F457560

General Info

Members Datasets Scaffolds Average Seq Length
513 294 492 189

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10097266|Ga0105238_100972662
Length 214
Sequence LLPRKLGTGDSARQARRLEVLNIVRIVSGSFRGKTLAAPAGEATRPTSDRARQAIFNILEHAAWSPGLRDVRVIDLFAGSGALGFEALSRGAAFCLFVETDEAARGAIRENVEAMGLFGVTRVHRRDATDLGMRPGADGPAFDFAFLDPPYAKGLGETALDKLAAGGWLKPGATVVFERGAGEPDLDIAGFEPLDIRDYGAARVSFLRFAETPR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
8 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
12 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
15 2849560528 Caulobacter zeae 410 Isolate Unclassified
16 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
17 2851153111 Caulobacter radicis 736 Isolate Unclassified
18 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
19 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
20 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
21 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
284 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
285 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
286 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.91
Metatranscriptomes 0
Isolates 4.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.94
Nodule 0
Rhizoplane 4.68
Rhizosphere 77.58
Stem 0
Stem Tuber 0
Unclassified 7.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10106005 3300003320 Bacteria 1200
2 Ga0055536_1001003 3300003781 Bacteria 17938
3 Ga0055530_10000337 3300003791 Bacteria 42372
4 Ga0055530_10001846 3300003791 Bacteria 14564
5 Ga0055530_10003612 3300003791 Bacteria 8681
6 Ga0055531_10000820 3300003794 Bacteria 25755
7 Ga0055531_10001142 3300003794 Bacteria 20555
8 Ga0055543_1024023 3300004625 Bacteria 1096
9 Ga0065165_1000171 3300005262 Bacteria 114917
10 Ga0070658_10214714 3300005327 Bacteria 1626
11 Ga0070658_10378802 3300005327 Bacteria 1213
12 Ga0070670_100145858 3300005331 Bacteria 2048
13 Ga0070670_100155670 3300005331 Bacteria 1979
14 Ga0070670_100293181 3300005331 Bacteria 1422
15 Ga0070666_10194976 3300005335 Bacteria 1424
16 Ga0070680_100018418 3300005336 Bacteria 5517
17 Ga0070680_100037522 3300005336 Bacteria 3915
18 Ga0070682_100022064 3300005337 Bacteria 3766
19 Ga0070682_100385777 3300005337 Bacteria 1055
20 Ga0070660_100074290 3300005339 Bacteria 2660
21 Ga0070660_100081723 3300005339 Bacteria 2537
22 Ga0070691_10012514 3300005341 Bacteria 3886
23 Ga0070687_100263958 3300005343 Bacteria 1076
24 Ga0070661_100100169 3300005344 Bacteria 2154
25 Ga0070668_100025547 3300005347 Bacteria 4479
26 Ga0070668_100063153 3300005347 Bacteria 2870
27 Ga0070671_100014187 3300005355 Bacteria 6433
28 Ga0070671_100367153 3300005355 Bacteria 1229
29 Ga0070671_101357076 3300005355 Bacteria 628
30 Ga0070659_100000572 3300005366 Bacteria 26951
31 Ga0070659_100012877 3300005366 Bacteria 6216
32 Ga0070667_100010707 3300005367 Bacteria 7580
33 Ga0070711_100561417 3300005439 Bacteria 948
34 Ga0070705_100055287 3300005440 Bacteria 2332
35 Ga0070705_100536724 3300005440 Bacteria 894
36 Ga0070694_100035770 3300005444 Bacteria 3286
37 Ga0070663_100001790 3300005455 Bacteria 11959
38 Ga0070678_100029073 3300005456 Bacteria 3780
39 Ga0070662_100174784 3300005457 Bacteria 1689
40 Ga0070679_100082950 3300005530 Bacteria 3195
41 Ga0068853_100038979 3300005539 Bacteria 4051
42 Ga0068853_100092445 3300005539 Bacteria 2661
43 Ga0068853_100595447 3300005539 Bacteria 1050
44 Ga0070672_100585561 3300005543 Bacteria 971
45 Ga0070665_100000622 3300005548 Bacteria 48397
46 Ga0070665_100075069 3300005548 Bacteria 3387
47 Ga0068855_100055347 3300005563 Bacteria 4660
48 Ga0068855_100209297 3300005563 Bacteria 2192
49 Ga0068855_100230580 3300005563 Bacteria 2074
50 Ga0068855_100243925 3300005563 Bacteria 2006
51 Ga0070664_100214143 3300005564 Bacteria 1722
52 Ga0068854_100326935 3300005578 Bacteria 1248
53 Ga0068856_100494539 3300005614 Bacteria 1244
54 Ga0070702_100116787 3300005615 Bacteria 1664
55 Ga0068852_101100624 3300005616 Bacteria 815
56 Ga0068859_100013721 3300005617 Bacteria 8124
57 Ga0068864_100008710 3300005618 Bacteria 8367
58 Ga0068864_100075368 3300005618 Bacteria 2946
59 Ga0068864_100529412 3300005618 Bacteria 1137
60 Ga0068864_101209508 3300005618 Unclassified 754
61 Ga0068861_100051839 3300005719 Bacteria 3117
62 Ga0068861_100257978 3300005719 Bacteria 1491
63 Ga0068863_100000045 3300005841 Bacteria 147269
64 Ga0068863_100026291 3300005841 Bacteria 5553
65 Ga0068863_100049914 3300005841 Bacteria 3968
66 Ga0068858_100033334 3300005842 Bacteria 4781
67 Ga0068858_100109610 3300005842 Bacteria 2578
68 Ga0068860_100028753 3300005843 Bacteria 5350
69 Ga0068860_100177028 3300005843 Bacteria 2061
70 Ga0068860_100244402 3300005843 Bacteria 1746
71 Ga0068862_100008821 3300005844 Bacteria 8349
72 Ga0068862_100012456 3300005844 Bacteria 7038
73 Ga0068862_100030139 3300005844 Bacteria 4571
74 Ga0068862_100496876 3300005844 Bacteria 1157
75 Ga0081455_10000022 3300005937 Bacteria 159620
76 Ga0081455_10093505 3300005937 Bacteria 2430
77 Ga0070717_10168089 3300006028 Bacteria 1906
78 Ga0070717_10529217 3300006028 Bacteria 1067
79 Ga0075365_10379122 3300006038 Bacteria 998
80 Ga0075365_10929178 3300006038 Bacteria 613
81 Ga0075432_10046497 3300006058 Bacteria 1523
82 Ga0075369_10003307 3300006186 Bacteria 5856
83 Ga0075370_10049315 3300006353 Bacteria 2386
84 Ga0068871_100880406 3300006358 Unclassified 829
85 Ga0075428_100075472 3300006844 Bacteria 3681
86 Ga0075428_100466011 3300006844 Bacteria 1353
87 Ga0075430_100462244 3300006846 Bacteria 1047
88 Ga0075431_100006746 3300006847 Bacteria 11400
89 Ga0075431_100021213 3300006847 Bacteria 6638
90 Ga0075431_100056098 3300006847 Bacteria 4064
91 Ga0075431_100730527 3300006847 Bacteria 966
92 Ga0075431_100781980 3300006847 Bacteria 928
93 Ga0075433_10002806 3300006852 Bacteria 13350
94 Ga0075434_100000682 3300006871 Bacteria 26436
95 Ga0075429_100062430 3300006880 Bacteria 3246
96 Ga0075429_100134798 3300006880 Bacteria 2161
97 Ga0075429_100139804 3300006880 Bacteria 2119
98 Ga0075429_100146387 3300006880 Bacteria 2067
99 Ga0075429_100898724 3300006880 Bacteria 775
100 Ga0068865_100017815 3300006881 Bacteria 4574
101 Ga0097620_100013721 3300006931 Bacteria 8124
102 Ga0097620_100107052 3300006931 Unclassified 2856
103 Ga0105250_10241620 3300009092 Bacteria 770
104 Ga0105240_10003686 3300009093 Bacteria 23693
105 Ga0105240_10064756 3300009093 Bacteria 4540
106 Ga0105240_10121519 3300009093 Bacteria 3144
107 Ga0105240_10242094 3300009093 Bacteria 2091
108 Ga0105240_10256190 3300009093 Bacteria 2021
109 Ga0105240_10308820 3300009093 Bacteria 1807
110 Ga0111539_10006439 3300009094 Bacteria 15133
111 Ga0111539_10009047 3300009094 Bacteria 12605
112 Ga0111539_10023642 3300009094 Bacteria 7551
113 Ga0105245_10736653 3300009098 Bacteria 1021
114 Ga0105247_10378016 3300009101 Bacteria 1003
115 Ga0114129_10062433 3300009147 Bacteria 5205
116 Ga0114129_10092906 3300009147 Bacteria 4180
117 Ga0114129_10450331 3300009147 Bacteria 1688
118 Ga0105241_10323671 3300009174 Bacteria 1330
119 Ga0105248_10007277 3300009177 Bacteria 12142
120 Ga0105248_10021669 3300009177 Bacteria 7118
121 Ga0105248_10124089 3300009177 Bacteria 2913
