F457518

General Info

Members Datasets Scaffolds Average Seq Length
513 219 1026 83

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_11014640|Ga0065715_110146401
Length 92
Sequence MISCQDFITELGNLLDEEVASEIREQLELHLAHCNTCQVLYDSTRKTLRIVTESGSFEYPDPIAEPLVAKVMERVRSGCALDPKETQKAQES

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
166 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
195 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
196 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
197 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
203 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
204 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
209 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
210 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.51
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 41.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_11014640 3300005293 Unclassified 541
2 JGI24751J29686_10000024 3300002459 Bacteria 97492
3 JGI25406J46586_10139654 3300003203 Bacteria 709
4 rootH2_10312485 3300003320 Unclassified 2082
5 Ga0065714_10189564 3300005288 Bacteria 885
6 Ga0065704_10157689 3300005289 Bacteria 1377
7 Ga0065704_10266719 3300005289 Unclassified 920
8 Ga0065704_10439994 3300005289 Unclassified 714
9 Ga0065704_10699048 3300005289 Unclassified 562
10 Ga0065712_10076217 3300005290 Bacteria 3707
11 Ga0065712_10220212 3300005290 Bacteria 1027
12 Ga0065712_10826414 3300005290 Unclassified 504
13 Ga0065715_10096605 3300005293 Bacteria 3850
14 Ga0065715_10262672 3300005293 Bacteria 1133
15 Ga0065715_10302971 3300005293 Unclassified 1037
16 Ga0065715_10469853 3300005293 Unclassified 807
17 Ga0065707_10007500 3300005295 Bacteria 2874
18 Ga0065707_10019323 3300005295 Bacteria 1348
19 Ga0070676_10133921 3300005328 Unclassified 1570
20 Ga0070690_100066203 3300005330 Bacteria 2338
21 Ga0070690_100217881 3300005330 Archaea 1336
22 Ga0070670_100000029 3300005331 Bacteria 180239
23 Ga0070670_100459409 3300005331 Bacteria 1129
24 Ga0070670_100835388 3300005331 Bacteria 833
25 Ga0068869_100081786 3300005334 Unclassified 2412
26 Ga0068869_100360336 3300005334 Bacteria 1187
27 Ga0068869_100498179 3300005334 Bacteria 1017
28 Ga0068869_100727637 3300005334 Unclassified 848
29 Ga0068869_101637825 3300005334 Unclassified 573
30 Ga0070680_100005398 3300005336 Bacteria 9675
31 Ga0070682_100030067 3300005337 Bacteria 3275
32 Ga0068868_101583216 3300005338 Unclassified 615
33 Ga0070689_100119820 3300005340 Unclassified 2101
34 Ga0070692_10209914 3300005345 Unclassified 1145
35 Ga0070692_11125100 3300005345 Unclassified 555
36 Ga0070669_100866534 3300005353 Unclassified 770
37 Ga0070673_100146724 3300005364 Archaea 1995
38 Ga0070673_100681113 3300005364 Bacteria 943
39 Ga0070673_101078853 3300005364 Unclassified 750
40 Ga0070659_100252346 3300005366 Unclassified 1462
41 Ga0070659_100540617 3300005366 Bacteria 997
42 Ga0070703_10046514 3300005406 Bacteria 1372
43 Ga0070709_10158453 3300005434 Bacteria 1572
44 Ga0070714_100001370 3300005435 Bacteria 17640
45 Ga0070713_100010976 3300005436 Bacteria 6571
46 Ga0070711_100049673 3300005439 Unclassified 2873
47 Ga0070711_100138617 3300005439 Bacteria 1821
48 Ga0070711_100205482 3300005439 Bacteria 1522
49 Ga0070705_100049390 3300005440 Bacteria 2442
50 Ga0070705_100117242 3300005440 Bacteria 1713
51 Ga0070705_100165505 3300005440 Bacteria 1483
52 Ga0070705_100427139 3300005440 Unclassified 988
53 Ga0070705_100443690 3300005440 Unclassified 972
54 Ga0070705_101070938 3300005440 Unclassified 658
55 Ga0070700_100240025 3300005441 Bacteria 1294
56 Ga0070700_100349629 3300005441 Bacteria 1095
57 Ga0070694_100034648 3300005444 Bacteria 3331
58 Ga0070694_100086501 3300005444 Bacteria 2191
59 Ga0070694_100245848 3300005444 Bacteria 1351
60 Ga0070694_100387603 3300005444 Bacteria 1091
61 Ga0070694_100544048 3300005444 Archaea 929
62 Ga0070694_100621374 3300005444 Unclassified 872
63 Ga0070694_100751392 3300005444 Bacteria 796
64 Ga0070694_101882280 3300005444 Bacteria 511
65 Ga0070678_102007877 3300005456 Unclassified 547
66 Ga0070681_10003300 3300005458 Bacteria 15066
67 Ga0070681_10004020 3300005458 Bacteria 13871
68 Ga0070681_10017605 3300005458 Bacteria 7141
69 Ga0068867_100144817 3300005459 Unclassified 1861
70 Ga0070685_10381858 3300005466 Unclassified 971
71 Ga0070706_100038591 3300005467 Unclassified 4408
72 Ga0070707_100080760 3300005468 Unclassified 3139
73 Ga0070707_101076084 3300005468 Unclassified 770
74 Ga0070698_100115649 3300005471 Unclassified 2646
75 Ga0070699_100041322 3300005518 Unclassified 3992
76 Ga0070699_100147409 3300005518 Unclassified 2080
77 Ga0070699_100233868 3300005518 Unclassified 1639
78 Ga0070699_101363869 3300005518 Unclassified 650
79 Ga0070679_100000052 3300005530 Bacteria 85455
