | Ga0081455_10000022 | Ga0081455_10000022134 | 185 |
| 106 | 3300006028 | Ga0070717_10168089 | Ga0070717_101680892 | 185 |
| 107 | 3300006028 | Ga0070717_10529217 | Ga0070717_105292172 | 185 |
| 108 | 3300006058 | Ga0075432_10046497 | Ga0075432_100464972 | 185 |
| 109 | 3300006186 | Ga0075369_10003307 | Ga0075369_100033074 | 185 |
| 110 | 3300006353 | Ga0075370_10049315 | Ga0075370_100493152 | 185 |
| 111 | 3300006844 | Ga0075428_100075472 | Ga0075428_1000754726 | 185 |
| 112 | 3300006844 | Ga0075428_100466011 | Ga0075428_1004660112 | 185 |
| 113 | 3300006847 | Ga0075431_100006746 | Ga0075431_1000067468 | 185 |
| 114 | 3300006847 | Ga0075431_100021213 | Ga0075431_1000212132 | 185 |
| 115 | 3300006847 | Ga0075431_100056098 | Ga0075431_1000560983 | 185 |
| 116 | 3300006847 | Ga0075431_100730527 | Ga0075431_1007305272 | 185 |
| 117 | 3300006847 | Ga0075431_100781980 | Ga0075431_1007819801 | 185 |
| 118 | 3300006852 | Ga0075433_10002806 | Ga0075433_1000280614 | 185 |
| 119 | 3300006871 | Ga0075434_100000682 | Ga0075434_1000006829 | 185 |
| 120 | 3300006880 | Ga0075429_100062430 | Ga0075429_1000624302 | 185 |
| 121 | 3300006880 | Ga0075429_100139804 | Ga0075429_1001398044 | 185 |
| 122 | 3300006880 | Ga0075429_100146387 | Ga0075429_1001463872 | 185 |
| 123 | 3300006880 | Ga0075429_100898724 | Ga0075429_1008987241 | 185 |
| 124 | 3300006881 | Ga0068865_100017815 | Ga0068865_1000178154 | 185 |
| 125 | 3300006931 | Ga0097620_100013721 | Ga0097620_1000137216 | 185 |
| 126 | 3300006931 | Ga0097620_100107052 | Ga0097620_1001070522 | 185 |
| 127 | 3300009092 | Ga0105250_10241620 | Ga0105250_102416202 | 185 |
| 128 | 3300009093 | Ga0105240_10003686 | Ga0105240_1000368620 | 185 |
| 129 | 3300009093 | Ga0105240_10064756 | Ga0105240_100647565 | 185 |
| 130 | 3300009093 | Ga0105240_10121519 | Ga0105240_101215192 | 185 |
| 131 | 3300009093 | Ga0105240_10242094 | Ga0105240_102420942 | 185 |
| 132 | 3300009093 | Ga0105240_10256190 | Ga0105240_102561902 | 185 |
| 133 | 3300009093 | Ga0105240_10308820 | Ga0105240_103088202 | 185 |
| 134 | 3300009094 | Ga0111539_10006439 | Ga0111539_100064391 | 185 |
| 135 | 3300009094 | Ga0111539_10009047 | Ga0111539_1000904715 | 185 |
| 136 | 3300009094 | Ga0111539_10023642 | Ga0111539_100236423 | 185 |
| 137 | 3300009098 | Ga0105245_10736653 | Ga0105245_107366532 | 185 |
| 138 | 3300009101 | Ga0105247_10378016 | Ga0105247_103780161 | 185 |
| 139 | 3300009147 | Ga0114129_10062433 | Ga0114129_100624333 | 185 |
| 140 | 3300009147 | Ga0114129_10092906 | Ga0114129_100929062 | 185 |
| 141 | 3300009147 | Ga0114129_10450331 | Ga0114129_104503312 | 185 |
| 142 | 3300009174 | Ga0105241_10323671 | Ga0105241_103236712 | 185 |
| 143 | 3300009177 | Ga0105248_10007277 | Ga0105248_100072777 | 185 |
| 144 | 3300009177 | Ga0105248_10021669 | Ga0105248_100216694 | 185 |
| 145 | 3300009177 | Ga0105248_10124089 | Ga0105248_101240893 | 185 |
| 146 | 3300009177 | Ga0105248_10611401 | Ga0105248_106114012 | 185 |
| 147 | 3300009177 | Ga0105248_10651147 | Ga0105248_106511471 | 185 |
| 148 | 3300009545 | Ga0105237_10850969 | Ga0105237_108509692 | 185 |
| 149 | 3300009551 | Ga0105238_10017608 | Ga0105238_100176087 | 185 |
| 150 | 3300009551 | Ga0105238_10097266 | Ga0105238_100972662 | 185 |
| 151 | 3300009551 | Ga0105238_10104420 | Ga0105238_101044203 | 185 |
| 152 | 3300009551 | Ga0105238_10774850 | Ga0105238_107748502 | 185 |
| 153 | 3300013100 | Ga0157373_10003319 | Ga0157373_100033195 | 185 |
| 154 | 3300013100 | Ga0157373_10013230 | Ga0157373_100132303 | 185 |
| 155 | 3300013104 | Ga0157370_10245057 | Ga0157370_102450572 | 185 |
| 156 | 3300013105 | Ga0157369_10443148 | Ga0157369_104431482 | 185 |
| 157 | 3300013306 | Ga0163162_10449121 | Ga0163162_104491212 | 185 |
| 158 | 3300013306 | Ga0163162_11031732 | Ga0163162_110317322 | 185 |
| 159 | 3300013308 | Ga0157375_10288392 | Ga0157375_102883922 | 185 |
| 160 | 3300013308 | Ga0157375_10291033 | Ga0157375_102910332 | 185 |