122 Ga0105248_10611401 3300009177 Bacteria 1230
123 Ga0105248_10651147 3300009177 Bacteria 1189
124 Ga0105237_10173262 3300009545 Bacteria 2158
125 Ga0105237_10850969 3300009545 Bacteria 919
126 Ga0105238_10017608 3300009551 Bacteria 7263
127 Ga0105238_10097266 3300009551 Bacteria 2929
128 Ga0105238_10104420 3300009551 Bacteria 2814
129 Ga0105238_10139157 3300009551 Bacteria 2405
130 Ga0105238_10774850 3300009551 Bacteria 974
131 Ga0105249_10104794 3300009553 Bacteria 2665
132 Ga0105239_10229224 3300010375 Bacteria 2084
133 Ga0157373_10003319 3300013100 Bacteria 12159
134 Ga0157373_10013230 3300013100 Bacteria 6058
135 Ga0157370_10245057 3300013104 Bacteria 1658
136 Ga0157369_10296165 3300013105 Bacteria 1683
137 Ga0157369_10443148 3300013105 Bacteria 1345
138 Ga0163162_10449121 3300013306 Bacteria 1421
139 Ga0163162_11031732 3300013306 Unclassified 930
140 Ga0157375_10288392 3300013308 Bacteria 1804
141 Ga0157375_10291033 3300013308 Bacteria 1796
142 Ga0163163_10004247 3300014325 Bacteria 12211
143 Ga0163163_11429630 3300014325 Bacteria 753
144 Ga0157380_10189901 3300014326 Bacteria 1812
145 Ga0157379_10017905 3300014968 Bacteria 6241
146 Ga0157379_10261577 3300014968 Bacteria 1572
147 Ga0182007_10191322 3300015262 Bacteria 712
148 Ga0213872_10159098 3300021361 Bacteria 983
149 Ga0213876_10158935 3300021384 Bacteria 1202
150 Ga0213876_10212558 3300021384 Bacteria 1028
151 Ga0209676_1000319 3300025292 Bacteria 93542
152 Ga0209676_1000401 3300025292 Bacteria 78968
153 Ga0209564_1002799 3300025295 Bacteria 12999
154 Ga0209050_1000095 3300025298 Bacteria 242722
155 Ga0209050_1000584 3300025298 Bacteria 59071
156 Ga0209050_1001426 3300025298 Bacteria 25794
157 Ga0209256_1005664 3300025299 Bacteria 7032
158 Ga0209256_1024239 3300025299 Bacteria 1790
159 Ga0209051_1001183 3300025303 Bacteria 23584
160 Ga0209257_1000106 3300025304 Bacteria 242634
161 Ga0209257_1001595 3300025304 Bacteria 25963
162 Ga0209257_1005570 3300025304 Bacteria 8760
163 Ga0207647_10022869 3300025904 Bacteria 4146
164 Ga0207705_10008259 3300025909 Bacteria 7609
165 Ga0207705_10184113 3300025909 Bacteria 1577
166 Ga0207654_10059012 3300025911 Bacteria 2236
167 Ga0207695_10001379 3300025913 Bacteria 41077
168 Ga0207695_10002462 3300025913 Bacteria 27332
169 Ga0207695_10004860 3300025913 Bacteria 18139
170 Ga0207695_10056450 3300025913 Bacteria 4085
171 Ga0207695_10116274 3300025913 Bacteria 2648
172 Ga0207695_10254425 3300025913 Bacteria 1655
173 Ga0207660_10016818 3300025917 Bacteria 4849
174 Ga0207660_10051773 3300025917 Bacteria 2920
175 Ga0207660_10148875 3300025917 Bacteria 1797
176 Ga0207662_10391997 3300025918 Bacteria 940
177 Ga0207657_10003963 3300025919 Bacteria 15722
178 Ga0207657_10046357 3300025919 Bacteria 3808
179 Ga0207657_10068026 3300025919 Bacteria 3027
180 Ga0207657_10517770 3300025919 Bacteria 934
181 Ga0207649_10554035 3300025920 Bacteria 880
182 Ga0207652_10007396 3300025921 Bacteria 8855
183 Ga0207681_10131239 3300025923 Bacteria 1853
184 Ga0207694_10158317 3300025924 Bacteria 1828
185 Ga0207694_10688938 3300025924 Bacteria 862
186 Ga0207650_10116285 3300025925 Bacteria 2077
187 Ga0207650_10259365 3300025925 Bacteria 1410
188 Ga0207644_10217717 3300025931 Bacteria 1512
189 Ga0207644_11229913 3300025931 Bacteria 629
190 Ga0207690_10000721 3300025932 Bacteria 21295
191 Ga0207690_10056777 3300025932 Bacteria 2642
192 Ga0207706_10209343 3300025933 Bacteria 1709
193 Ga0207686_10028536 3300025934 Bacteria 3282
194 Ga0207704_10021207 3300025938 Bacteria 3455
195 Ga0207711_10005253 3300025941 Bacteria 10980
196 Ga0207711_10006201 3300025941 Bacteria 10103
197 Ga0207711_10321228 3300025941 Bacteria 1431
198 Ga0207679_10041597 3300025945 Bacteria 3297
199 Ga0207679_10162650 3300025945 Bacteria 1829
200 Ga0207667_10013404 3300025949 Bacteria 9379
201 Ga0207667_10043017 3300025949 Bacteria 4796
202 Ga0207667_10163729 3300025949 Bacteria 2287
203 Ga0207667_10246038 3300025949 Bacteria 1830
204 Ga0207667_10948200 3300025949 Bacteria 850
205 Ga0207668_10001987 3300025972 Bacteria 11946
206 Ga0207668_10002033 3300025972 Bacteria 11801
207 Ga0207668_10187234 3300025972 Bacteria 1637
208 Ga0207640_10293933 3300025981 Bacteria 1282
209 Ga0207658_10171879 3300025986 Bacteria 1786
210 Ga0207703_10000049 3300026035 Bacteria 149817
211 Ga0207703_10030770 3300026035 Bacteria 4241
212 Ga0207639_10061509 3300026041 Bacteria 2901
213 Ga0207639_10486921 3300026041 Bacteria 1125
214 Ga0207639_10529852 3300026041 Bacteria 1079
215 Ga0207678_10000101 3300026067 Bacteria 70507
216 Ga0207708_10266981 3300026075 Bacteria 1383
217 Ga0207708_10433485 3300026075 Bacteria 1092
218 Ga0207708_10697532 3300026075 Bacteria 867
219 Ga0207702_10417110 3300026078 Bacteria 1297
220 Ga0207702_10740224 3300026078 Bacteria 970
221 Ga0207641_10000011 3300026088 Bacteria 384362
222 Ga0207641_10114400 3300026088 Bacteria 2397
223 Ga0207676_10000739 3300026095 Bacteria 25569
224 Ga0207676_10019096 3300026095 Bacteria 4995
225 Ga0207676_10136684 3300026095 Bacteria 2092
226 Ga0207676_10269342 3300026095 Bacteria 1542
227 Ga0207674_10186980 3300026116 Bacteria 2021
228 Ga0207675_100031205 3300026118 Bacteria 4963
229 Ga0207675_100148954 3300026118 Bacteria 2227
230 Ga0207698_10232326 3300026142 Bacteria 1675
231 Ga0207698_11119414 3300026142 Bacteria 800
232 Ga0209981_1001429 3300027378 Bacteria 3016
233 Ga0207428_10010757 3300027907 Bacteria 8160
234 Ga0268266_10000621 3300028379 Bacteria 48218
235 Ga0268266_10055286 3300028379 Bacteria 3412
236 Ga0268265_10008744 3300028380 Bacteria 6844
237 Ga0268265_10042312 3300028380 Bacteria 3379
238 Ga0268265_10065151 3300028380 Bacteria 2810
239 Ga0268265_10321637 3300028380 Bacteria 1401
240 Ga0268264_10000002 3300028381 Bacteria 1153045
241 Ga0268264_10040882 3300028381 Bacteria 3832
242 Ga0268264_10230984 3300028381 Bacteria 1708
243 Ga0268264_10597222 3300028381 Bacteria 1087
244 Ga0265337_1010051 3300028556 Bacteria 3337
245 Ga0265319_1024073 3300028563 Bacteria 2197
246 Ga0307517_10002263 3300028786 Bacteria 31025
247 Ga0307517_10037458 3300028786 Bacteria 5415
248 Ga0307515_10041864 3300028794 Bacteria 7187
249 Ga0307515_10068754 3300028794 Bacteria 4858
250 Ga0307511_10218015 3300030521 Bacteria 963
251 Ga0265320_10164525 3300031240 Bacteria 998
252 Ga0265331_10195860 3300031250 Bacteria 911
253 Ga0265327_10001380 3300031251 Bacteria 31060
254 Ga0265327_10002320 3300031251 Bacteria 20341
255 Ga0265327_10065134 3300031251 Bacteria 1844
256 Ga0307513_10000127 3300031456 Bacteria 107100
257 Ga0307513_10005398 3300031456 Bacteria 16908
258 Ga0307513_10006008 3300031456 Bacteria 15948
259 Ga0307513_10022294 3300031456 Bacteria 7448
260 Ga0307408_100769862 3300031548 Bacteria 871
261 Ga0307508_10254968 3300031616 Bacteria 1350
262 Ga0307516_10000001 3300031730 Bacteria 510338
263 Ga0307406_10842294 3300031901 Bacteria 777
264 Ga0307407_10355261 3300031903 Bacteria 1039
265 Ga0307407_10923165 3300031903 Bacteria 671
266 Ga0307412_10341554 3300031911 Bacteria 1199
267 Ga0307412_10346371 3300031911 Unclassified 1191
268 Ga0307411_10695977 3300032005 Bacteria 885
269 Ga0307415_101103179 3300032126 Bacteria 743
270 Ga0307510_10010349 3300033180 Bacteria 11077