80 Ga0070679_100139949 3300005530 Bacteria 2400
81 Ga0070686_101310092 3300005544 Bacteria 605
82 Ga0070695_100048398 3300005545 Bacteria 2719
83 Ga0070695_100119073 3300005545 Bacteria 1804
84 Ga0070695_100193193 3300005545 Unclassified 1450
85 Ga0070695_100224492 3300005545 Bacteria 1355
86 Ga0070695_100287879 3300005545 Unclassified 1210
87 Ga0070695_100316765 3300005545 Bacteria 1158
88 Ga0070695_100521314 3300005545 Bacteria 922
89 Ga0070695_101060406 3300005545 Bacteria 662
90 Ga0070695_101353719 3300005545 Bacteria 589
91 Ga0070695_101467129 3300005545 Unclassified 567
92 Ga0070695_101550989 3300005545 Unclassified 552
93 Ga0070695_101872359 3300005545 Unclassified 504
94 Ga0070696_100111840 3300005546 Bacteria 1967
95 Ga0070696_100198154 3300005546 Bacteria 1498
96 Ga0070696_100311328 3300005546 Unclassified 1209
97 Ga0070696_100505371 3300005546 Unclassified 962
98 Ga0070693_100009641 3300005547 Bacteria 4807
99 Ga0070693_100009827 3300005547 Unclassified 4772
100 Ga0070693_100227919 3300005547 Unclassified 1224
101 Ga0070693_100799880 3300005547 Bacteria 699
102 Ga0070704_100051715 3300005549 Bacteria 2895
103 Ga0070704_100392732 3300005549 Unclassified 1182
104 Ga0070704_101303491 3300005549 Unclassified 664
105 Ga0068855_102211338 3300005563 Unclassified 552
106 Ga0068855_102324444 3300005563 Unclassified 536
107 Ga0070664_100374526 3300005564 Bacteria 1298
108 Ga0068857_100040724 3300005577 Bacteria 4120
109 Ga0068857_100696676 3300005577 Unclassified 965
110 Ga0068857_100731381 3300005577 Unclassified 942
111 Ga0068857_101380241 3300005577 Unclassified 685
112 Ga0068857_102427375 3300005577 Unclassified 515
113 Ga0068854_101457828 3300005578 Unclassified 620
114 Ga0068854_102249365 3300005578 Unclassified 505
115 Ga0068856_100005380 3300005614 Bacteria 12619
116 Ga0070702_100218415 3300005615 Bacteria 1273
117 Ga0070702_100376794 3300005615 Bacteria 1008
118 Ga0070702_100403692 3300005615 Bacteria 978
119 Ga0070702_101291692 3300005615 Unclassified 592
120 Ga0070702_101329041 3300005615 Unclassified 585
121 Ga0068859_100086271 3300005617 Bacteria 3185
122 Ga0068859_100100964 3300005617 Bacteria 2941
123 Ga0068859_100412451 3300005617 Archaea 1447
124 Ga0068859_100738112 3300005617 Bacteria 1074
125 Ga0068859_100868323 3300005617 Bacteria 988
126 Ga0068864_100016376 3300005618 Bacteria 6171
127 Ga0068864_100083441 3300005618 Bacteria 2806
128 Ga0068864_100173056 3300005618 Bacteria 1970
129 Ga0068864_100387182 3300005618 Unclassified 1326
130 Ga0068864_100443750 3300005618 Bacteria 1240
131 Ga0068864_100590913 3300005618 Unclassified 1076
132 Ga0068864_100651021 3300005618 Unclassified 1026
133 Ga0068866_10538321 3300005718 Unclassified 779
134 Ga0068861_102393998 3300005719 Bacteria 531
135 Ga0068851_10020258 3300005834 Bacteria 3218
136 Ga0068863_100070159 3300005841 Bacteria 3314
137 Ga0068863_100098664 3300005841 Bacteria 2774
138 Ga0068863_100268544 3300005841 Unclassified 1651
139 Ga0068863_100580192 3300005841 Bacteria 1109
140 Ga0068863_100620713 3300005841 Bacteria 1071
141 Ga0068863_100765903 3300005841 Bacteria 962
142 Ga0068863_100846190 3300005841 Unclassified 914
143 Ga0068863_101385358 3300005841 Unclassified 711
144 Ga0068858_100024132 3300005842 Bacteria 5667
145 Ga0068858_100211855 3300005842 Bacteria 1834
146 Ga0068858_100520800 3300005842 Unclassified 1150
147 Ga0068858_100682719 3300005842 Bacteria 999
148 Ga0068858_101069465 3300005842 Archaea 792
149 Ga0068858_101207832 3300005842 Unclassified 743
150 Ga0068858_101424966 3300005842 Unclassified 683
151 Ga0068860_100051812 3300005843 Bacteria 3904
152 Ga0068860_100064067 3300005843 Bacteria 3491
153 Ga0068860_100094320 3300005843 Bacteria 2852
154 Ga0068860_100139553 3300005843 Bacteria 2329
155 Ga0068860_101150059 3300005843 Unclassified 796
156 Ga0068862_100641812 3300005844 Unclassified 1023
157 Ga0081455_10011957 3300005937 Bacteria 8687
158 Ga0081539_10007208 3300005985 Bacteria 10235
159 Ga0070715_10208572 3300006163 Unclassified 997
160 Ga0070716_100013511 3300006173 Unclassified 4162
161 Ga0070716_100041697 3300006173 Bacteria 2559
162 Ga0070716_100074563 3300006173 Bacteria 2005
163 Ga0070716_100610007 3300006173 Bacteria 822
164 Ga0070716_101347458 3300006173 Unclassified 578
165 Ga0070712_101750557 3300006175 Unclassified 544
166 Ga0097621_100027684 3300006237 Bacteria 4460
167 Ga0097621_100035088 3300006237 Unclassified 4006
168 Ga0097621_100179280 3300006237 Bacteria 1830
169 Ga0068871_100004189 3300006358 Bacteria 9987
170 Ga0068871_100029282 3300006358 Bacteria 4322
171 Ga0068871_100032680 3300006358 Unclassified 4113
172 Ga0068871_100358089 3300006358 Bacteria 1292
173 Ga0075433_10038223 3300006852 Unclassified 4144
174 Ga0075433_10128992 3300006852 Bacteria 2247