| 161 | 3300014325 | Ga0163163_10004247 | Ga0163163_1000424710 | 185 |
| 162 | 3300014325 | Ga0163163_11429630 | Ga0163163_114296302 | 185 |
| 163 | 3300014968 | Ga0157379_10261577 | Ga0157379_102615772 | 185 |
| 164 | 3300015262 | Ga0182007_10191322 | Ga0182007_101913221 | 185 |
| 165 | 3300021361 | Ga0213872_10159098 | Ga0213872_101590982 | 185 |
| 166 | 3300021384 | Ga0213876_10158935 | Ga0213876_101589352 | 185 |
| 167 | 3300021384 | Ga0213876_10212558 | Ga0213876_102125581 | 185 |
| 168 | 3300025292 | Ga0209676_1000319 | Ga0209676_100031923 | 185 |
| 169 | 3300025292 | Ga0209676_1000401 | Ga0209676_100040160 | 185 |
| 170 | 3300025295 | Ga0209564_1002799 | Ga0209564_100279911 | 185 |
| 171 | 3300025298 | Ga0209050_1000095 | Ga0209050_1000095224 | 185 |
| 172 | 3300025298 | Ga0209050_1000584 | Ga0209050_100058414 | 185 |
| 173 | 3300025298 | Ga0209050_1001426 | Ga0209050_100142617 | 185 |
| 174 | 3300025299 | Ga0209256_1005664 | Ga0209256_10056642 | 185 |
| 175 | 3300025299 | Ga0209256_1024239 | Ga0209256_10242392 | 185 |
| 176 | 3300025303 | Ga0209051_1001183 | Ga0209051_100118316 | 185 |
| 177 | 3300025304 | Ga0209257_1000106 | Ga0209257_100010629 | 185 |
| 178 | 3300025304 | Ga0209257_1001595 | Ga0209257_100159513 | 185 |
| 179 | 3300025304 | Ga0209257_1005570 | Ga0209257_10055704 | 185 |
| 180 | 3300025909 | Ga0207705_10008259 | Ga0207705_100082595 | 185 |
| 181 | 3300025909 | Ga0207705_10184113 | Ga0207705_101841133 | 185 |
| 182 | 3300025913 | Ga0207695_10001379 | Ga0207695_100013792 | 185 |
| 183 | 3300025913 | Ga0207695_10002462 | Ga0207695_1000246217 | 185 |
| 184 | 3300025913 | Ga0207695_10004860 | Ga0207695_100048603 | 185 |
| 185 | 3300025913 | Ga0207695_10056450 | Ga0207695_100564503 | 185 |
| 186 | 3300025913 | Ga0207695_10116274 | Ga0207695_101162742 | 185 |
| 187 | 3300025913 | Ga0207695_10254425 | Ga0207695_102544252 | 185 |
| 188 | 3300025917 | Ga0207660_10016818 | Ga0207660_100168187 | 185 |
| 189 | 3300025917 | Ga0207660_10051773 | Ga0207660_100517734 | 185 |
| 190 | 3300025917 | Ga0207660_10148875 | Ga0207660_101488752 | 185 |
| 191 | 3300025918 | Ga0207662_10391997 | Ga0207662_103919972 | 185 |
| 192 | 3300025919 | Ga0207657_10003963 | Ga0207657_1000396314 | 185 |
| 193 | 3300025919 | Ga0207657_10046357 | Ga0207657_100463573 | 185 |
| 194 | 3300025919 | Ga0207657_10517770 | Ga0207657_105177702 | 185 |
| 195 | 3300025921 | Ga0207652_10007396 | Ga0207652_100073962 | 185 |
| 196 | 3300025923 | Ga0207681_10131239 | Ga0207681_101312392 | 185 |
| 197 | 3300025924 | Ga0207694_10688938 | Ga0207694_106889382 | 185 |
| 198 | 3300025925 | Ga0207650_10116285 | Ga0207650_101162853 | 185 |
| 199 | 3300025925 | Ga0207650_10259365 | Ga0207650_102593652 | 185 |
| 200 | 3300025931 | Ga0207644_10217717 | Ga0207644_102177171 | 185 |
| 201 | 3300025931 | Ga0207644_11229913 | Ga0207644_112299131 | 185 |
| 202 | 3300025932 | Ga0207690_10000721 | Ga0207690_100007216 | 185 |
| 203 | 3300025933 | Ga0207706_10209343 | Ga0207706_102093432 | 185 |
| 204 | 3300025934 | Ga0207686_10028536 | Ga0207686_100285362 | 185 |
| 205 | 3300025938 | Ga0207704_10021207 | Ga0207704_100212072 | 185 |
| 206 | 3300025941 | Ga0207711_10005253 | Ga0207711_100052538 | 185 |
| 207 | 3300025941 | Ga0207711_10006201 | Ga0207711_100062014 | 185 |
| 208 | 3300025941 | Ga0207711_10321228 | Ga0207711_103212282 | 185 |
| 209 | 3300025945 | Ga0207679_10041597 | Ga0207679_100415974 | 185 |
| 210 | 3300025949 | Ga0207667_10013404 | Ga0207667_100134042 | 185 |
| 211 | 3300025949 | Ga0207667_10043017 | Ga0207667_100430175 | 185 |
| 212 | 3300025949 | Ga0207667_10163729 | Ga0207667_101637291 | 185 |
| 213 | 3300025949 | Ga0207667_10246038 | Ga0207667_102460382 | 185 |
| 214 | 3300025972 | Ga0207668_10001987 | Ga0207668_100019875 | 185 |
| 215 | 3300025972 | Ga0207668_10002033 | Ga0207668_100020331 | 185 |
| 216 | 3300025972 | Ga0207668_10187234 | Ga0207668_101872343 | 185 |
| 217 | 3300025981 | Ga0207640_10293933 | Ga0207640_102939332 | 185 |