271 Ga0373938_0033450 3300034957 Bacteria 1112
272 Ga0373928_0011830 3300035084 Bacteria 1734
273 Ga0373928_0100594 3300035084 Bacteria 753
274 Ga0373940_0032401 3300035088 Bacteria 1400
275 Ga0373944_0017015 3300035089 Bacteria 2058
276 Ga0373949_0014335 3300035090 Bacteria 1764
277 Ga0373952_0004126 3300035092 Bacteria 2625
278 Ga0373936_0010127 3300035113 Bacteria 3560
279 Ga0373960_0038567 3300035121 Bacteria 1370
280 Ga0373943_0332009 3300035170 Bacteria 868
281 Ga0373962_0008661 3300035242 Bacteria 2508
282 Ga0373962_0017799 3300035242 Bacteria 1844
283 Ga0373931_0001236 3300035691 Bacteria 10921
284 Ga0373935_0321375 3300035692 Bacteria 1098
285 Ga0373927_0001687 3300035695 Bacteria 16504
286 Ga0373927_0088035 3300035695 Bacteria 2016
287 Ga0373925_0000089 3300037068 Bacteria 98449
288 Ga0395905_0058274 3300037471 Bacteria 3612
289 Ga0395905_0552312 3300037471 Bacteria 1053
290 Ga0395901_0057916 3300038443 Bacteria 4030
291 Ga0395901_0273604 3300038443 Bacteria 1756
292 Ga0436365_0706118 3300039437 Bacteria 4548
293 Ga0436365_1521295 3300039437 Bacteria 1202
294 Ga0436361_1040436 3300039447 Bacteria 6464
295 Ga0439446_0001768 3300042156 Bacteria 5035
296 Ga0439435_0010130 3300042436 Bacteria 2229
297 Ga0466966_0317403 3300044684 Bacteria 936
298 Ga0466964_0169345 3300044706 Bacteria 1027
299 Ga0466964_0200141 3300044706 Bacteria 958
300 Ga0466960_0167240 3300044901 Bacteria 1185
301 Ga0466959_0056213 3300045049 Bacteria 2872
302 Ga0495627_000513 3300046453 Bacteria 32122
303 Ga0495590_0000309 3300046457 Bacteria 25577
304 Ga0495638_0000782 3300046460 Bacteria 33588
305 Ga0495638_0002789 3300046460 Bacteria 14025
306 Ga0495638_0006168 3300046460 Bacteria 8755
307 Ga0495638_0028472 3300046460 Bacteria 3607
308 Ga0495650_0113576 3300046471 Bacteria 1003
309 Ga0495585_0209027 3300046492 Bacteria 990
310 Ga0495583_0026122 3300046506 Bacteria 2902
311 Ga0495606_0102859 3300046507 Bacteria 1736
312 Ga0495610_0001981 3300046512 Bacteria 17476
313 Ga0495610_0002726 3300046512 Bacteria 14517
314 Ga0495616_0001022 3300046513 Bacteria 20016
315 Ga0495628_0084804 3300046516 Bacteria 2458
316 Ga0495631_0001982 3300046518 Bacteria 11977
317 Ga0495637_0071977 3300046520 Bacteria 1393
318 Ga0495643_0150994 3300046522 Bacteria 1150
319 Ga0495648_0000039 3300046524 Bacteria 185430
320 Ga0495642_0006363 3300046528 Bacteria 4525
321 Ga0495642_0041196 3300046528 Bacteria 1878
322 Ga0495652_0506838 3300046529 Bacteria 836
323 Ga0495587_0340430 3300046536 Bacteria 837
324 Ga0495609_0028061 3300046538 Bacteria 2570
325 Ga0495621_0183181 3300046539 Bacteria 837
326 Ga0495621_0208636 3300046539 Bacteria 788
327 Ga0495597_0001061 3300046542 Bacteria 20987
328 Ga0495668_0000221 3300046616 Bacteria 82680
329 Ga0495668_0008696 3300046616 Bacteria 6307
330 Ga0495668_0058663 3300046616 Bacteria 2124
331 Ga0495668_0064493 3300046616 Bacteria 2016
332 Ga0495668_0124997 3300046616 Bacteria 1408
333 Ga0495668_0282440 3300046616 Bacteria 909
334 Ga0495668_0489660 3300046616 Bacteria 677
335 Ga0495668_0505391 3300046616 Bacteria 666
336 Ga0495611_0022340 3300046648 Bacteria 2737
337 Ga0495625_0000034 3300046660 Bacteria 225120
338 Ga0495625_0087248 3300046660 Bacteria 2163
339 Ga0495625_0142100 3300046660 Bacteria 1618
340 Ga0495625_0253950 3300046660 Bacteria 1140
341 Ga0495659_0039063 3300046664 Bacteria 1687
342 Ga0495669_0000002 3300046684 Bacteria 282777
343 Ga0495669_0000317 3300046684 Bacteria 26674
344 Ga0495669_0002819 3300046684 Bacteria 7129
345 Ga0495669_0112053 3300046684 Bacteria 1274
346 Ga0495613_0001433 3300046689 Bacteria 18206
347 Ga0495589_0185232 3300046794 Bacteria 986
348 Ga0495660_0011161 3300046810 Bacteria 5217
349 Ga0495674_0184948 3300047319 Bacteria 1734
350 Ga0495672_0000778 3300047320 Bacteria 34618
351 Ga0495687_104978 3300047443 Bacteria 1051
352 Ga0495677_0006171 3300047445 Bacteria 4528
353 Ga0495677_0012380 3300047445 Bacteria 3112
354 Ga0495677_0012403 3300047445 Bacteria 3109
355 Ga0495679_003359 3300047446 Bacteria 7727
356 Ga0495673_0000223 3300047469 Bacteria 84150
357 Ga0495673_0001949 3300047469 Bacteria 15315
358 Ga0495673_0194278 3300047469 Bacteria 762
359 Ga0495686_0001197 3300047472 Bacteria 29986
360 Ga0495686_0031613 3300047472 Bacteria 3431
361 Ga0496100_0510224 3300048903 Bacteria 927
362 Ga0496101_0430426 3300048904 Bacteria 1040
363 Ga0496102_0044272 3300048905 Bacteria 4039
364 Ga0496102_0138713 3300048905 Bacteria 2279
365 Ga0496102_0228999 3300048905 Bacteria 1752
366 Ga0496103_0160935 3300048906 Bacteria 1440
367 Ga0496106_0357863 3300048909 Bacteria 1172
368 Ga0496107_0000029 3300048910 Bacteria 102345
369 Ga0496109_0036566 3300048912 Bacteria 4433
370 Ga0496109_0146299 3300048912 Bacteria 2211
371 Ga0496110_0007268 3300048913 Bacteria 8829
372 Ga0496110_0397169 3300048913 Bacteria 1257
373 Ga0496111_0030793 3300048914 Bacteria 3817
374 Ga0496111_0246494 3300048914 Bacteria 1326
375 Ga0496112_0017333 3300048915 Bacteria 6765
376 Ga0496112_0061990 3300048915 Bacteria 3688
377 Ga0496112_0248011 3300048915 Bacteria 1732
378 Ga0496112_0558968 3300048915 Bacteria 1078
379 Ga0496112_1188071 3300048915 Bacteria 680
380 Ga0496113_0729097 3300048916 Bacteria 790
381 Ga0496115_0000771 3300048918 Bacteria 23514
382 Ga0496115_0007037 3300048918 Bacteria 8265
383 Ga0496115_0027262 3300048918 Bacteria 4467
384 Ga0496115_0751946 3300048918 Bacteria 762
385 Ga0496116_0134897 3300048919 Bacteria 1400
386 Ga0496117_0007978 3300048920 Bacteria 10167
387 Ga0496118_0010336 3300048921 Bacteria 9251
388 Ga0496121_0000397 3300048924 Bacteria 87422
389 Ga0496121_0006516 3300048924 Bacteria 14437
390 Ga0496121_0065129 3300048924 Bacteria 2967
391 Ga0496121_0226863 3300048924 Bacteria 1311
392 Ga0496125_0212402 3300048928 Bacteria 1255
393 Ga0496126_0289480 3300048929 Bacteria 1355
394 Ga0496126_0414284 3300048929 Bacteria 1090
395 Ga0496126_0888096 3300048929 Bacteria 677
396 Ga0495678_000773 3300049459 Bacteria 28865
397 Ga0495682_0071270 3300049460 Bacteria 1251
398 Ga0501033_0599339 3300049570 Bacteria 756
399 Ga0501034_0075750 3300049571 Bacteria 3371
400 Ga0501038_0528512 3300049574 Bacteria 899
401 Ga0501039_0109899 3300049575 Bacteria 2155
402 Ga0501039_0259693 3300049575 Bacteria 1365
403 Ga0501039_0276945 3300049575 Bacteria 1319
404 Ga0501040_0234622 3300049576 Bacteria 1307
405 Ga0501041_0138876 3300049577 Bacteria 1515
406 Ga0501046_0039248 3300049580 Bacteria 3793
407 Ga0501046_0265837 3300049580 Bacteria 1259
408 Ga0501047_0001352 3300049581 Bacteria 24079
409 Ga0501047_0001827 3300049581 Bacteria 20573
410 Ga0501047_0091648 3300049581 Bacteria 2918
411 Ga0501047_0313823 3300049581 Bacteria 1408
412 Ga0501048_0090698 3300049582 Bacteria 2156
413 Ga0501068_0467188 3300049584 Bacteria 817
414 Ga0501068_0468115 3300049584 Bacteria 816
415 Ga0501070_0080286 3300049586 Bacteria 2699
416 Ga0501071_0349566 3300049587 Bacteria 1125
417 Ga0501072_0048835 3300049588 Bacteria 3331
418 Ga0501072_0095088 3300049588 Bacteria 2368
419 Ga0501072_0199399 3300049588 Bacteria 1596
420 Ga0501072_0398834 3300049588 Bacteria 1091
421 Ga0501073_0059724 3300049589 Bacteria 2662
422 Ga0501073_0349407 3300049589 Bacteria 1021