175 Ga0075433_10366362 3300006852 Unclassified 1273
176 Ga0075433_10453315 3300006852 Unclassified 1130
177 Ga0075433_11186566 3300006852 Bacteria 663
178 Ga0075433_11324522 3300006852 Unclassified 624
179 Ga0075433_11405622 3300006852 Unclassified 604
180 Ga0075434_100025315 3300006871 Bacteria 5806
181 Ga0075434_100045653 3300006871 Bacteria 4346
182 Ga0068865_100320408 3300006881 Unclassified 1247
183 Ga0068865_100918931 3300006881 Archaea 762
184 Ga0075436_101000919 3300006914 Unclassified 627
185 Ga0097620_100086270 3300006931 Bacteria 3185
186 Ga0097620_100100958 3300006931 Bacteria 2941
187 Ga0097620_100412425 3300006931 Archaea 1447
188 Ga0097620_100738140 3300006931 Bacteria 1074
189 Ga0097620_100868466 3300006931 Bacteria 988
190 Ga0105251_10460698 3300009011 Unclassified 590
191 Ga0105240_10081300 3300009093 Bacteria 3982
192 Ga0105240_10201545 3300009093 Bacteria 2332
193 Ga0105245_10218578 3300009098 Bacteria 1837
194 Ga0105245_10982978 3300009098 Bacteria 888
195 Ga0105245_11104957 3300009098 Unclassified 839
196 Ga0105245_11465930 3300009098 Bacteria 733
197 Ga0105245_12525096 3300009098 Unclassified 567
198 Ga0105247_10000326 3300009101 Bacteria 42400
199 Ga0105247_10108701 3300009101 Bacteria 1782
200 Ga0105247_10126955 3300009101 Bacteria 1659
201 Ga0105247_10672154 3300009101 Unclassified 776
202 Ga0105247_10739174 3300009101 Unclassified 744
203 Ga0105247_10759463 3300009101 Unclassified 736
204 Ga0114129_10030268 3300009147 Bacteria 7663
205 Ga0114129_10036932 3300009147 Bacteria 6897
206 Ga0105243_10006689 3300009148 Bacteria 8901
207 Ga0105243_10042719 3300009148 Bacteria 3550
208 Ga0105243_10185808 3300009148 Unclassified 1811
209 Ga0105243_10844558 3300009148 Bacteria 906
210 Ga0105241_10015272 3300009174 Bacteria 5624
211 Ga0105241_10040668 3300009174 Bacteria 3510
212 Ga0105241_10046806 3300009174 Bacteria 3286
213 Ga0105241_10049031 3300009174 Bacteria 3215
214 Ga0105241_10349720 3300009174 Unclassified 1283
215 Ga0105241_10492754 3300009174 Bacteria 1091
216 Ga0105241_10645738 3300009174 Bacteria 961
217 Ga0105241_10788883 3300009174 Unclassified 874
218 Ga0105241_10792389 3300009174 Unclassified 872
219 Ga0105241_10804646 3300009174 Unclassified 866
220 Ga0105241_11457815 3300009174 Bacteria 657
221 Ga0105241_12385151 3300009174 Unclassified 528
222 Ga0105242_10003233 3300009176 Bacteria 12700
223 Ga0105242_10097197 3300009176 Unclassified 2489
224 Ga0105242_10232008 3300009176 Bacteria 1654
225 Ga0105242_10890768 3300009176 Unclassified 889
226 Ga0105242_12784837 3300009176 Bacteria 539
227 Ga0105248_10047855 3300009177 Bacteria 4796
228 Ga0105248_10060546 3300009177 Unclassified 4250
229 Ga0105248_10094402 3300009177 Bacteria 3368
230 Ga0105248_10312563 3300009177 Bacteria 1770
231 Ga0105248_10373583 3300009177 Bacteria 1605
232 Ga0105248_10401479 3300009177 Unclassified 1543
233 Ga0105248_10585527 3300009177 Unclassified 1259
234 Ga0105237_10003293 3300009545 Bacteria 19288
235 Ga0105237_10130804 3300009545 Bacteria 2504
236 Ga0105237_10174393 3300009545 Bacteria 2150
237 Ga0105237_10362566 3300009545 Bacteria 1454
238 Ga0105237_10383312 3300009545 Bacteria 1411
239 Ga0105237_11939271 3300009545 Unclassified 597
240 Ga0105237_11957926 3300009545 Unclassified 594
241 Ga0105238_10000459 3300009551 Bacteria 42813
242 Ga0105238_10140359 3300009551 Bacteria 2393
243 Ga0105238_10280281 3300009551 Unclassified 1648
244 Ga0105238_10536547 3300009551 Unclassified 1173
245 Ga0105249_10010826 3300009553 Bacteria 8014
246 Ga0105249_10039846 3300009553 Bacteria 4265
247 Ga0105249_10070924 3300009553 Bacteria 3218
248 Ga0105249_10489782 3300009553 Unclassified 1273
249 Ga0105239_10099847 3300010375 Bacteria 3209
250 Ga0105239_10404684 3300010375 Unclassified 1545
251 Ga0105239_11072408 3300010375 Unclassified 927
252 Ga0105239_13011772 3300010375 Bacteria 549
253 Ga0105246_10027123 3300011119 Bacteria 3750
254 Ga0105246_10040193 3300011119 Bacteria 3155
255 Ga0105246_10075117 3300011119 Bacteria 2392
256 Ga0105246_10082250 3300011119 Bacteria 2298
257 Ga0105246_11856416 3300011119 Unclassified 577
258 Ga0157373_10139707 3300013100 Bacteria 1703
259 Ga0157373_10613496 3300013100 Bacteria 793
260 Ga0157371_10288952 3300013102 Bacteria 1185
261 Ga0157371_10327878 3300013102 Bacteria 1112
262 Ga0157371_11341356 3300013102 Unclassified 554
263 Ga0157374_10809870 3300013296 Bacteria 953
264 Ga0157374_11300284 3300013296 Bacteria 749
265 Ga0157378_10000105 3300013297 Bacteria 79945
266 Ga0157378_10003812 3300013297 Bacteria 13344
267 Ga0157378_10182557 3300013297 Unclassified 1974
268 Ga0157378_10221291 3300013297 Bacteria 1800
269 Ga0157378_10581201 3300013297 Unclassified 1129
270 Ga0163162_10005772 3300013306 Bacteria 11974
271 Ga0163162_10189447 3300013306 Bacteria 2184