| 218 | 3300025986 | Ga0207658_10171879 | Ga0207658_101718793 | 185 |
| 219 | 3300026035 | Ga0207703_10000049 | Ga0207703_1000004920 | 185 |
| 220 | 3300026041 | Ga0207639_10061509 | Ga0207639_100615092 | 185 |
| 221 | 3300026041 | Ga0207639_10486921 | Ga0207639_104869212 | 185 |
| 222 | 3300026041 | Ga0207639_10529852 | Ga0207639_105298522 | 185 |
| 223 | 3300026075 | Ga0207708_10697532 | Ga0207708_106975321 | 185 |
| 224 | 3300026078 | Ga0207702_10417110 | Ga0207702_104171102 | 185 |
| 225 | 3300026078 | Ga0207702_10740224 | Ga0207702_107402241 | 185 |
| 226 | 3300026088 | Ga0207641_10000011 | Ga0207641_10000011152 | 185 |
| 227 | 3300026088 | Ga0207641_10114400 | Ga0207641_101144002 | 185 |
| 228 | 3300026095 | Ga0207676_10000739 | Ga0207676_100007399 | 185 |
| 229 | 3300026095 | Ga0207676_10019096 | Ga0207676_100190962 | 185 |
| 230 | 3300026095 | Ga0207676_10136684 | Ga0207676_101366843 | 185 |
| 231 | 3300026116 | Ga0207674_10186980 | Ga0207674_101869801 | 185 |
| 232 | 3300026118 | Ga0207675_100031205 | Ga0207675_1000312053 | 185 |
| 233 | 3300026118 | Ga0207675_100148954 | Ga0207675_1001489542 | 185 |
| 234 | 3300026142 | Ga0207698_11119414 | Ga0207698_111194142 | 185 |
| 235 | 3300027378 | Ga0209981_1001429 | Ga0209981_10014295 | 185 |
| 236 | 3300027907 | Ga0207428_10010757 | Ga0207428_100107573 | 185 |
| 237 | 3300028379 | Ga0268266_10000621 | Ga0268266_1000062131 | 185 |
| 238 | 3300028379 | Ga0268266_10055286 | Ga0268266_100552865 | 185 |
| 239 | 3300028380 | Ga0268265_10008744 | Ga0268265_100087444 | 185 |
| 240 | 3300028380 | Ga0268265_10042312 | Ga0268265_100423122 | 185 |
| 241 | 3300028380 | Ga0268265_10321637 | Ga0268265_103216372 | 185 |
| 242 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002106 | 185 |
| 243 | 3300028381 | Ga0268264_10040882 | Ga0268264_100408821 | 185 |
| 244 | 3300028381 | Ga0268264_10230984 | Ga0268264_102309842 | 185 |
| 245 | 3300028381 | Ga0268264_10597222 | Ga0268264_105972222 | 185 |
| 246 | 3300028556 | Ga0265337_1010051 | Ga0265337_10100512 | 185 |
| 247 | 3300028563 | Ga0265319_1024073 | Ga0265319_10240733 | 185 |
| 248 | 3300028786 | Ga0307517_10002263 | Ga0307517_1000226315 | 185 |
| 249 | 3300028786 | Ga0307517_10037458 | Ga0307517_100374582 | 185 |
| 250 | 3300028794 | Ga0307515_10041864 | Ga0307515_100418645 | 185 |
| 251 | 3300028794 | Ga0307515_10068754 | Ga0307515_100687543 | 185 |
| 252 | 3300030521 | Ga0307511_10218015 | Ga0307511_102180152 | 185 |
| 253 | 3300031240 | Ga0265320_10164525 | Ga0265320_101645252 | 185 |
| 254 | 3300031250 | Ga0265331_10195860 | Ga0265331_101958602 | 185 |
| 255 | 3300031251 | Ga0265327_10001380 | Ga0265327_100013805 | 185 |
| 256 | 3300031251 | Ga0265327_10002320 | Ga0265327_100023208 | 185 |
| 257 | 3300031251 | Ga0265327_10065134 | Ga0265327_100651342 | 185 |
| 258 | 3300031456 | Ga0307513_10000127 | Ga0307513_1000012716 | 185 |
| 259 | 3300031456 | Ga0307513_10005398 | Ga0307513_100053987 | 185 |
| 260 | 3300031456 | Ga0307513_10022294 | Ga0307513_100222947 | 185 |
| 261 | 3300031548 | Ga0307408_100769862 | Ga0307408_1007698621 | 185 |
| 262 | 3300031616 | Ga0307508_10254968 | Ga0307508_102549682 | 185 |
| 263 | 3300031730 | Ga0307516_10000001 | Ga0307516_10000001293 | 185 |
| 264 | 3300031911 | Ga0307412_10346371 | Ga0307412_103463711 | 185 |
| 265 | 3300033180 | Ga0307510_10010349 | Ga0307510_100103492 | 185 |
| 266 | 3300034957 | Ga0373938_0033450 | Ga0373938_0033450_288_857 | 185 |
| 267 | 3300035084 | Ga0373928_0011830 | Ga0373928_0011830_404_973 | 185 |
| 268 | 3300035088 | Ga0373940_0032401 | Ga0373940_0032401_504_1073 | 185 |
| 269 | 3300035089 | Ga0373944_0017015 | Ga0373944_0017015_1296_1880 | 185 |
| 270 | 3300035090 | Ga0373949_0014335 | Ga0373949_0014335_873_1442 | 185 |
| 271 | 3300035092 | Ga0373952_0004126 | Ga0373952_0004126_1271_1840 | 185 |
| 272 | 3300035113 | Ga0373936_0010127 | Ga0373936_0010127_1252_1821 | 185 |
| 273 | 3300035121 | Ga0373960_0038567 | Ga0373960_0038567_534_1103 | 185 |