423 Ga0501073_0510956 3300049589 Bacteria 831
424 Ga0501076_0089577 3300049592 Bacteria 2473
425 Ga0501076_0657026 3300049592 Bacteria 865
426 Ga0501076_0851396 3300049592 Bacteria 752
427 Ga0501079_0899469 3300049741 Bacteria 697
428 Ga0501080_0006464 3300049742 Bacteria 10525
429 Ga0501080_0010727 3300049742 Bacteria 8381
430 Ga0501081_0018566 3300049743 Bacteria 4621
431 Ga0501081_0181751 3300049743 Bacteria 1521
432 Ga0501081_0365756 3300049743 Bacteria 1064
433 Ga0501081_0911524 3300049743 Bacteria 663
434 Ga0501083_0002798 3300049744 Bacteria 12050
435 Ga0501083_0102287 3300049744 Bacteria 1889
436 Ga0501035_0614645 3300049822 Bacteria 884
437 Ga0501035_0665376 3300049822 Bacteria 843
438 Ga0501044_0326402 3300049823 Unclassified 1458
439 Ga0501045_0095419 3300049824 Bacteria 2200
440 nmdc:mga07m45_134555_c1 3300050496 Bacteria 1430
441 nmdc:mga05p37_74423_c1 3300050507 Bacteria 4180
442 nmdc:mga05p37_929376_c1 3300050507 Bacteria 934
443 nmdc:mga09592_132006_c1 3300050508 Bacteria 2149
444 nmdc:mga09592_6522_c2 3300050508 Bacteria 7610
445 nmdc:mga09592_716428_c1 3300050508 Bacteria 851
446 nmdc:mga0qj67_416040_c1 3300050509 Bacteria 1084
447 nmdc:mga06r32_120185_c1 3300050510 Bacteria 2591
448 nmdc:mga06r32_36778_c1 3300050510 Bacteria 4629
449 nmdc:mga06r32_579677_c1 3300050510 Bacteria 1094
450 nmdc:mga06r32_82932_c1 3300050510 Bacteria 3124
451 nmdc:mga08y16_112215_c1 3300050511 Bacteria 2838
452 nmdc:mga08y16_144719_c1 3300050511 Bacteria 2471
453 nmdc:mga0n895_3101_c1 3300050512 Bacteria 13235
454 nmdc:mga0a205_3468_c1 3300050515 Bacteria 14083
455 Ga0500578_0001117 3300053086 Bacteria 28820
456 Ga0500578_0464524 3300053086 Bacteria 718
457 Ga0500643_003852 3300053087 Bacteria 6984
458 Ga0500643_020813 3300053087 Bacteria 2136
459 Ga0500644_0000822 3300053088 Bacteria 10480
460 Ga0500644_0048316 3300053088 Bacteria 1447
461 Ga0500647_0076122 3300053091 Bacteria 1610
462 Ga0500651_0380679 3300053093 Bacteria 796
463 Ga0500554_104451 3300053102 Bacteria 949
464 Ga0500572_000561 3300053111 Bacteria 12671
465 Ga0500594_0000093 3300053118 Bacteria 27296
466 Ga0500595_057501 3300053119 Bacteria 1185
467 Ga0500608_000188 3300053122 Bacteria 24796
468 Ga0500608_002326 3300053122 Bacteria 6896
469 Ga0500608_117025 3300053122 Bacteria 1214
470 Ga0500614_021634 3300053123 Bacteria 1494
471 Ga0500618_000152 3300053125 Bacteria 57055
472 Ga0500642_0088580 3300053130 Bacteria 1429
473 Ga0500652_034298 3300053131 Bacteria 2010
474 Ga0500655_068862 3300053133 Bacteria 720
475 Ga0500559_0000054 3300053136 Bacteria 90695
476 Ga0500559_0002200 3300053136 Bacteria 10307
477 Ga0500559_0004821 3300053136 Bacteria 6301
478 Ga0500564_000094 3300053138 Bacteria 22644
479 Ga0500590_054907 3300053148 Bacteria 2016
480 Ga0500622_0001162 3300053156 Bacteria 21873
481 Ga0501084_0010424 3300054114 Bacteria 7684
482 Ga0501084_0057061 3300054114 Bacteria 3268
483 Ga0501084_0432981 3300054114 Bacteria 1112
484 Ga0501082_0003782 3300060353 Bacteria 13228
485 Ga0501082_0009285 3300060353 Bacteria 8477
486 Ga0501082_0077766 3300060353 Bacteria 2861
487 Ga0501082_0245384 3300060353 Bacteria 1559
488 Ga0501082_0245403 3300060353 Bacteria 1558
489 Ga0501082_0415192 3300060353 Bacteria 1175
490 Ga0530510_0048406 3300061734 Bacteria 3073
491 Ga0530510_0215322 3300061734 Bacteria 1427
492 Ga0530510_0245248 3300061734 Bacteria 1334

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100012456 Ga0068862_1000124562 172
2 3300006880 Ga0075429_100134798 Ga0075429_1001347983 172
3 3300028380 Ga0268265_10065151 Ga0268265_100651513 172
4 3300050508 nmdc:mga09592_132006_c1 nmdc:mga09592_132006_c1_1519_2073 172
5 3300039447 Ga0436361_1040436 Ga0436361_1040436_4715_5245 173
6 3300046538 Ga0495609_0028061 Ga0495609_0028061_643_1179 174
7 3300049581 Ga0501047_0313823 Ga0501047_0313823_795_1325 174
8 3300006038 Ga0075365_10379122 Ga0075365_103791222 179
9 3300010375 Ga0105239_10229224 Ga0105239_102292242 180
10 iso_pu_bacteria 2510917020 2511121917 181
11 iso_pu_bacteria 2582581279 2585148282 181
12 iso_pu_bacteria 2582581280 2585150970 181
13 iso_pu_bacteria 2582581293 2585196369 181
14 iso_pu_bacteria 2585428106 2587919184 181
15 iso_pu_bacteria 2643221583 2643926982 181
16 iso_pu_bacteria 2643221598 2643998829 181
17 iso_pu_bacteria 2643221614 2644087142 181
18 iso_pu_bacteria 2643221640 2644227409 181
19 iso_pu_bacteria 2643221642 2644237072 181
20 iso_pu_bacteria 2643221661 2644342096 181
21 iso_pu_bacteria 2643221666 2644368383 181
22 iso_pu_bacteria 2791355048 2792461282 181
23 iso_pu_bacteria 2843744320 2843745352 181
24 iso_pu_bacteria 2849560528 2849564632 181
25 iso_pu_bacteria 2849573788 2849577738 181
26 iso_pu_bacteria 2851153111 2851155635 181
27 iso_pu_bacteria 2857504554 2857508426 181
28 iso_pu_bacteria 2884960567 2884961228 181
29 iso_pu_bacteria 2898329390 2898331105 181
30 iso_pu_bacteria 2928531327 2928534551 181
31 3300005844 Ga0068862_100496876 Ga0068862_1004968761 184
32 3300005937 Ga0081455_10093505 Ga0081455_100935054 184
33 3300006846 Ga0075430_100462244 Ga0075430_1004622442 184
34 3300009553 Ga0105249_10104794 Ga0105249_101047943 184
35 3300031901 Ga0307406_10842294 Ga0307406_108422941 184
36 3300031903 Ga0307407_10923165 Ga0307407_109231652 184
37 3300035084 Ga0373928_0100594 Ga0373928_0100594_73_633 184
38 3300035242 Ga0373962_0017799 Ga0373962_0017799_509_1069 184
39 3300047469 Ga0495673_0194278 Ga0495673_0194278_20_580 184
40 3300049581 Ga0501047_0001352 Ga0501047_0001352_6449_7054 184
41 3300049589 Ga0501073_0059724 Ga0501073_0059724_785_1510 184
42 3300049742 Ga0501080_0006464 Ga0501080_0006464_4443_5003 184
43 3300049744 Ga0501083_0002798 Ga0501083_0002798_11115_11675 184
44 3300050509 nmdc:mga0qj67_416040_c1 nmdc:mga0qj67_416040_c1_354_914 184
45 3300060353 Ga0501082_0003782 Ga0501082_0003782_2231_2791 184
46 3300003781 Ga0055536_1001003 Ga0055536_100100313 185
47 3300003791 Ga0055530_10000337 Ga0055530_1000033738 185
48 3300003791 Ga0055530_10001846 Ga0055530_100018465 185
49 3300003791 Ga0055530_10003612 Ga0055530_100036127 185
50 3300003794 Ga0055531_10000820 Ga0055531_1000082013 185
51 3300003794 Ga0055531_10001142 Ga0055531_1000114213 185
52 3300004625 Ga0055543_1024023 Ga0055543_10240232 185
53 3300005262 Ga0065165_1000171 Ga0065165_100017118 185
54 3300005327 Ga0070658_10214714 Ga0070658_102147143 185
55 3300005327 Ga0070658_10378802 Ga0070658_103788022 185
56 3300005331 Ga0070670_100145858 Ga0070670_1001458583 185
57 3300005331 Ga0070670_100155670 Ga0070670_1001556702 185
58 3300005331 Ga0070670_100293181 Ga0070670_1002931812 185
59 3300005335 Ga0070666_10194976 Ga0070666_101949762 185
60 3300005336 Ga0070680_100018418 Ga0070680_1000184188 185
61 3300005336 Ga0070680_100037522 Ga0070680_1000375222 185
62 3300005337 Ga0070682_100385777 Ga0070682_1003857772 185
63 3300005339 Ga0070660_100074290 Ga0070660_1000742902 185
64 3300005341 Ga0070691_10012514 Ga0070691_100125143 185
65 3300005343 Ga0070687_100263958 Ga0070687_1002639582 185
66 3300005344 Ga0070661_100100169 Ga0070661_1001001692 185
67 3300005347 Ga0070668_100025547 Ga0070668_1000255475 185
68 3300005347 Ga0070668_100063153 Ga0070668_1000631533 185