272 Ga0163162_10203288 3300013306 Bacteria 2110
273 Ga0163162_10915387 3300013306 Bacteria 989
274 Ga0163162_11357758 3300013306 Unclassified 808
275 Ga0157372_10048367 3300013307 Unclassified 4728
276 Ga0157372_11076570 3300013307 Bacteria 930
277 Ga0157375_10068684 3300013308 Archaea 3547
278 Ga0157375_13686513 3300013308 Bacteria 509
279 Ga0163163_10000235 3300014325 Bacteria 56231
280 Ga0163163_10003844 3300014325 Bacteria 12790
281 Ga0163163_10062431 3300014325 Unclassified 3692
282 Ga0163163_10091190 3300014325 Bacteria 3061
283 Ga0163163_11685174 3300014325 Unclassified 695
284 Ga0157380_13045079 3300014326 Bacteria 534
285 Ga0157380_13352041 3300014326 Unclassified 512
286 Ga0157377_10754280 3300014745 Bacteria 713
287 Ga0157377_10763079 3300014745 Bacteria 709
288 Ga0157377_10880885 3300014745 Unclassified 667
289 Ga0157379_10132622 3300014968 Unclassified 2243
290 Ga0157379_10344288 3300014968 Bacteria 1364
291 Ga0157379_10860301 3300014968 Bacteria 858
292 Ga0157376_10225752 3300014969 Bacteria 1737
293 Ga0157376_10413492 3300014969 Unclassified 1307
294 Ga0182007_10130026 3300015262 Unclassified 846
295 Ga0182007_10153594 3300015262 Unclassified 784
296 Ga0163161_11905858 3300017792 Bacteria 529
297 Ga0207656_10012806 3300025321 Bacteria 3193
298 Ga0207653_10005200 3300025885 Bacteria 4067
299 Ga0207642_10446565 3300025899 Unclassified 783
300 Ga0207710_10000291 3300025900 Bacteria 40580
301 Ga0207710_10135600 3300025900 Bacteria 1185
302 Ga0207710_10476484 3300025900 Unclassified 646
303 Ga0207680_10719845 3300025903 Unclassified 715
304 Ga0207647_10042305 3300025904 Bacteria 2859
305 Ga0207647_10377001 3300025904 Unclassified 801
306 Ga0207685_10137560 3300025905 Unclassified 1091
307 Ga0207699_10174721 3300025906 Bacteria 1440
308 Ga0207645_10139767 3300025907 Bacteria 1578
309 Ga0207643_10052009 3300025908 Unclassified 2326
310 Ga0207684_10014122 3300025910 Bacteria 6897
311 Ga0207654_10036950 3300025911 Bacteria 2732
312 Ga0207654_10132335 3300025911 Bacteria 1580
313 Ga0207654_10301948 3300025911 Unclassified 1089
314 Ga0207654_10538965 3300025911 Unclassified 828
315 Ga0207654_10681489 3300025911 Unclassified 738
316 Ga0207654_10727020 3300025911 Unclassified 714
317 Ga0207654_10852220 3300025911 Unclassified 659
318 Ga0207654_10859308 3300025911 Bacteria 657
319 Ga0207654_11357767 3300025911 Unclassified 518
320 Ga0207707_10000014 3300025912 Bacteria 261972
321 Ga0207707_10041783 3300025912 Bacteria 4004
322 Ga0207707_10053037 3300025912 Bacteria 3529
323 Ga0207695_10277177 3300025913 Bacteria 1571
324 Ga0207695_10383520 3300025913 Bacteria 1291
325 Ga0207671_10023996 3300025914 Bacteria 4591
326 Ga0207671_10154395 3300025914 Bacteria 1775
327 Ga0207693_10086092 3300025915 Bacteria 2462
328 Ga0207663_10095428 3300025916 Bacteria 1984
329 Ga0207663_10173783 3300025916 Bacteria 1532
330 Ga0207663_10189944 3300025916 Unclassified 1474
331 Ga0207660_10002404 3300025917 Bacteria 12302
332 Ga0207660_10312840 3300025917 Bacteria 1253
333 Ga0207652_10000031 3300025921 Bacteria 143723
334 Ga0207652_10162540 3300025921 Bacteria 2002
335 Ga0207652_11230976 3300025921 Unclassified 651
336 Ga0207646_10169499 3300025922 Unclassified 1971
337 Ga0207646_11153881 3300025922 Unclassified 680
338 Ga0207681_10423674 3300025923 Unclassified 1079
339 Ga0207694_10010422 3300025924 Bacteria 7007
340 Ga0207694_10278096 3300025924 Bacteria 1374
341 Ga0207650_10000005 3300025925 Bacteria 663190
342 Ga0207687_10004205 3300025927 Bacteria 9629
343 Ga0207687_10397884 3300025927 Unclassified 1132
344 Ga0207700_10031261 3300025928 Bacteria 3779
345 Ga0207664_10024097 3300025929 Unclassified 4570
346 Ga0207690_11472366 3300025932 Bacteria 569
347 Ga0207686_10011703 3300025934 Archaea 4812
348 Ga0207686_11329996 3300025934 Unclassified 590
349 Ga0207709_10003287 3300025935 Bacteria 9700
350 Ga0207709_10036836 3300025935 Bacteria 2902
351 Ga0207709_10593204 3300025935 Bacteria 876
352 Ga0207670_10216118 3300025936 Unclassified 1465
353 Ga0207670_11390818 3300025936 Unclassified 596
354 Ga0207704_11428759 3300025938 Unclassified 593
355 Ga0207665_10085116 3300025939 Bacteria 2183
356 Ga0207665_10088559 3300025939 Unclassified 2142
357 Ga0207711_10077929 3300025941 Unclassified 2890
358 Ga0207711_10242552 3300025941 Unclassified 1653
359 Ga0207711_10765479 3300025941 Unclassified 900
360 Ga0207711_10776303 3300025941 Unclassified 893
361 Ga0207711_10777035 3300025941 Bacteria 892
362 Ga0207711_11709233 3300025941 Unclassified 573
363 Ga0207689_10043052 3300025942 Unclassified 3733
364 Ga0207689_10048093 3300025942 Unclassified 3519
365 Ga0207689_10240518 3300025942 Bacteria 1496
366 Ga0207689_10375144 3300025942 Bacteria 1184
367 Ga0207689_10389294 3300025942 Bacteria 1161
368 Ga0207689_11078770 3300025942 Unclassified 677