| 274 | 3300035170 | Ga0373943_0332009 | Ga0373943_0332009_167_736 | 185 |
| 275 | 3300035242 | Ga0373962_0008661 | Ga0373962_0008661_747_1316 | 185 |
| 276 | 3300035691 | Ga0373931_0001236 | Ga0373931_0001236_8448_9017 | 185 |
| 277 | 3300035692 | Ga0373935_0321375 | Ga0373935_0321375_448_1017 | 185 |
| 278 | 3300035695 | Ga0373927_0001687 | Ga0373927_0001687_7890_8474 | 185 |
| 279 | 3300035695 | Ga0373927_0088035 | Ga0373927_0088035_790_1359 | 185 |
| 280 | 3300037068 | Ga0373925_0000089 | Ga0373925_0000089_70072_70656 | 185 |
| 281 | 3300037471 | Ga0395905_0058274 | Ga0395905_0058274_1419_1988 | 185 |
| 282 | 3300038443 | Ga0395901_0057916 | Ga0395901_0057916_2762_3331 | 185 |
| 283 | 3300038443 | Ga0395901_0273604 | Ga0395901_0273604_319_882 | 185 |
| 284 | 3300039437 | Ga0436365_0706118 | Ga0436365_0706118_3397_3966 | 185 |
| 285 | 3300039437 | Ga0436365_1521295 | Ga0436365_1521295_204_773 | 185 |
| 286 | 3300042156 | Ga0439446_0001768 | Ga0439446_0001768_1845_2411 | 185 |
| 287 | 3300042436 | Ga0439435_0010130 | Ga0439435_0010130_1461_2027 | 185 |
| 288 | 3300044684 | Ga0466966_0317403 | Ga0466966_0317403_239_805 | 185 |
| 289 | 3300044706 | Ga0466964_0169345 | Ga0466964_0169345_39_608 | 185 |
| 290 | 3300044706 | Ga0466964_0200141 | Ga0466964_0200141_250_816 | 185 |
| 291 | 3300044901 | Ga0466960_0167240 | Ga0466960_0167240_289_855 | 185 |
| 292 | 3300045049 | Ga0466959_0056213 | Ga0466959_0056213_2177_2743 | 185 |
| 293 | 3300046453 | Ga0495627_000513 | Ga0495627_000513_20964_21527 | 185 |
| 294 | 3300046457 | Ga0495590_0000309 | Ga0495590_0000309_14216_14782 | 185 |
| 295 | 3300046460 | Ga0495638_0000782 | Ga0495638_0000782_11746_12312 | 185 |
| 296 | 3300046460 | Ga0495638_0002789 | Ga0495638_0002789_4947_5510 | 185 |
| 297 | 3300046460 | Ga0495638_0006168 | Ga0495638_0006168_7582_8145 | 185 |
| 298 | 3300046460 | Ga0495638_0028472 | Ga0495638_0028472_1613_2179 | 185 |
| 299 | 3300046492 | Ga0495585_0209027 | Ga0495585_0209027_118_693 | 185 |
| 300 | 3300046506 | Ga0495583_0026122 | Ga0495583_0026122_2111_2686 | 185 |
| 301 | 3300046507 | Ga0495606_0102859 | Ga0495606_0102859_1135_1698 | 185 |
| 302 | 3300046512 | Ga0495610_0001981 | Ga0495610_0001981_5044_5607 | 185 |
| 303 | 3300046512 | Ga0495610_0002726 | Ga0495610_0002726_11350_11916 | 185 |
| 304 | 3300046513 | Ga0495616_0001022 | Ga0495616_0001022_15482_16045 | 185 |
| 305 | 3300046516 | Ga0495628_0084804 | Ga0495628_0084804_633_1238 | 185 |
| 306 | 3300046518 | Ga0495631_0001982 | Ga0495631_0001982_5791_6357 | 185 |
| 307 | 3300046520 | Ga0495637_0071977 | Ga0495637_0071977_212_781 | 185 |
| 308 | 3300046522 | Ga0495643_0150994 | Ga0495643_0150994_100_669 | 185 |
| 309 | 3300046524 | Ga0495648_0000039 | Ga0495648_0000039_6543_7109 | 185 |
| 310 | 3300046528 | Ga0495642_0006363 | Ga0495642_0006363_1799_2368 | 185 |
| 311 | 3300046528 | Ga0495642_0041196 | Ga0495642_0041196_95_664 | 185 |
| 312 | 3300046529 | Ga0495652_0506838 | Ga0495652_0506838_188_796 | 185 |
| 313 | 3300046536 | Ga0495587_0340430 | Ga0495587_0340430_222_809 | 185 |
| 314 | 3300046539 | Ga0495621_0208636 | Ga0495621_0208636_137_712 | 185 |
| 315 | 3300046542 | Ga0495597_0001061 | Ga0495597_0001061_5925_6494 | 185 |
| 316 | 3300046616 | Ga0495668_0000221 | Ga0495668_0000221_55137_55700 | 185 |
| 317 | 3300046616 | Ga0495668_0008696 | Ga0495668_0008696_5360_5926 | 185 |
| 318 | 3300046616 | Ga0495668_0058663 | Ga0495668_0058663_1455_2027 | 185 |
| 319 | 3300046616 | Ga0495668_0064493 | Ga0495668_0064493_328_897 | 185 |
| 320 | 3300046616 | Ga0495668_0124997 | Ga0495668_0124997_827_1396 | 185 |
| 321 | 3300046616 | Ga0495668_0282440 | Ga0495668_0282440_54_617 | 185 |
| 322 | 3300046616 | Ga0495668_0489660 | Ga0495668_0489660_94_663 | 185 |
| 323 | 3300046616 | Ga0495668_0505391 | Ga0495668_0505391_85_654 | 185 |
| 324 | 3300046648 | Ga0495611_0022340 | Ga0495611_0022340_1764_2333 | 185 |
| 325 | 3300046660 | Ga0495625_0000034 | Ga0495625_0000034_8805_9371 | 185 |