69 3300005355 Ga0070671_100014187 Ga0070671_1000141879 185
70 3300005355 Ga0070671_100367153 Ga0070671_1003671532 185
71 3300005355 Ga0070671_101357076 Ga0070671_1013570761 185
72 3300005366 Ga0070659_100000572 Ga0070659_10000057216 185
73 3300005366 Ga0070659_100012877 Ga0070659_1000128773 185
74 3300005367 Ga0070667_100010707 Ga0070667_1000107075 185
75 3300005440 Ga0070705_100536724 Ga0070705_1005367241 185
76 3300005456 Ga0070678_100029073 Ga0070678_1000290731 185
77 3300005457 Ga0070662_100174784 Ga0070662_1001747842 185
78 3300005539 Ga0068853_100092445 Ga0068853_1000924452 185
79 3300005539 Ga0068853_100595447 Ga0068853_1005954472 185
80 3300005543 Ga0070672_100585561 Ga0070672_1005855612 185
81 3300005548 Ga0070665_100000622 Ga0070665_10000062231 185
82 3300005548 Ga0070665_100075069 Ga0070665_1000750693 185
83 3300005563 Ga0068855_100055347 Ga0068855_1000553473 185
84 3300005563 Ga0068855_100209297 Ga0068855_1002092973 185
85 3300005563 Ga0068855_100243925 Ga0068855_1002439253 185
86 3300005564 Ga0070664_100214143 Ga0070664_1002141432 185
87 3300005578 Ga0068854_100326935 Ga0068854_1003269352 185
88 3300005614 Ga0068856_100494539 Ga0068856_1004945392 185
89 3300005616 Ga0068852_101100624 Ga0068852_1011006242 185
90 3300005617 Ga0068859_100013721 Ga0068859_1000137216 185
91 3300005618 Ga0068864_100008710 Ga0068864_1000087109 185
92 3300005618 Ga0068864_100075368 Ga0068864_1000753682 185
93 3300005618 Ga0068864_100529412 Ga0068864_1005294122 185
94 3300005719 Ga0068861_100051839 Ga0068861_1000518394 185
95 3300005719 Ga0068861_100257978 Ga0068861_1002579782 185
96 3300005841 Ga0068863_100000045 Ga0068863_1000000458 185
97 3300005841 Ga0068863_100026291 Ga0068863_1000262913 185
98 3300005841 Ga0068863_100049914 Ga0068863_1000499145 185
99 3300005842 Ga0068858_100109610 Ga0068858_1001096102 185
100 3300005843 Ga0068860_100028753 Ga0068860_1000287533 185
101 3300005843 Ga0068860_100177028 Ga0068860_1001770282 185
102 3300005843 Ga0068860_100244402 Ga0068860_1002444022 185
103 3300005844 Ga0068862_100008821 Ga0068862_1000088213 185
104 3300005844 Ga0068862_100030139 Ga0068862_1000301394 185
105 3300005937 Ga0081455_10000022 Ga0081455_10000022134 185
106 3300006028 Ga0070717_10168089 Ga0070717_101680892 185
107 3300006028 Ga0070717_10529217 Ga0070717_105292172 185
108 3300006058 Ga0075432_10046497 Ga0075432_100464972 185
109 3300006186 Ga0075369_10003307 Ga0075369_100033074 185
110 3300006353 Ga0075370_10049315 Ga0075370_100493152 185
111 3300006844 Ga0075428_100075472 Ga0075428_1000754726 185
112 3300006844 Ga0075428_100466011 Ga0075428_1004660112 185
113 3300006847 Ga0075431_100006746 Ga0075431_1000067468 185
114 3300006847 Ga0075431_100021213 Ga0075431_1000212132 185
115 3300006847 Ga0075431_100056098 Ga0075431_1000560983 185
116 3300006847 Ga0075431_100730527 Ga0075431_1007305272 185
117 3300006847 Ga0075431_100781980 Ga0075431_1007819801 185
118 3300006852 Ga0075433_10002806 Ga0075433_1000280614 185
119 3300006871 Ga0075434_100000682 Ga0075434_1000006829 185
120 3300006880 Ga0075429_100062430 Ga0075429_1000624302 185
121 3300006880 Ga0075429_100139804 Ga0075429_1001398044 185
122 3300006880 Ga0075429_100146387 Ga0075429_1001463872 185
123 3300006880 Ga0075429_100898724 Ga0075429_1008987241 185
124 3300006881 Ga0068865_100017815 Ga0068865_1000178154 185
125 3300006931 Ga0097620_100013721 Ga0097620_1000137216 185
126 3300006931 Ga0097620_100107052 Ga0097620_1001070522 185
127 3300009092 Ga0105250_10241620 Ga0105250_102416202 185
128 3300009093 Ga0105240_10003686 Ga0105240_1000368620 185
129 3300009093 Ga0105240_10064756 Ga0105240_100647565 185
130 3300009093 Ga0105240_10121519 Ga0105240_101215192 185
131 3300009093 Ga0105240_10242094 Ga0105240_102420942 185
132 3300009093 Ga0105240_10256190 Ga0105240_102561902 185
133 3300009093 Ga0105240_10308820 Ga0105240_103088202 185
134 3300009094 Ga0111539_10006439 Ga0111539_100064391 185
135 3300009094 Ga0111539_10009047 Ga0111539_1000904715 185
136 3300009094 Ga0111539_10023642 Ga0111539_100236423 185
137 3300009098 Ga0105245_10736653 Ga0105245_107366532 185
138 3300009101 Ga0105247_10378016 Ga0105247_103780161 185
139 3300009147 Ga0114129_10062433 Ga0114129_100624333 185
140 3300009147 Ga0114129_10092906 Ga0114129_100929062 185
141 3300009147 Ga0114129_10450331 Ga0114129_104503312 185
142 3300009174 Ga0105241_10323671 Ga0105241_103236712 185
143 3300009177 Ga0105248_10007277 Ga0105248_100072777 185
144 3300009177 Ga0105248_10021669 Ga0105248_100216694 185
145 3300009177 Ga0105248_10124089 Ga0105248_101240893 185
146 3300009177 Ga0105248_10611401 Ga0105248_106114012 185
147 3300009177 Ga0105248_10651147 Ga0105248_106511471 185
148 3300009545 Ga0105237_10850969 Ga0105237_108509692 185
149 3300009551 Ga0105238_10017608 Ga0105238_100176087 185
150 3300009551 Ga0105238_10097266 Ga0105238_100972662 185
151 3300009551 Ga0105238_10104420 Ga0105238_101044203 185
152 3300009551 Ga0105238_10774850 Ga0105238_107748502 185
153 3300013100 Ga0157373_10003319 Ga0157373_100033195 185
154 3300013100 Ga0157373_10013230 Ga0157373_100132303 185
155 3300013104 Ga0157370_10245057 Ga0157370_102450572 185
156 3300013105 Ga0157369_10443148 Ga0157369_104431482 185
157 3300013306 Ga0163162_10449121 Ga0163162_104491212 185
158 3300013306 Ga0163162_11031732 Ga0163162_110317322 185
159 3300013308 Ga0157375_10288392 Ga0157375_102883922 185
160 3300013308 Ga0157375_10291033 Ga0157375_102910332 185
161 3300014325 Ga0163163_10004247 Ga0163163_1000424710 185
162 3300014325 Ga0163163_11429630 Ga0163163_114296302 185
163 3300014968 Ga0157379_10261577 Ga0157379_102615772 185
164 3300015262 Ga0182007_10191322 Ga0182007_101913221 185
165 3300021361 Ga0213872_10159098 Ga0213872_101590982 185
166 3300021384 Ga0213876_10158935 Ga0213876_101589352 185
167 3300021384 Ga0213876_10212558 Ga0213876_102125581 185
168 3300025292 Ga0209676_1000319 Ga0209676_100031923 185
169 3300025292 Ga0209676_1000401 Ga0209676_100040160 185
170 3300025295 Ga0209564_1002799 Ga0209564_100279911 185
171 3300025298 Ga0209050_1000095 Ga0209050_1000095224 185
172 3300025298 Ga0209050_1000584 Ga0209050_100058414 185
173 3300025298 Ga0209050_1001426 Ga0209050_100142617 185
174 3300025299 Ga0209256_1005664 Ga0209256_10056642 185
175 3300025299 Ga0209256_1024239 Ga0209256_10242392 185
176 3300025303 Ga0209051_1001183 Ga0209051_100118316 185
177 3300025304 Ga0209257_1000106 Ga0209257_100010629 185
178 3300025304 Ga0209257_1001595 Ga0209257_100159513 185
179 3300025304 Ga0209257_1005570 Ga0209257_10055704 185
180 3300025909 Ga0207705_10008259 Ga0207705_100082595 185
181 3300025909 Ga0207705_10184113 Ga0207705_101841133 185
182 3300025913 Ga0207695_10001379 Ga0207695_100013792 185
183 3300025913 Ga0207695_10002462 Ga0207695_1000246217 185
184 3300025913 Ga0207695_10004860 Ga0207695_100048603 185
185 3300025913 Ga0207695_10056450 Ga0207695_100564503 185
186 3300025913 Ga0207695_10116274 Ga0207695_101162742 185
187 3300025913 Ga0207695_10254425 Ga0207695_102544252 185
188 3300025917 Ga0207660_10016818 Ga0207660_100168187 185
189 3300025917 Ga0207660_10051773 Ga0207660_100517734 185
190 3300025917 Ga0207660_10148875 Ga0207660_101488752 185