369 Ga0207689_11631198 3300025942 Unclassified 536
370 Ga0207679_10511038 3300025945 Bacteria 1073
371 Ga0207679_10628237 3300025945 Bacteria 970
372 Ga0207667_10778302 3300025949 Bacteria 955
373 Ga0207667_12075828 3300025949 Unclassified 527
374 Ga0207651_10257780 3300025960 Archaea 1430
375 Ga0207651_10966658 3300025960 Bacteria 760
376 Ga0207712_10010848 3300025961 Bacteria 5798
377 Ga0207640_10539019 3300025981 Unclassified 978
378 Ga0207640_12149096 3300025981 Unclassified 506
379 Ga0207677_10449078 3300026023 Bacteria 1104
380 Ga0207677_11529688 3300026023 Unclassified 617
381 Ga0207703_10050302 3300026035 Unclassified 3372
382 Ga0207703_10164786 3300026035 Archaea 1944
383 Ga0207703_10198042 3300026035 Bacteria 1783
384 Ga0207703_10253177 3300026035 Bacteria 1588
385 Ga0207708_10013886 3300026075 Bacteria 6020
386 Ga0207702_10037207 3300026078 Bacteria 4073
387 Ga0207702_10543516 3300026078 Bacteria 1136
388 Ga0207641_10090560 3300026088 Unclassified 2675
389 Ga0207641_10101124 3300026088 Bacteria 2540
390 Ga0207641_10673484 3300026088 Unclassified 1017
391 Ga0207641_12095657 3300026088 Unclassified 566
392 Ga0207648_10105942 3300026089 Unclassified 2467
393 Ga0207648_10215232 3300026089 Archaea 1706
394 Ga0207676_10021063 3300026095 Unclassified 4779
395 Ga0207676_10172029 3300026095 Bacteria 1888
396 Ga0207676_10222467 3300026095 Unclassified 1682
397 Ga0207676_10914389 3300026095 Unclassified 861
398 Ga0207676_11380192 3300026095 Unclassified 700
399 Ga0207676_12239047 3300026095 Bacteria 544
400 Ga0207674_10029883 3300026116 Bacteria 5734
401 Ga0207674_10033731 3300026116 Bacteria 5358
402 Ga0207674_10505554 3300026116 Bacteria 1167
403 Ga0207674_11881164 3300026116 Unclassified 565
404 Ga0207675_100707137 3300026118 Unclassified 1017
405 Ga0207675_101746038 3300026118 Unclassified 642
406 Ga0207698_10158986 3300026142 Bacteria 1973
407 Ga0207698_11446508 3300026142 Unclassified 702
408 Ga0207698_12297669 3300026142 Bacteria 551
409 Ga0207698_12342150 3300026142 Unclassified 546
410 Ga0268265_10351182 3300028380 Bacteria 1347
411 Ga0268265_11749548 3300028380 Bacteria 628
412 Ga0268264_10030201 3300028381 Bacteria 4443
413 Ga0268264_10038533 3300028381 Bacteria 3946
414 Ga0268264_10054010 3300028381 Bacteria 3353
415 Ga0268264_10080254 3300028381 Bacteria 2786
416 Ga0268264_12067419 3300028381 Unclassified 578
417 Ga0307408_100002979 3300031548 Bacteria 11725
418 Ga0307405_10704678 3300031731 Unclassified 836
419 Ga0307413_10473539 3300031824 Unclassified 999
420 Ga0307410_10114935 3300031852 Unclassified 1953
421 Ga0307410_10204684 3300031852 Unclassified 1509
422 Ga0307406_10029262 3300031901 Bacteria 3335
423 Ga0307412_10519640 3300031911 Unclassified 994
424 Ga0307409_100119317 3300031995 Bacteria 2230
425 Ga0307416_100422659 3300032002 Bacteria 1377
426 Ga0307414_10085654 3300032004 Bacteria 2322
427 Ga0307411_10017803 3300032005 Bacteria 4061
428 Ga0307411_10284403 3300032005 Unclassified 1318
429 Ga0307415_100000420 3300032126 Bacteria 18169
430 Ga0373956_0404621 3300035119 Unclassified 651
431 Ga0373957_0409365 3300035120 Unclassified 584
432 Ga0373927_0006052 3300035695 Bacteria 8289
433 Ga0373927_0047369 3300035695 Bacteria 2781
434 Ga0373947_0740032 3300035725 Unclassified 671
435 Ga0395905_0769303 3300037471 Bacteria 866
436 Ga0242419_006542 3300038698 Unclassified 848
437 Ga0242420_001946 3300038996 Bacteria 2867
438 Ga0242420_004564 3300038996 Unclassified 2101
439 Ga0242420_031682 3300038996 Bacteria 983
440 Ga0439448_0140048 3300042005 Unclassified 837
441 Ga0439449_0267080 3300042007 Unclassified 644
442 Ga0439458_0002398 3300042157 Bacteria 4578
443 Ga0439458_0154840 3300042157 Unclassified 615
444 Ga0451577_0174754 3300042876 Bacteria 1936
445 Ga0453683_0193352 3300044673 Bacteria 1291
446 Ga0451576_0155773 3300045051 Bacteria 2383
447 Ga0451576_0616665 3300045051 Bacteria 1140
448 Ga0451576_0756291 3300045051 Unclassified 1021
449 Ga0451576_1029693 3300045051 Unclassified 863
450 Ga0451576_2320096 3300045051 Unclassified 550
451 Ga0495580_0253403 3300046472 Unclassified 1205
452 Ga0495582_0005292 3300046473 Bacteria 7211
453 Ga0495665_0025091 3300046531 Bacteria 3204
454 Ga0495634_0043922 3300046642 Bacteria 3027
455 Ga0495588_0284562 3300046674 Unclassified 871
456 Ga0495636_0034070 3300047318 Bacteria 2095
457 Ga0495636_0232400 3300047318 Unclassified 849
458 Ga0495674_0248946 3300047319 Unclassified 1463
459 Ga0495674_0515470 3300047319 Bacteria 955
460 Ga0496102_0022482 3300048905 Bacteria 5588
461 Ga0496103_0502954 3300048906 Unclassified 775
462 Ga0496104_0291539 3300048907 Bacteria 1544
463 Ga0496104_0394004 3300048907 Unclassified 1297
464 Ga0496104_1740370 3300048907 Unclassified 526
465 Ga0496106_0020739 3300048909 Bacteria 4877