| 326 | 3300046660 | Ga0495625_0087248 | Ga0495625_0087248_1139_1714 | 185 |
| 327 | 3300046660 | Ga0495625_0142100 | Ga0495625_0142100_545_1108 | 185 |
| 328 | 3300046660 | Ga0495625_0253950 | Ga0495625_0253950_189_764 | 185 |
| 329 | 3300046664 | Ga0495659_0039063 | Ga0495659_0039063_184_747 | 185 |
| 330 | 3300046684 | Ga0495669_0000002 | Ga0495669_0000002_25369_25938 | 185 |
| 331 | 3300046684 | Ga0495669_0000317 | Ga0495669_0000317_4571_5140 | 185 |
| 332 | 3300046684 | Ga0495669_0002819 | Ga0495669_0002819_4911_5480 | 185 |
| 333 | 3300046684 | Ga0495669_0112053 | Ga0495669_0112053_549_1118 | 185 |
| 334 | 3300046689 | Ga0495613_0001433 | Ga0495613_0001433_8556_9164 | 185 |
| 335 | 3300046794 | Ga0495589_0185232 | Ga0495589_0185232_23_586 | 185 |
| 336 | 3300046810 | Ga0495660_0011161 | Ga0495660_0011161_2031_2594 | 185 |
| 337 | 3300047319 | Ga0495674_0184948 | Ga0495674_0184948_606_1211 | 185 |
| 338 | 3300047320 | Ga0495672_0000778 | Ga0495672_0000778_32056_32625 | 185 |
| 339 | 3300047443 | Ga0495687_104978 | Ga0495687_104978_371_940 | 185 |
| 340 | 3300047445 | Ga0495677_0006171 | Ga0495677_0006171_2721_3290 | 185 |
| 341 | 3300047445 | Ga0495677_0012380 | Ga0495677_0012380_986_1555 | 185 |
| 342 | 3300047445 | Ga0495677_0012403 | Ga0495677_0012403_1182_1751 | 185 |
| 343 | 3300047446 | Ga0495679_003359 | Ga0495679_003359_2381_2944 | 185 |
| 344 | 3300047469 | Ga0495673_0000223 | Ga0495673_0000223_65633_66196 | 185 |
| 345 | 3300047469 | Ga0495673_0001949 | Ga0495673_0001949_10679_11245 | 185 |
| 346 | 3300047472 | Ga0495686_0001197 | Ga0495686_0001197_18065_18631 | 185 |
| 347 | 3300047472 | Ga0495686_0031613 | Ga0495686_0031613_2786_3349 | 185 |
| 348 | 3300048903 | Ga0496100_0510224 | Ga0496100_0510224_90_659 | 185 |
| 349 | 3300048904 | Ga0496101_0430426 | Ga0496101_0430426_364_933 | 185 |
| 350 | 3300048905 | Ga0496102_0044272 | Ga0496102_0044272_1659_2228 | 185 |
| 351 | 3300048905 | Ga0496102_0138713 | Ga0496102_0138713_52_621 | 185 |
| 352 | 3300048905 | Ga0496102_0228999 | Ga0496102_0228999_1025_1594 | 185 |
| 353 | 3300048906 | Ga0496103_0160935 | Ga0496103_0160935_76_645 | 185 |
| 354 | 3300048909 | Ga0496106_0357863 | Ga0496106_0357863_121_684 | 185 |
| 355 | 3300048910 | Ga0496107_0000029 | Ga0496107_0000029_49005_49568 | 185 |
| 356 | 3300048912 | Ga0496109_0036566 | Ga0496109_0036566_3225_3794 | 185 |
| 357 | 3300048912 | Ga0496109_0146299 | Ga0496109_0146299_1037_1606 | 185 |
| 358 | 3300048913 | Ga0496110_0007268 | Ga0496110_0007268_5907_6476 | 185 |
| 359 | 3300048913 | Ga0496110_0397169 | Ga0496110_0397169_369_938 | 185 |
| 360 | 3300048914 | Ga0496111_0030793 | Ga0496111_0030793_2163_2732 | 185 |
| 361 | 3300048914 | Ga0496111_0246494 | Ga0496111_0246494_312_881 | 185 |
| 362 | 3300048915 | Ga0496112_0017333 | Ga0496112_0017333_1790_2407 | 185 |
| 363 | 3300048915 | Ga0496112_0061990 | Ga0496112_0061990_113_682 | 185 |
| 364 | 3300048915 | Ga0496112_0248011 | Ga0496112_0248011_68_637 | 185 |
| 365 | 3300048915 | Ga0496112_0558968 | Ga0496112_0558968_192_767 | 185 |
| 366 | 3300048915 | Ga0496112_1188071 | Ga0496112_1188071_27_596 | 185 |
| 367 | 3300048916 | Ga0496113_0729097 | Ga0496113_0729097_47_616 | 185 |
| 368 | 3300048918 | Ga0496115_0000771 | Ga0496115_0000771_16230_16799 | 185 |
| 369 | 3300048918 | Ga0496115_0007037 | Ga0496115_0007037_5318_5902 | 185 |
| 370 | 3300048918 | Ga0496115_0027262 | Ga0496115_0027262_2043_2636 | 185 |
| 371 | 3300048918 | Ga0496115_0751946 | Ga0496115_0751946_179_745 | 185 |
| 372 | 3300048919 | Ga0496116_0134897 | Ga0496116_0134897_219_788 | 185 |
| 373 | 3300048920 | Ga0496117_0007978 | Ga0496117_0007978_1369_1938 | 185 |
| 374 | 3300048921 | Ga0496118_0010336 | Ga0496118_0010336_4286_4855 | 185 |
| 375 | 3300048924 | Ga0496121_0000397 | Ga0496121_0000397_52371_52940 | 185 |
| 376 | 3300048924 | Ga0496121_0006516 | Ga0496121_0006516_3241_3804 | 185 |
| 377 | 3300048924 | Ga0496121_0065129 | Ga0496121_0065129_597_1160 | 185 |