191 3300025918 Ga0207662_10391997 Ga0207662_103919972 185
192 3300025919 Ga0207657_10003963 Ga0207657_1000396314 185
193 3300025919 Ga0207657_10046357 Ga0207657_100463573 185
194 3300025919 Ga0207657_10517770 Ga0207657_105177702 185
195 3300025921 Ga0207652_10007396 Ga0207652_100073962 185
196 3300025923 Ga0207681_10131239 Ga0207681_101312392 185
197 3300025924 Ga0207694_10688938 Ga0207694_106889382 185
198 3300025925 Ga0207650_10116285 Ga0207650_101162853 185
199 3300025925 Ga0207650_10259365 Ga0207650_102593652 185
200 3300025931 Ga0207644_10217717 Ga0207644_102177171 185
201 3300025931 Ga0207644_11229913 Ga0207644_112299131 185
202 3300025932 Ga0207690_10000721 Ga0207690_100007216 185
203 3300025933 Ga0207706_10209343 Ga0207706_102093432 185
204 3300025934 Ga0207686_10028536 Ga0207686_100285362 185
205 3300025938 Ga0207704_10021207 Ga0207704_100212072 185
206 3300025941 Ga0207711_10005253 Ga0207711_100052538 185
207 3300025941 Ga0207711_10006201 Ga0207711_100062014 185
208 3300025941 Ga0207711_10321228 Ga0207711_103212282 185
209 3300025945 Ga0207679_10041597 Ga0207679_100415974 185
210 3300025949 Ga0207667_10013404 Ga0207667_100134042 185
211 3300025949 Ga0207667_10043017 Ga0207667_100430175 185
212 3300025949 Ga0207667_10163729 Ga0207667_101637291 185
213 3300025949 Ga0207667_10246038 Ga0207667_102460382 185
214 3300025972 Ga0207668_10001987 Ga0207668_100019875 185
215 3300025972 Ga0207668_10002033 Ga0207668_100020331 185
216 3300025972 Ga0207668_10187234 Ga0207668_101872343 185
217 3300025981 Ga0207640_10293933 Ga0207640_102939332 185
218 3300025986 Ga0207658_10171879 Ga0207658_101718793 185
219 3300026035 Ga0207703_10000049 Ga0207703_1000004920 185
220 3300026041 Ga0207639_10061509 Ga0207639_100615092 185
221 3300026041 Ga0207639_10486921 Ga0207639_104869212 185
222 3300026041 Ga0207639_10529852 Ga0207639_105298522 185
223 3300026075 Ga0207708_10697532 Ga0207708_106975321 185
224 3300026078 Ga0207702_10417110 Ga0207702_104171102 185
225 3300026078 Ga0207702_10740224 Ga0207702_107402241 185
226 3300026088 Ga0207641_10000011 Ga0207641_10000011152 185
227 3300026088 Ga0207641_10114400 Ga0207641_101144002 185
228 3300026095 Ga0207676_10000739 Ga0207676_100007399 185
229 3300026095 Ga0207676_10019096 Ga0207676_100190962 185
230 3300026095 Ga0207676_10136684 Ga0207676_101366843 185
231 3300026116 Ga0207674_10186980 Ga0207674_101869801 185
232 3300026118 Ga0207675_100031205 Ga0207675_1000312053 185
233 3300026118 Ga0207675_100148954 Ga0207675_1001489542 185
234 3300026142 Ga0207698_11119414 Ga0207698_111194142 185
235 3300027378 Ga0209981_1001429 Ga0209981_10014295 185
236 3300027907 Ga0207428_10010757 Ga0207428_100107573 185
237 3300028379 Ga0268266_10000621 Ga0268266_1000062131 185
238 3300028379 Ga0268266_10055286 Ga0268266_100552865 185
239 3300028380 Ga0268265_10008744 Ga0268265_100087444 185
240 3300028380 Ga0268265_10042312 Ga0268265_100423122 185
241 3300028380 Ga0268265_10321637 Ga0268265_103216372 185
242 3300028381 Ga0268264_10000002 Ga0268264_10000002106 185
243 3300028381 Ga0268264_10040882 Ga0268264_100408821 185
244 3300028381 Ga0268264_10230984 Ga0268264_102309842 185
245 3300028381 Ga0268264_10597222 Ga0268264_105972222 185
246 3300028556 Ga0265337_1010051 Ga0265337_10100512 185
247 3300028563 Ga0265319_1024073 Ga0265319_10240733 185
248 3300028786 Ga0307517_10002263 Ga0307517_1000226315 185
249 3300028786 Ga0307517_10037458 Ga0307517_100374582 185
250 3300028794 Ga0307515_10041864 Ga0307515_100418645 185
251 3300028794 Ga0307515_10068754 Ga0307515_100687543 185
252 3300030521 Ga0307511_10218015 Ga0307511_102180152 185
253 3300031240 Ga0265320_10164525 Ga0265320_101645252 185
254 3300031250 Ga0265331_10195860 Ga0265331_101958602 185
255 3300031251 Ga0265327_10001380 Ga0265327_100013805 185
256 3300031251 Ga0265327_10002320 Ga0265327_100023208 185
257 3300031251 Ga0265327_10065134 Ga0265327_100651342 185
258 3300031456 Ga0307513_10000127 Ga0307513_1000012716 185
259 3300031456 Ga0307513_10005398 Ga0307513_100053987 185
260 3300031456 Ga0307513_10022294 Ga0307513_100222947 185
261 3300031548 Ga0307408_100769862 Ga0307408_1007698621 185
262 3300031616 Ga0307508_10254968 Ga0307508_102549682 185
263 3300031730 Ga0307516_10000001 Ga0307516_10000001293 185
264 3300031911 Ga0307412_10346371 Ga0307412_103463711 185
265 3300033180 Ga0307510_10010349 Ga0307510_100103492 185
266 3300034957 Ga0373938_0033450 Ga0373938_0033450_288_857 185
267 3300035084 Ga0373928_0011830 Ga0373928_0011830_404_973 185
268 3300035088 Ga0373940_0032401 Ga0373940_0032401_504_1073 185
269 3300035089 Ga0373944_0017015 Ga0373944_0017015_1296_1880 185
270 3300035090 Ga0373949_0014335 Ga0373949_0014335_873_1442 185
271 3300035092 Ga0373952_0004126 Ga0373952_0004126_1271_1840 185
272 3300035113 Ga0373936_0010127 Ga0373936_0010127_1252_1821 185
273 3300035121 Ga0373960_0038567 Ga0373960_0038567_534_1103 185
274 3300035170 Ga0373943_0332009 Ga0373943_0332009_167_736 185
275 3300035242 Ga0373962_0008661 Ga0373962_0008661_747_1316 185
276 3300035691 Ga0373931_0001236 Ga0373931_0001236_8448_9017 185
277 3300035692 Ga0373935_0321375 Ga0373935_0321375_448_1017 185
278 3300035695 Ga0373927_0001687 Ga0373927_0001687_7890_8474 185
279 3300035695 Ga0373927_0088035 Ga0373927_0088035_790_1359 185
280 3300037068 Ga0373925_0000089 Ga0373925_0000089_70072_70656 185
281 3300037471 Ga0395905_0058274 Ga0395905_0058274_1419_1988 185
282 3300038443 Ga0395901_0057916 Ga0395901_0057916_2762_3331 185
283 3300038443 Ga0395901_0273604 Ga0395901_0273604_319_882 185
284 3300039437 Ga0436365_0706118 Ga0436365_0706118_3397_3966 185
285 3300039437 Ga0436365_1521295 Ga0436365_1521295_204_773 185
286 3300042156 Ga0439446_0001768 Ga0439446_0001768_1845_2411 185
287 3300042436 Ga0439435_0010130 Ga0439435_0010130_1461_2027 185
288 3300044684 Ga0466966_0317403 Ga0466966_0317403_239_805 185
289 3300044706 Ga0466964_0169345 Ga0466964_0169345_39_608 185
290 3300044706 Ga0466964_0200141 Ga0466964_0200141_250_816 185
291 3300044901 Ga0466960_0167240 Ga0466960_0167240_289_855 185
292 3300045049 Ga0466959_0056213 Ga0466959_0056213_2177_2743 185
293 3300046453 Ga0495627_000513 Ga0495627_000513_20964_21527 185
294 3300046457 Ga0495590_0000309 Ga0495590_0000309_14216_14782 185
295 3300046460 Ga0495638_0000782 Ga0495638_0000782_11746_12312 185
296 3300046460 Ga0495638_0002789 Ga0495638_0002789_4947_5510 185
297 3300046460 Ga0495638_0006168 Ga0495638_0006168_7582_8145 185
298 3300046460 Ga0495638_0028472 Ga0495638_0028472_1613_2179 185
299 3300046492 Ga0495585_0209027 Ga0495585_0209027_118_693 185
300 3300046506 Ga0495583_0026122 Ga0495583_0026122_2111_2686 185
301 3300046507 Ga0495606_0102859 Ga0495606_0102859_1135_1698 185
302 3300046512 Ga0495610_0001981 Ga0495610_0001981_5044_5607 185
303 3300046512 Ga0495610_0002726 Ga0495610_0002726_11350_11916 185
304 3300046513 Ga0495616_0001022 Ga0495616_0001022_15482_16045 185
305 3300046516 Ga0495628_0084804 Ga0495628_0084804_633_1238 185
306 3300046518 Ga0495631_0001982 Ga0495631_0001982_5791_6357 185
307 3300046520 Ga0495637_0071977 Ga0495637_0071977_212_781 185
308 3300046522 Ga0495643_0150994 Ga0495643_0150994_100_669 185
309 3300046524 Ga0495648_0000039 Ga0495648_0000039_6543_7109 185