466 Ga0496106_0441735 3300048909 Unclassified 1045
467 Ga0496108_0101474 3300048911 Bacteria 2455
468 Ga0496108_0215382 3300048911 Unclassified 1668
469 Ga0496108_0241511 3300048911 Bacteria 1571
470 Ga0496110_0452376 3300048913 Bacteria 1170
471 Ga0496110_1918248 3300048913 Unclassified 502
472 Ga0496112_0054595 3300048915 Bacteria 3926
473 Ga0496112_0681751 3300048915 Unclassified 956
474 Ga0496112_1277606 3300048915 Unclassified 650
475 Ga0496113_0203025 3300048916 Bacteria 1576
476 Ga0496113_0559587 3300048916 Bacteria 917
477 Ga0496113_0970314 3300048916 Bacteria 670
478 Ga0501292_107326 3300049515 Unclassified 559
479 Ga0501299_193694 3300049522 Unclassified 537
480 Ga0501041_0705285 3300049577 Unclassified 646
481 Ga0501067_0788652 3300049583 Unclassified 535
482 Ga0501198_011462 3300049649 Bacteria 1323
483 Ga0501202_005001 3300049652 Bacteria 2336
484 Ga0501206_110493 3300049653 Unclassified 508
485 Ga0501207_002251 3300049654 Bacteria 2476
486 Ga0501214_085290 3300049659 Unclassified 537
487 Ga0501216_003553 3300049660 Bacteria 2279
488 Ga0501217_011771 3300049661 Unclassified 1940
489 Ga0501223_001695 3300049663 Bacteria 5042
490 Ga0501227_010820 3300049665 Bacteria 1981
491 Ga0501233_010293 3300049668 Bacteria 1839
492 Ga0501240_005293 3300049673 Bacteria 1539
493 Ga0501243_050913 3300049675 Unclassified 747
494 Ga0501246_012601 3300049676 Unclassified 796
495 Ga0501259_026211 3300049688 Bacteria 1072
496 Ga0501221_100836 3300049704 Unclassified 717
497 Ga0501225_0020937 3300049705 Bacteria 1807
498 Ga0501234_000759 3300049707 Bacteria 5004
499 Ga0501212_005659 3300049851 Bacteria 1658
500 Ga0501226_000397 3300049853 Bacteria 6291
501 nmdc:mga05p37_49976_c1 3300050507 Bacteria 5143
502 nmdc:mga05p37_740378_c1 3300050507 Unclassified 1085
503 nmdc:mga0n895_102804_c1 3300050512 Bacteria 2868
504 nmdc:mga0n895_294680_c1 3300050512 Unclassified 1645
505 nmdc:mga0rr50_214354_c1 3300050513 Unclassified 1587
506 nmdc:mga0a205_192149_c1 3300050515 Unclassified 1933
507 nmdc:mga0a205_36669_c2 3300050515 Bacteria 4370
508 nmdc:mga0a205_81342_c1 3300050515 Bacteria 3129
509 Ga0590071_000311 3300059421 Bacteria 14228
510 Ga0590074_008410 3300059423 Unclassified 1718
511 Ga0590075_000976 3300059424 Bacteria 7416
512 Ga0590077_000605 3300059426 Bacteria 9719
513 Ga0530510_1306312 3300061734 Bacteria 556
514 Ga0065715_11014640
515 JGI24751J29686_10000024
516 JGI25406J46586_10139654
517 rootH2_10312485
518 Ga0065714_10189564
519 Ga0065704_10157689
520 Ga0065704_10266719
521 Ga0065704_10439994
522 Ga0065704_10699048
523 Ga0065712_10076217
524 Ga0065712_10220212
525 Ga0065712_10826414
526 Ga0065715_10096605
527 Ga0065715_10262672
528 Ga0065715_10302971
529 Ga0065715_10469853
530 Ga0065707_10007500
531 Ga0065707_10019323
532 Ga0070676_10133921
533 Ga0070690_100066203
534 Ga0070690_100217881
535 Ga0070670_100000029
536 Ga0070670_100459409
537 Ga0070670_100835388
538 Ga0068869_100081786
539 Ga0068869_100360336
540 Ga0068869_100498179
541 Ga0068869_100727637
542 Ga0068869_101637825
543 Ga0070680_100005398
544 Ga0070682_100030067
545 Ga0068868_101583216
546 Ga0070689_100119820
547 Ga0070692_10209914
548 Ga0070692_11125100
549 Ga0070669_100866534
550 Ga0070673_100146724
551 Ga0070673_100681113
552 Ga0070673_101078853
553 Ga0070659_100252346
554 Ga0070659_100540617
555 Ga0070703_10046514
556 Ga0070709_10158453
557 Ga0070714_100001370
558 Ga0070713_100010976
559 Ga0070711_100049673
560 Ga0070711_100138617
561 Ga0070711_100205482
562 Ga0070705_100049390
563 Ga0070705_100117242
564 Ga0070705_100165505
565 Ga0070705_100427139
566 Ga0070705_100443690
567 Ga0070705_101070938
568 Ga0070700_100240025
569 Ga0070700_100349629
570 Ga0070694_100034648
571 Ga0070694_100086501
572 Ga0070694_100245848
573 Ga0070694_100387603
574 Ga0070694_100544048
575 Ga0070694_100621374
576 Ga0070694_100751392
577 Ga0070694_101882280
578 Ga0070678_102007877
579 Ga0070681_10003300
580 Ga0070681_10004020
581 Ga0070681_10017605
582 Ga0068867_100144817
583 Ga0070685_10381858
584 Ga0070706_100038591
585 Ga0070707_100080760
586 Ga0070707_101076084
587 Ga0070698_100115649
588 Ga0070699_100041322
589 Ga0070699_100147409
590 Ga0070699_100233868
591 Ga0070699_101363869
592 Ga0070679_100000052
593 Ga0070679_100139949
594 Ga0070686_101310092
595 Ga0070695_100048398
596 Ga0070695_100119073
597 Ga0070695_100193193
598 Ga0070695_100224492
599 Ga0070695_100287879
600 Ga0070695_100316765
601 Ga0070695_100521314
602 Ga0070695_101060406
603 Ga0070695_101353719
604 Ga0070695_101467129
605 Ga0070695_101550989
606 Ga0070695_101872359
607 Ga0070696_100111840
608 Ga0070696_100198154
609 Ga0070696_100311328
610 Ga0070696_100505371
611 Ga0070693_100009641
612 Ga0070693_100009827
613 Ga0070693_100227919
614 Ga0070693_100799880
615 Ga0070704_100051715
616 Ga0070704_100392732