| 378 | 3300048924 | Ga0496121_0226863 | Ga0496121_0226863_718_1296 | 185 |
| 379 | 3300048928 | Ga0496125_0212402 | Ga0496125_0212402_53_616 | 185 |
| 380 | 3300048929 | Ga0496126_0289480 | Ga0496126_0289480_469_1032 | 185 |
| 381 | 3300048929 | Ga0496126_0414284 | Ga0496126_0414284_54_617 | 185 |
| 382 | 3300049459 | Ga0495678_000773 | Ga0495678_000773_9511_10077 | 185 |
| 383 | 3300049460 | Ga0495682_0071270 | Ga0495682_0071270_647_1216 | 185 |
| 384 | 3300049570 | Ga0501033_0599339 | Ga0501033_0599339_76_651 | 185 |
| 385 | 3300049571 | Ga0501034_0075750 | Ga0501034_0075750_219_788 | 185 |
| 386 | 3300049574 | Ga0501038_0528512 | Ga0501038_0528512_127_705 | 185 |
| 387 | 3300049575 | Ga0501039_0109899 | Ga0501039_0109899_691_1257 | 185 |
| 388 | 3300049575 | Ga0501039_0259693 | Ga0501039_0259693_505_1083 | 185 |
| 389 | 3300049575 | Ga0501039_0276945 | Ga0501039_0276945_704_1273 | 185 |
| 390 | 3300049576 | Ga0501040_0234622 | Ga0501040_0234622_695_1273 | 185 |
| 391 | 3300049577 | Ga0501041_0138876 | Ga0501041_0138876_587_1156 | 185 |
| 392 | 3300049580 | Ga0501046_0039248 | Ga0501046_0039248_2864_3442 | 185 |
| 393 | 3300049580 | Ga0501046_0265837 | Ga0501046_0265837_543_1112 | 185 |
| 394 | 3300049581 | Ga0501047_0001827 | Ga0501047_0001827_8893_9462 | 185 |
| 395 | 3300049582 | Ga0501048_0090698 | Ga0501048_0090698_599_1177 | 185 |
| 396 | 3300049584 | Ga0501068_0467188 | Ga0501068_0467188_84_653 | 185 |
| 397 | 3300049584 | Ga0501068_0468115 | Ga0501068_0468115_130_708 | 185 |
| 398 | 3300049586 | Ga0501070_0080286 | Ga0501070_0080286_1238_1816 | 185 |
| 399 | 3300049587 | Ga0501071_0349566 | Ga0501071_0349566_59_628 | 185 |
| 400 | 3300049588 | Ga0501072_0048835 | Ga0501072_0048835_2659_3228 | 185 |
| 401 | 3300049588 | Ga0501072_0095088 | Ga0501072_0095088_979_1545 | 185 |
| 402 | 3300049588 | Ga0501072_0199399 | Ga0501072_0199399_972_1550 | 185 |
| 403 | 3300049588 | Ga0501072_0398834 | Ga0501072_0398834_248_817 | 185 |
| 404 | 3300049589 | Ga0501073_0349407 | Ga0501073_0349407_175_744 | 185 |
| 405 | 3300049589 | Ga0501073_0510956 | Ga0501073_0510956_23_601 | 185 |
| 406 | 3300049592 | Ga0501076_0089577 | Ga0501076_0089577_1882_2451 | 185 |
| 407 | 3300049592 | Ga0501076_0657026 | Ga0501076_0657026_150_728 | 185 |
| 408 | 3300049592 | Ga0501076_0851396 | Ga0501076_0851396_144_737 | 185 |
| 409 | 3300049741 | Ga0501079_0899469 | Ga0501079_0899469_44_616 | 185 |
| 410 | 3300049742 | Ga0501080_0010727 | Ga0501080_0010727_5169_5738 | 185 |
| 411 | 3300049743 | Ga0501081_0018566 | Ga0501081_0018566_1811_2389 | 185 |
| 412 | 3300049743 | Ga0501081_0181751 | Ga0501081_0181751_225_791 | 185 |
| 413 | 3300049743 | Ga0501081_0365756 | Ga0501081_0365756_174_743 | 185 |
| 414 | 3300049743 | Ga0501081_0911524 | Ga0501081_0911524_25_597 | 185 |
| 415 | 3300049744 | Ga0501083_0102287 | Ga0501083_0102287_250_819 | 185 |
| 416 | 3300049822 | Ga0501035_0614645 | Ga0501035_0614645_26_595 | 185 |
| 417 | 3300049824 | Ga0501045_0095419 | Ga0501045_0095419_1343_1921 | 185 |
| 418 | 3300050496 | nmdc:mga07m45_134555_c1 | nmdc:mga07m45_134555_c1_558_1178 | 185 |
| 419 | 3300050507 | nmdc:mga05p37_74423_c1 | nmdc:mga05p37_74423_c1_1172_1744 | 185 |
| 420 | 3300050507 | nmdc:mga05p37_929376_c1 | nmdc:mga05p37_929376_c1_302_871 | 185 |
| 421 | 3300050508 | nmdc:mga09592_6522_c2 | nmdc:mga09592_6522_c2_1917_2486 | 185 |
| 422 | 3300050508 | nmdc:mga09592_716428_c1 | nmdc:mga09592_716428_c1_85_657 | 185 |
| 423 | 3300050510 | nmdc:mga06r32_120185_c1 | nmdc:mga06r32_120185_c1_870_1439 | 185 |
| 424 | 3300050510 | nmdc:mga06r32_36778_c1 | nmdc:mga06r32_36778_c1_2553_3122 | 185 |
| 425 | 3300050510 | nmdc:mga06r32_579677_c1 | nmdc:mga06r32_579677_c1_509_1078 | 185 |
| 426 | 3300050510 | nmdc:mga06r32_82932_c1 | nmdc:mga06r32_82932_c1_1133_1705 | 185 |
| 427 | 3300050511 | nmdc:mga08y16_112215_c1 | nmdc:mga08y16_112215_c1_312_884 | 185 |
| 428 | 3300050511 | nmdc:mga08y16_144719_c1 | nmdc:mga08y16_144719_c1_796_1365 | 185 |