310 3300046528 Ga0495642_0006363 Ga0495642_0006363_1799_2368 185
311 3300046528 Ga0495642_0041196 Ga0495642_0041196_95_664 185
312 3300046529 Ga0495652_0506838 Ga0495652_0506838_188_796 185
313 3300046536 Ga0495587_0340430 Ga0495587_0340430_222_809 185
314 3300046539 Ga0495621_0208636 Ga0495621_0208636_137_712 185
315 3300046542 Ga0495597_0001061 Ga0495597_0001061_5925_6494 185
316 3300046616 Ga0495668_0000221 Ga0495668_0000221_55137_55700 185
317 3300046616 Ga0495668_0008696 Ga0495668_0008696_5360_5926 185
318 3300046616 Ga0495668_0058663 Ga0495668_0058663_1455_2027 185
319 3300046616 Ga0495668_0064493 Ga0495668_0064493_328_897 185
320 3300046616 Ga0495668_0124997 Ga0495668_0124997_827_1396 185
321 3300046616 Ga0495668_0282440 Ga0495668_0282440_54_617 185
322 3300046616 Ga0495668_0489660 Ga0495668_0489660_94_663 185
323 3300046616 Ga0495668_0505391 Ga0495668_0505391_85_654 185
324 3300046648 Ga0495611_0022340 Ga0495611_0022340_1764_2333 185
325 3300046660 Ga0495625_0000034 Ga0495625_0000034_8805_9371 185
326 3300046660 Ga0495625_0087248 Ga0495625_0087248_1139_1714 185
327 3300046660 Ga0495625_0142100 Ga0495625_0142100_545_1108 185
328 3300046660 Ga0495625_0253950 Ga0495625_0253950_189_764 185
329 3300046664 Ga0495659_0039063 Ga0495659_0039063_184_747 185
330 3300046684 Ga0495669_0000002 Ga0495669_0000002_25369_25938 185
331 3300046684 Ga0495669_0000317 Ga0495669_0000317_4571_5140 185
332 3300046684 Ga0495669_0002819 Ga0495669_0002819_4911_5480 185
333 3300046684 Ga0495669_0112053 Ga0495669_0112053_549_1118 185
334 3300046689 Ga0495613_0001433 Ga0495613_0001433_8556_9164 185
335 3300046794 Ga0495589_0185232 Ga0495589_0185232_23_586 185
336 3300046810 Ga0495660_0011161 Ga0495660_0011161_2031_2594 185
337 3300047319 Ga0495674_0184948 Ga0495674_0184948_606_1211 185
338 3300047320 Ga0495672_0000778 Ga0495672_0000778_32056_32625 185
339 3300047443 Ga0495687_104978 Ga0495687_104978_371_940 185
340 3300047445 Ga0495677_0006171 Ga0495677_0006171_2721_3290 185
341 3300047445 Ga0495677_0012380 Ga0495677_0012380_986_1555 185
342 3300047445 Ga0495677_0012403 Ga0495677_0012403_1182_1751 185
343 3300047446 Ga0495679_003359 Ga0495679_003359_2381_2944 185
344 3300047469 Ga0495673_0000223 Ga0495673_0000223_65633_66196 185
345 3300047469 Ga0495673_0001949 Ga0495673_0001949_10679_11245 185
346 3300047472 Ga0495686_0001197 Ga0495686_0001197_18065_18631 185
347 3300047472 Ga0495686_0031613 Ga0495686_0031613_2786_3349 185
348 3300048903 Ga0496100_0510224 Ga0496100_0510224_90_659 185
349 3300048904 Ga0496101_0430426 Ga0496101_0430426_364_933 185
350 3300048905 Ga0496102_0044272 Ga0496102_0044272_1659_2228 185
351 3300048905 Ga0496102_0138713 Ga0496102_0138713_52_621 185
352 3300048905 Ga0496102_0228999 Ga0496102_0228999_1025_1594 185
353 3300048906 Ga0496103_0160935 Ga0496103_0160935_76_645 185
354 3300048909 Ga0496106_0357863 Ga0496106_0357863_121_684 185
355 3300048910 Ga0496107_0000029 Ga0496107_0000029_49005_49568 185
356 3300048912 Ga0496109_0036566 Ga0496109_0036566_3225_3794 185
357 3300048912 Ga0496109_0146299 Ga0496109_0146299_1037_1606 185
358 3300048913 Ga0496110_0007268 Ga0496110_0007268_5907_6476 185
359 3300048913 Ga0496110_0397169 Ga0496110_0397169_369_938 185
360 3300048914 Ga0496111_0030793 Ga0496111_0030793_2163_2732 185
361 3300048914 Ga0496111_0246494 Ga0496111_0246494_312_881 185
362 3300048915 Ga0496112_0017333 Ga0496112_0017333_1790_2407 185
363 3300048915 Ga0496112_0061990 Ga0496112_0061990_113_682 185
364 3300048915 Ga0496112_0248011 Ga0496112_0248011_68_637 185
365 3300048915 Ga0496112_0558968 Ga0496112_0558968_192_767 185
366 3300048915 Ga0496112_1188071 Ga0496112_1188071_27_596 185
367 3300048916 Ga0496113_0729097 Ga0496113_0729097_47_616 185
368 3300048918 Ga0496115_0000771 Ga0496115_0000771_16230_16799 185
369 3300048918 Ga0496115_0007037 Ga0496115_0007037_5318_5902 185
370 3300048918 Ga0496115_0027262 Ga0496115_0027262_2043_2636 185
371 3300048918 Ga0496115_0751946 Ga0496115_0751946_179_745 185
372 3300048919 Ga0496116_0134897 Ga0496116_0134897_219_788 185
373 3300048920 Ga0496117_0007978 Ga0496117_0007978_1369_1938 185
374 3300048921 Ga0496118_0010336 Ga0496118_0010336_4286_4855 185
375 3300048924 Ga0496121_0000397 Ga0496121_0000397_52371_52940 185
376 3300048924 Ga0496121_0006516 Ga0496121_0006516_3241_3804 185
377 3300048924 Ga0496121_0065129 Ga0496121_0065129_597_1160 185
378 3300048924 Ga0496121_0226863 Ga0496121_0226863_718_1296 185
379 3300048928 Ga0496125_0212402 Ga0496125_0212402_53_616 185
380 3300048929 Ga0496126_0289480 Ga0496126_0289480_469_1032 185
381 3300048929 Ga0496126_0414284 Ga0496126_0414284_54_617 185
382 3300049459 Ga0495678_000773 Ga0495678_000773_9511_10077 185
383 3300049460 Ga0495682_0071270 Ga0495682_0071270_647_1216 185
384 3300049570 Ga0501033_0599339 Ga0501033_0599339_76_651 185
385 3300049571 Ga0501034_0075750 Ga0501034_0075750_219_788 185
386 3300049574 Ga0501038_0528512 Ga0501038_0528512_127_705 185
387 3300049575 Ga0501039_0109899 Ga0501039_0109899_691_1257 185
388 3300049575 Ga0501039_0259693 Ga0501039_0259693_505_1083 185
389 3300049575 Ga0501039_0276945 Ga0501039_0276945_704_1273 185
390 3300049576 Ga0501040_0234622 Ga0501040_0234622_695_1273 185
391 3300049577 Ga0501041_0138876 Ga0501041_0138876_587_1156 185
392 3300049580 Ga0501046_0039248 Ga0501046_0039248_2864_3442 185
393 3300049580 Ga0501046_0265837 Ga0501046_0265837_543_1112 185
394 3300049581 Ga0501047_0001827 Ga0501047_0001827_8893_9462 185
395 3300049582 Ga0501048_0090698 Ga0501048_0090698_599_1177 185
396 3300049584 Ga0501068_0467188 Ga0501068_0467188_84_653 185
397 3300049584 Ga0501068_0468115 Ga0501068_0468115_130_708 185
398 3300049586 Ga0501070_0080286 Ga0501070_0080286_1238_1816 185
399 3300049587 Ga0501071_0349566 Ga0501071_0349566_59_628 185
400 3300049588 Ga0501072_0048835 Ga0501072_0048835_2659_3228 185
401 3300049588 Ga0501072_0095088 Ga0501072_0095088_979_1545 185
402 3300049588 Ga0501072_0199399 Ga0501072_0199399_972_1550 185
403 3300049588 Ga0501072_0398834 Ga0501072_0398834_248_817 185
404 3300049589 Ga0501073_0349407 Ga0501073_0349407_175_744 185
405 3300049589 Ga0501073_0510956 Ga0501073_0510956_23_601 185
406 3300049592 Ga0501076_0089577 Ga0501076_0089577_1882_2451 185
407 3300049592 Ga0501076_0657026 Ga0501076_0657026_150_728 185
408 3300049592 Ga0501076_0851396 Ga0501076_0851396_144_737 185
409 3300049741 Ga0501079_0899469 Ga0501079_0899469_44_616 185
410 3300049742 Ga0501080_0010727 Ga0501080_0010727_5169_5738 185
411 3300049743 Ga0501081_0018566 Ga0501081_0018566_1811_2389 185
412 3300049743 Ga0501081_0181751 Ga0501081_0181751_225_791 185
413 3300049743 Ga0501081_0365756 Ga0501081_0365756_174_743 185
414 3300049743 Ga0501081_0911524 Ga0501081_0911524_25_597 185
415 3300049744 Ga0501083_0102287 Ga0501083_0102287_250_819 185
416 3300049822 Ga0501035_0614645 Ga0501035_0614645_26_595 185
417 3300049824 Ga0501045_0095419 Ga0501045_0095419_1343_1921 185
418 3300050496 nmdc:mga07m45_134555_c1 nmdc:mga07m45_134555_c1_558_1178 185
419 3300050507 nmdc:mga05p37_74423_c1 nmdc:mga05p37_74423_c1_1172_1744 185
420 3300050507 nmdc:mga05p37_929376_c1 nmdc:mga05p37_929376_c1_302_871 185