617 Ga0070704_101303491
618 Ga0068855_102211338
619 Ga0068855_102324444
620 Ga0070664_100374526
621 Ga0068857_100040724
622 Ga0068857_100696676
623 Ga0068857_100731381
624 Ga0068857_101380241
625 Ga0068857_102427375
626 Ga0068854_101457828
627 Ga0068854_102249365
628 Ga0068856_100005380
629 Ga0070702_100218415
630 Ga0070702_100376794
631 Ga0070702_100403692
632 Ga0070702_101291692
633 Ga0070702_101329041
634 Ga0068859_100086271
635 Ga0068859_100100964
636 Ga0068859_100412451
637 Ga0068859_100738112
638 Ga0068859_100868323
639 Ga0068864_100016376
640 Ga0068864_100083441
641 Ga0068864_100173056
642 Ga0068864_100387182
643 Ga0068864_100443750
644 Ga0068864_100590913
645 Ga0068864_100651021
646 Ga0068866_10538321
647 Ga0068861_102393998
648 Ga0068851_10020258
649 Ga0068863_100070159
650 Ga0068863_100098664
651 Ga0068863_100268544
652 Ga0068863_100580192
653 Ga0068863_100620713
654 Ga0068863_100765903
655 Ga0068863_100846190
656 Ga0068863_101385358
657 Ga0068858_100024132
658 Ga0068858_100211855
659 Ga0068858_100520800
660 Ga0068858_100682719
661 Ga0068858_101069465
662 Ga0068858_101207832
663 Ga0068858_101424966
664 Ga0068860_100051812
665 Ga0068860_100064067
666 Ga0068860_100094320
667 Ga0068860_100139553
668 Ga0068860_101150059
669 Ga0068862_100641812
670 Ga0081455_10011957
671 Ga0081539_10007208
672 Ga0070715_10208572
673 Ga0070716_100013511
674 Ga0070716_100041697
675 Ga0070716_100074563
676 Ga0070716_100610007
677 Ga0070716_101347458
678 Ga0070712_101750557
679 Ga0097621_100027684
680 Ga0097621_100035088
681 Ga0097621_100179280
682 Ga0068871_100004189
683 Ga0068871_100029282
684 Ga0068871_100032680
685 Ga0068871_100358089
686 Ga0075433_10038223
687 Ga0075433_10128992
688 Ga0075433_10366362
689 Ga0075433_10453315
690 Ga0075433_11186566
691 Ga0075433_11324522
692 Ga0075433_11405622
693 Ga0075434_100025315
694 Ga0075434_100045653
695 Ga0068865_100320408
696 Ga0068865_100918931
697 Ga0075436_101000919
698 Ga0097620_100086270
699 Ga0097620_100100958
700 Ga0097620_100412425
701 Ga0097620_100738140
702 Ga0097620_100868466
703 Ga0105251_10460698
704 Ga0105240_10081300
705 Ga0105240_10201545
706 Ga0105245_10218578
707 Ga0105245_10982978
708 Ga0105245_11104957
709 Ga0105245_11465930
710 Ga0105245_12525096
711 Ga0105247_10000326
712 Ga0105247_10108701
713 Ga0105247_10126955
714 Ga0105247_10672154
715 Ga0105247_10739174
716 Ga0105247_10759463
717 Ga0114129_10030268
718 Ga0114129_10036932
719 Ga0105243_10006689
720 Ga0105243_10042719
721 Ga0105243_10185808
722 Ga0105243_10844558
723 Ga0105241_10015272
724 Ga0105241_10040668
725 Ga0105241_10046806
726 Ga0105241_10049031
727 Ga0105241_10349720
728 Ga0105241_10492754
729 Ga0105241_10645738
730 Ga0105241_10788883
731 Ga0105241_10792389
732 Ga0105241_10804646
733 Ga0105241_11457815
734 Ga0105241_12385151
735 Ga0105242_10003233
736 Ga0105242_10097197
737 Ga0105242_10232008
738 Ga0105242_10890768
739 Ga0105242_12784837
740 Ga0105248_10047855
741 Ga0105248_10060546
742 Ga0105248_10094402
743 Ga0105248_10312563
744 Ga0105248_10373583
745 Ga0105248_10401479
746 Ga0105248_10585527
747 Ga0105237_10003293
748 Ga0105237_10130804
749 Ga0105237_10174393
750 Ga0105237_10362566
751 Ga0105237_10383312
752 Ga0105237_11939271
753 Ga0105237_11957926
754 Ga0105238_10000459
755 Ga0105238_10140359
756 Ga0105238_10280281
757 Ga0105238_10536547
758 Ga0105249_10010826
759 Ga0105249_10039846
760 Ga0105249_10070924
761 Ga0105249_10489782
762 Ga0105239_10099847
763 Ga0105239_10404684
764 Ga0105239_11072408
765 Ga0105239_13011772
766 Ga0105246_10027123
767 Ga0105246_10040193
768 Ga0105246_10075117
769 Ga0105246_10082250
770 Ga0105246_11856416
771 Ga0157373_10139707
772 Ga0157373_10613496
773 Ga0157371_10288952
774 Ga0157371_10327878
775 Ga0157371_11341356
776 Ga0157374_10809870
777 Ga0157374_11300284
778 Ga0157378_10000105
779 Ga0157378_10003812
780 Ga0157378_10182557
781 Ga0157378_10221291
782 Ga0157378_10581201
783 Ga0163162_10005772
784 Ga0163162_10189447
785 Ga0163162_10203288
786 Ga0163162_10915387
787 Ga0163162_11357758
788 Ga0157372_10048367
789 Ga0157372_11076570
790 Ga0157375_10068684
791 Ga0157375_13686513
792 Ga0163163_10000235
793 Ga0163163_10003844
794 Ga0163163_10062431
795 Ga0163163_10091190
796 Ga0163163_11685174
797 Ga0157380_13045079
798 Ga0157380_13352041
799 Ga0157377_10754280
800 Ga0157377_10763079
801 Ga0157377_10880885
802 Ga0157379_10132622
803 Ga0157379_10344288
804 Ga0157379_10860301
805 Ga0157376_10225752
806 Ga0157376_10413492
807 Ga0182007_10130026
808 Ga0182007_10153594
809 Ga0163161_11905858
810 Ga0207656_10012806
811 Ga0207653_10005200
812 Ga0207642_10446565
813 Ga0207710_10000291
814 Ga0207710_10135600
815 Ga0207710_10476484
816 Ga0207680_10719845
817 Ga0207647_10042305
818 Ga0207647_10377001
819 Ga0207685_10137560
820 Ga0207699_10174721