| 429 | 3300050512 | nmdc:mga0n895_3101_c1 | nmdc:mga0n895_3101_c1_5048_5617 | 185 |
| 430 | 3300050515 | nmdc:mga0a205_3468_c1 | nmdc:mga0a205_3468_c1_5887_6456 | 185 |
| 431 | 3300053086 | Ga0500578_0001117 | Ga0500578_0001117_18764_19330 | 185 |
| 432 | 3300053086 | Ga0500578_0464524 | Ga0500578_0464524_83_652 | 185 |
| 433 | 3300053087 | Ga0500643_003852 | Ga0500643_003852_4703_5266 | 185 |
| 434 | 3300053087 | Ga0500643_020813 | Ga0500643_020813_1468_2034 | 185 |
| 435 | 3300053088 | Ga0500644_0000822 | Ga0500644_0000822_5681_6247 | 185 |
| 436 | 3300053088 | Ga0500644_0048316 | Ga0500644_0048316_315_881 | 185 |
| 437 | 3300053091 | Ga0500647_0076122 | Ga0500647_0076122_371_934 | 185 |
| 438 | 3300053093 | Ga0500651_0380679 | Ga0500651_0380679_66_632 | 185 |
| 439 | 3300053102 | Ga0500554_104451 | Ga0500554_104451_198_761 | 185 |
| 440 | 3300053111 | Ga0500572_000561 | Ga0500572_000561_10117_10680 | 185 |
| 441 | 3300053118 | Ga0500594_0000093 | Ga0500594_0000093_5358_5924 | 185 |
| 442 | 3300053122 | Ga0500608_000188 | Ga0500608_000188_18510_19073 | 185 |
| 443 | 3300053122 | Ga0500608_002326 | Ga0500608_002326_4495_5064 | 185 |
| 444 | 3300053122 | Ga0500608_117025 | Ga0500608_117025_220_786 | 185 |
| 445 | 3300053123 | Ga0500614_021634 | Ga0500614_021634_675_1238 | 185 |
| 446 | 3300053125 | Ga0500618_000152 | Ga0500618_000152_35252_35815 | 185 |
| 447 | 3300053130 | Ga0500642_0088580 | Ga0500642_0088580_647_1213 | 185 |
| 448 | 3300053131 | Ga0500652_034298 | Ga0500652_034298_240_803 | 185 |
| 449 | 3300053133 | Ga0500655_068862 | Ga0500655_068862_41_607 | 185 |
| 450 | 3300053136 | Ga0500559_0000054 | Ga0500559_0000054_70775_71338 | 185 |
| 451 | 3300053136 | Ga0500559_0002200 | Ga0500559_0002200_4937_5503 | 185 |
| 452 | 3300053136 | Ga0500559_0004821 | Ga0500559_0004821_3427_3990 | 185 |
| 453 | 3300053138 | Ga0500564_000094 | Ga0500564_000094_83_649 | 185 |
| 454 | 3300053148 | Ga0500590_054907 | Ga0500590_054907_98_661 | 185 |
| 455 | 3300053156 | Ga0500622_0001162 | Ga0500622_0001162_2871_3437 | 185 |
| 456 | 3300054114 | Ga0501084_0010424 | Ga0501084_0010424_4556_5125 | 185 |
| 457 | 3300054114 | Ga0501084_0057061 | Ga0501084_0057061_2616_3182 | 185 |
| 458 | 3300054114 | Ga0501084_0432981 | Ga0501084_0432981_345_917 | 185 |
| 459 | 3300060353 | Ga0501082_0009285 | Ga0501082_0009285_3381_3950 | 185 |
| 460 | 3300060353 | Ga0501082_0077766 | Ga0501082_0077766_2045_2623 | 185 |
| 461 | 3300060353 | Ga0501082_0245384 | Ga0501082_0245384_220_786 | 185 |
| 462 | 3300060353 | Ga0501082_0245403 | Ga0501082_0245403_42_611 | 185 |
| 463 | 3300060353 | Ga0501082_0415192 | Ga0501082_0415192_103_666 | 185 |
| 464 | 3300061734 | Ga0530510_0048406 | Ga0530510_0048406_2432_3001 | 185 |
| 465 | 3300061734 | Ga0530510_0215322 | Ga0530510_0215322_760_1326 | 185 |
| 466 | 3300061734 | Ga0530510_0245248 | Ga0530510_0245248_492_1061 | 185 |
| 467 | 3300005439 | Ga0070711_100561417 | Ga0070711_1005614172 | 186 |
| 468 | 3300006038 | Ga0075365_10929178 | Ga0075365_109291781 | 186 |
| 469 | 3300026075 | Ga0207708_10266981 | Ga0207708_102669812 | 186 |
| 470 | 3300031456 | Ga0307513_10006008 | Ga0307513_100060085 | 186 |
| 471 | 3300031903 | Ga0307407_10355261 | Ga0307407_103552612 | 186 |
| 472 | 3300031911 | Ga0307412_10341554 | Ga0307412_103415542 | 186 |
| 473 | 3300032005 | Ga0307411_10695977 | Ga0307411_106959771 | 186 |
| 474 | 3300032126 | Ga0307415_101103179 | Ga0307415_1011031791 | 186 |
| 475 | 3300037471 | Ga0395905_0552312 | Ga0395905_0552312_211_828 | 186 |
| 476 | 3300046471 | Ga0495650_0113576 | Ga0495650_0113576_24_629 | 186 |
| 477 | 3300046539 | Ga0495621_0183181 | Ga0495621_0183181_115_726 | 186 |
| 478 | 3300049581 | Ga0501047_0091648 | Ga0501047_0091648_909_1484 | 186 |
| 479 | 3300049822 | Ga0501035_0665376 | Ga0501035_0665376_209_778 | 186 |
| 480 | 3300049823 | Ga0501044_0326402 | Ga0501044_0326402_446_1021 | 186 |
| 481 | 3300053119 | Ga0500595_057501 | Ga0500595_057501_564_1127 | 187 |