421 3300050508 nmdc:mga09592_6522_c2 nmdc:mga09592_6522_c2_1917_2486 185
422 3300050508 nmdc:mga09592_716428_c1 nmdc:mga09592_716428_c1_85_657 185
423 3300050510 nmdc:mga06r32_120185_c1 nmdc:mga06r32_120185_c1_870_1439 185
424 3300050510 nmdc:mga06r32_36778_c1 nmdc:mga06r32_36778_c1_2553_3122 185
425 3300050510 nmdc:mga06r32_579677_c1 nmdc:mga06r32_579677_c1_509_1078 185
426 3300050510 nmdc:mga06r32_82932_c1 nmdc:mga06r32_82932_c1_1133_1705 185
427 3300050511 nmdc:mga08y16_112215_c1 nmdc:mga08y16_112215_c1_312_884 185
428 3300050511 nmdc:mga08y16_144719_c1 nmdc:mga08y16_144719_c1_796_1365 185
429 3300050512 nmdc:mga0n895_3101_c1 nmdc:mga0n895_3101_c1_5048_5617 185
430 3300050515 nmdc:mga0a205_3468_c1 nmdc:mga0a205_3468_c1_5887_6456 185
431 3300053086 Ga0500578_0001117 Ga0500578_0001117_18764_19330 185
432 3300053086 Ga0500578_0464524 Ga0500578_0464524_83_652 185
433 3300053087 Ga0500643_003852 Ga0500643_003852_4703_5266 185
434 3300053087 Ga0500643_020813 Ga0500643_020813_1468_2034 185
435 3300053088 Ga0500644_0000822 Ga0500644_0000822_5681_6247 185
436 3300053088 Ga0500644_0048316 Ga0500644_0048316_315_881 185
437 3300053091 Ga0500647_0076122 Ga0500647_0076122_371_934 185
438 3300053093 Ga0500651_0380679 Ga0500651_0380679_66_632 185
439 3300053102 Ga0500554_104451 Ga0500554_104451_198_761 185
440 3300053111 Ga0500572_000561 Ga0500572_000561_10117_10680 185
441 3300053118 Ga0500594_0000093 Ga0500594_0000093_5358_5924 185
442 3300053122 Ga0500608_000188 Ga0500608_000188_18510_19073 185
443 3300053122 Ga0500608_002326 Ga0500608_002326_4495_5064 185
444 3300053122 Ga0500608_117025 Ga0500608_117025_220_786 185
445 3300053123 Ga0500614_021634 Ga0500614_021634_675_1238 185
446 3300053125 Ga0500618_000152 Ga0500618_000152_35252_35815 185
447 3300053130 Ga0500642_0088580 Ga0500642_0088580_647_1213 185
448 3300053131 Ga0500652_034298 Ga0500652_034298_240_803 185
449 3300053133 Ga0500655_068862 Ga0500655_068862_41_607 185
450 3300053136 Ga0500559_0000054 Ga0500559_0000054_70775_71338 185
451 3300053136 Ga0500559_0002200 Ga0500559_0002200_4937_5503 185
452 3300053136 Ga0500559_0004821 Ga0500559_0004821_3427_3990 185
453 3300053138 Ga0500564_000094 Ga0500564_000094_83_649 185
454 3300053148 Ga0500590_054907 Ga0500590_054907_98_661 185
455 3300053156 Ga0500622_0001162 Ga0500622_0001162_2871_3437 185
456 3300054114 Ga0501084_0010424 Ga0501084_0010424_4556_5125 185
457 3300054114 Ga0501084_0057061 Ga0501084_0057061_2616_3182 185
458 3300054114 Ga0501084_0432981 Ga0501084_0432981_345_917 185
459 3300060353 Ga0501082_0009285 Ga0501082_0009285_3381_3950 185
460 3300060353 Ga0501082_0077766 Ga0501082_0077766_2045_2623 185
461 3300060353 Ga0501082_0245384 Ga0501082_0245384_220_786 185
462 3300060353 Ga0501082_0245403 Ga0501082_0245403_42_611 185
463 3300060353 Ga0501082_0415192 Ga0501082_0415192_103_666 185
464 3300061734 Ga0530510_0048406 Ga0530510_0048406_2432_3001 185
465 3300061734 Ga0530510_0215322 Ga0530510_0215322_760_1326 185
466 3300061734 Ga0530510_0245248 Ga0530510_0245248_492_1061 185
467 3300005439 Ga0070711_100561417 Ga0070711_1005614172 186
468 3300006038 Ga0075365_10929178 Ga0075365_109291781 186
469 3300026075 Ga0207708_10266981 Ga0207708_102669812 186
470 3300031456 Ga0307513_10006008 Ga0307513_100060085 186
471 3300031903 Ga0307407_10355261 Ga0307407_103552612 186
472 3300031911 Ga0307412_10341554 Ga0307412_103415542 186
473 3300032005 Ga0307411_10695977 Ga0307411_106959771 186
474 3300032126 Ga0307415_101103179 Ga0307415_1011031791 186
475 3300037471 Ga0395905_0552312 Ga0395905_0552312_211_828 186
476 3300046471 Ga0495650_0113576 Ga0495650_0113576_24_629 186
477 3300046539 Ga0495621_0183181 Ga0495621_0183181_115_726 186
478 3300049581 Ga0501047_0091648 Ga0501047_0091648_909_1484 186
479 3300049822 Ga0501035_0665376 Ga0501035_0665376_209_778 186
480 3300049823 Ga0501044_0326402 Ga0501044_0326402_446_1021 186
481 3300053119 Ga0500595_057501 Ga0500595_057501_564_1127 187
482 3300003320 rootH2_10106005 rootH2_101060052 188
483 3300005337 Ga0070682_100022064 Ga0070682_1000220643 188
484 3300005339 Ga0070660_100081723 Ga0070660_1000817232 188
485 3300005440 Ga0070705_100055287 Ga0070705_1000552871 188
486 3300005444 Ga0070694_100035770 Ga0070694_1000357703 188
487 3300005455 Ga0070663_100001790 Ga0070663_1000017905 188
488 3300005530 Ga0070679_100082950 Ga0070679_1000829504 188
489 3300005539 Ga0068853_100038979 Ga0068853_1000389794 188
490 3300005563 Ga0068855_100230580 Ga0068855_1002305801 188
491 3300005615 Ga0070702_100116787 Ga0070702_1001167872 188
492 3300005618 Ga0068864_101209508 Ga0068864_1012095082 188
493 3300005842 Ga0068858_100033334 Ga0068858_1000333344 188
494 3300006358 Ga0068871_100880406 Ga0068871_1008804062 188
495 3300009545 Ga0105237_10173262 Ga0105237_101732623 188
496 3300009551 Ga0105238_10139157 Ga0105238_101391571 188
497 3300013105 Ga0157369_10296165 Ga0157369_102961652 188
498 3300014326 Ga0157380_10189901 Ga0157380_101899012 188
499 3300014968 Ga0157379_10017905 Ga0157379_100179055 188
500 3300025904 Ga0207647_10022869 Ga0207647_100228694 188
501 3300025911 Ga0207654_10059012 Ga0207654_100590123 188
502 3300025919 Ga0207657_10068026 Ga0207657_100680264 188
503 3300025920 Ga0207649_10554035 Ga0207649_105540351 188
504 3300025924 Ga0207694_10158317 Ga0207694_101583173 188
505 3300025932 Ga0207690_10056777 Ga0207690_100567772 188
506 3300025945 Ga0207679_10162650 Ga0207679_101626503 188
507 3300025949 Ga0207667_10948200 Ga0207667_109482001 188
508 3300026035 Ga0207703_10030770 Ga0207703_100307704 188
509 3300026067 Ga0207678_10000101 Ga0207678_1000010142 188
510 3300026075 Ga0207708_10433485 Ga0207708_104334852 188
511 3300026095 Ga0207676_10269342 Ga0207676_102693422 188
512 3300026142 Ga0207698_10232326 Ga0207698_102323263 188
513 3300048929 Ga0496126_0888096 Ga0496126_0888096_65_631 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

24

208

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.8923 1 187
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8915 1 184
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.8904 1 187
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.8844 1 187
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8804 1 184
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.907 44 105 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.898 1 186 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.889 25 185 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.883 1 184 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.878 25 185 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A357CJG3-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9887 47 185 GO:0003676
GO:0008168
GO:0031167
AF-A0A527GTB0-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9884 45 185 GO:0003676
GO:0008168
GO:0031167
AF-A0A529U2F3-F1-model_v4 deleted 0.9872 63 184
AF-A0A528UIM2-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9833 52 185 GO:0003676
GO:0008168
GO:0031167
AF-K8PAB4-F1-model_v4 RsmD family RNA methyltransferase 0.9824 1 184 GO:0003676
GO:0008168
GO:0031167

Feature Viewer

pLDDT pTM Quality
94.71 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map