821 Ga0207645_10139767
822 Ga0207643_10052009
823 Ga0207684_10014122
824 Ga0207654_10036950
825 Ga0207654_10132335
826 Ga0207654_10301948
827 Ga0207654_10538965
828 Ga0207654_10681489
829 Ga0207654_10727020
830 Ga0207654_10852220
831 Ga0207654_10859308
832 Ga0207654_11357767
833 Ga0207707_10000014
834 Ga0207707_10041783
835 Ga0207707_10053037
836 Ga0207695_10277177
837 Ga0207695_10383520
838 Ga0207671_10023996
839 Ga0207671_10154395
840 Ga0207693_10086092
841 Ga0207663_10095428
842 Ga0207663_10173783
843 Ga0207663_10189944
844 Ga0207660_10002404
845 Ga0207660_10312840
846 Ga0207652_10000031
847 Ga0207652_10162540
848 Ga0207652_11230976
849 Ga0207646_10169499
850 Ga0207646_11153881
851 Ga0207681_10423674
852 Ga0207694_10010422
853 Ga0207694_10278096
854 Ga0207650_10000005
855 Ga0207687_10004205
856 Ga0207687_10397884
857 Ga0207700_10031261
858 Ga0207664_10024097
859 Ga0207690_11472366
860 Ga0207686_10011703
861 Ga0207686_11329996
862 Ga0207709_10003287
863 Ga0207709_10036836
864 Ga0207709_10593204
865 Ga0207670_10216118
866 Ga0207670_11390818
867 Ga0207704_11428759
868 Ga0207665_10085116
869 Ga0207665_10088559
870 Ga0207711_10077929
871 Ga0207711_10242552
872 Ga0207711_10765479
873 Ga0207711_10776303
874 Ga0207711_10777035
875 Ga0207711_11709233
876 Ga0207689_10043052
877 Ga0207689_10048093
878 Ga0207689_10240518
879 Ga0207689_10375144
880 Ga0207689_10389294
881 Ga0207689_11078770
882 Ga0207689_11631198
883 Ga0207679_10511038
884 Ga0207679_10628237
885 Ga0207667_10778302
886 Ga0207667_12075828
887 Ga0207651_10257780
888 Ga0207651_10966658
889 Ga0207712_10010848
890 Ga0207640_10539019
891 Ga0207640_12149096
892 Ga0207677_10449078
893 Ga0207677_11529688
894 Ga0207703_10050302
895 Ga0207703_10164786
896 Ga0207703_10198042
897 Ga0207703_10253177
898 Ga0207708_10013886
899 Ga0207702_10037207
900 Ga0207702_10543516
901 Ga0207641_10090560
902 Ga0207641_10101124
903 Ga0207641_10673484
904 Ga0207641_12095657
905 Ga0207648_10105942
906 Ga0207648_10215232
907 Ga0207676_10021063
908 Ga0207676_10172029
909 Ga0207676_10222467
910 Ga0207676_10914389
911 Ga0207676_11380192
912 Ga0207676_12239047
913 Ga0207674_10029883
914 Ga0207674_10033731
915 Ga0207674_10505554
916 Ga0207674_11881164
917 Ga0207675_100707137
918 Ga0207675_101746038
919 Ga0207698_10158986
920 Ga0207698_11446508
921 Ga0207698_12297669
922 Ga0207698_12342150
923 Ga0268265_10351182
924 Ga0268265_11749548
925 Ga0268264_10030201
926 Ga0268264_10038533
927 Ga0268264_10054010
928 Ga0268264_10080254
929 Ga0268264_12067419
930 Ga0307408_100002979
931 Ga0307405_10704678
932 Ga0307413_10473539
933 Ga0307410_10114935
934 Ga0307410_10204684
935 Ga0307406_10029262
936 Ga0307412_10519640
937 Ga0307409_100119317
938 Ga0307416_100422659
939 Ga0307414_10085654
940 Ga0307411_10017803
941 Ga0307411_10284403
942 Ga0307415_100000420
943 Ga0373956_0404621
944 Ga0373957_0409365
945 Ga0373927_0006052
946 Ga0373927_0047369
947 Ga0373947_0740032
948 Ga0395905_0769303
949 Ga0242419_006542
950 Ga0242420_001946
951 Ga0242420_004564
952 Ga0242420_031682
953 Ga0439448_0140048
954 Ga0439449_0267080
955 Ga0439458_0002398
956 Ga0439458_0154840
957 Ga0451577_0174754
958 Ga0453683_0193352
959 Ga0451576_0155773
960 Ga0451576_0616665
961 Ga0451576_0756291
962 Ga0451576_1029693
963 Ga0451576_2320096
964 Ga0495580_0253403
965 Ga0495582_0005292
966 Ga0495665_0025091
967 Ga0495634_0043922
968 Ga0495588_0284562
969 Ga0495636_0034070
970 Ga0495636_0232400
971 Ga0495674_0248946
972 Ga0495674_0515470
973 Ga0496102_0022482
974 Ga0496103_0502954
975 Ga0496104_0291539
976 Ga0496104_0394004
977 Ga0496104_1740370
978 Ga0496106_0020739
979 Ga0496106_0441735
980 Ga0496108_0101474
981 Ga0496108_0215382
982 Ga0496108_0241511
983 Ga0496110_0452376
984 Ga0496110_1918248
985 Ga0496112_0054595
986 Ga0496112_0681751
987 Ga0496112_1277606
988 Ga0496113_0203025
989 Ga0496113_0559587
990 Ga0496113_0970314
991 Ga0501292_107326
992 Ga0501299_193694
993 Ga0501041_0705285
994 Ga0501067_0788652
995 Ga0501198_011462
996 Ga0501202_005001
997 Ga0501206_110493
998 Ga0501207_002251
999 Ga0501214_085290
1000 Ga0501216_003553
1001 Ga0501217_011771
1002 Ga0501223_001695
1003 Ga0501227_010820
1004 Ga0501233_010293
1005 Ga0501240_005293
1006 Ga0501243_050913
1007 Ga0501246_012601
1008 Ga0501259_026211
1009 Ga0501221_100836
1010 Ga0501225_0020937
1011 Ga0501234_000759
1012 Ga0501212_005659
1013 Ga0501226_000397
1014 nmdc:mga05p37_49976_c1
1015 nmdc:mga05p37_740378_c1
1016 nmdc:mga0n895_102804_c1
1017 nmdc:mga0n895_294680_c1
1018 nmdc:mga0rr50_214354_c1
1019 nmdc:mga0a205_192149_c1
1020 nmdc:mga0a205_36669_c2
1021 nmdc:mga0a205_81342_c1
1022 Ga0590071_000311
1023 Ga0590074_008410
1024 Ga0590075_000976
1025 Ga0590077_000605
1026 Ga0530510_1306312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

4

38

0.97

Map