| 482 | 3300003320 | rootH2_10106005 | rootH2_101060052 | 188 |
| 483 | 3300005337 | Ga0070682_100022064 | Ga0070682_1000220643 | 188 |
| 484 | 3300005339 | Ga0070660_100081723 | Ga0070660_1000817232 | 188 |
| 485 | 3300005440 | Ga0070705_100055287 | Ga0070705_1000552871 | 188 |
| 486 | 3300005444 | Ga0070694_100035770 | Ga0070694_1000357703 | 188 |
| 487 | 3300005455 | Ga0070663_100001790 | Ga0070663_1000017905 | 188 |
| 488 | 3300005530 | Ga0070679_100082950 | Ga0070679_1000829504 | 188 |
| 489 | 3300005539 | Ga0068853_100038979 | Ga0068853_1000389794 | 188 |
| 490 | 3300005563 | Ga0068855_100230580 | Ga0068855_1002305801 | 188 |
| 491 | 3300005615 | Ga0070702_100116787 | Ga0070702_1001167872 | 188 |
| 492 | 3300005618 | Ga0068864_101209508 | Ga0068864_1012095082 | 188 |
| 493 | 3300005842 | Ga0068858_100033334 | Ga0068858_1000333344 | 188 |
| 494 | 3300006358 | Ga0068871_100880406 | Ga0068871_1008804062 | 188 |
| 495 | 3300009545 | Ga0105237_10173262 | Ga0105237_101732623 | 188 |
| 496 | 3300009551 | Ga0105238_10139157 | Ga0105238_101391571 | 188 |
| 497 | 3300013105 | Ga0157369_10296165 | Ga0157369_102961652 | 188 |
| 498 | 3300014326 | Ga0157380_10189901 | Ga0157380_101899012 | 188 |
| 499 | 3300014968 | Ga0157379_10017905 | Ga0157379_100179055 | 188 |
| 500 | 3300025904 | Ga0207647_10022869 | Ga0207647_100228694 | 188 |
| 501 | 3300025911 | Ga0207654_10059012 | Ga0207654_100590123 | 188 |
| 502 | 3300025919 | Ga0207657_10068026 | Ga0207657_100680264 | 188 |
| 503 | 3300025920 | Ga0207649_10554035 | Ga0207649_105540351 | 188 |
| 504 | 3300025924 | Ga0207694_10158317 | Ga0207694_101583173 | 188 |
| 505 | 3300025932 | Ga0207690_10056777 | Ga0207690_100567772 | 188 |
| 506 | 3300025945 | Ga0207679_10162650 | Ga0207679_101626503 | 188 |
| 507 | 3300025949 | Ga0207667_10948200 | Ga0207667_109482001 | 188 |
| 508 | 3300026035 | Ga0207703_10030770 | Ga0207703_100307704 | 188 |
| 509 | 3300026067 | Ga0207678_10000101 | Ga0207678_1000010142 | 188 |
| 510 | 3300026075 | Ga0207708_10433485 | Ga0207708_104334852 | 188 |
| 511 | 3300026095 | Ga0207676_10269342 | Ga0207676_102693422 | 188 |
| 512 | 3300026142 | Ga0207698_10232326 | Ga0207698_102323263 | 188 |
| 513 | 3300048929 | Ga0496126_0888096 | Ga0496126_0888096_65_631 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fpo-assembly1.cif.gz_A | putative methyltransferase yhhf from escherichia coli. | 0.8923 | 1 | 187 |
| 6m1c-assembly1.cif.gz_A | crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions | 0.8915 | 1 | 184 |
| 2fpo-assembly5.cif.gz_E | putative methyltransferase yhhf from escherichia coli. | 0.8904 | 1 | 187 |
| 2fpo-assembly4.cif.gz_D | putative methyltransferase yhhf from escherichia coli. | 0.8844 | 1 | 187 |
| 3p9n-assembly1.cif.gz_A | rv2966c of m. tuberculosis is a rsmd-like methyltransferase | 0.8804 | 1 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.907 | 44 | 105 | 3.40.50.150 |
| af_P0ADX9_1_198_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.898 | 1 | 186 | 3.40.50.150 |
| af_Q2FZF6_1_156_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.889 | 25 | 185 | 3.40.50.150 |
| 6aieC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.883 | 1 | 184 | 3.40.50.150 |
| af_Q2FZF6_1_156_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.878 | 25 | 185 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357CJG3-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD | 0.9887 | 47 | 185 |
GO:0003676
GO:0008168 GO:0031167 |
| AF-A0A527GTB0-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD | 0.9884 | 45 | 185 |
GO:0003676
GO:0008168 GO:0031167 |
| AF-A0A529U2F3-F1-model_v4 | deleted | 0.9872 | 63 | 184 |
|
| AF-A0A528UIM2-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD | 0.9833 | 52 | 185 |
GO:0003676
GO:0008168 GO:0031167 |
| AF-K8PAB4-F1-model_v4 | RsmD family RNA methyltransferase | 0.9824 | 1 | 184 |
GO:0003676
GO:0008168 GO:0031167 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar