F457457

General Info

Members Datasets Scaffolds Average Seq Length
512 220 490 262

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000482|Ga0395901_0000482_15080_15904
Length 274
Sequence MKAISSRDNPLYKELKLLAGSSQARRKAGRTLLDGIHLCQTYLQHAGAPALCVVATGSRDHPEVVAIAAACERAQTRCILLPDTLYGALSQVENGVGLLFLVDTPQIQAPRILNQDAILLDGLQDPGNLGSILRSAAAAGIRQVFCGKGTVFAWSPKVLRAGMGAHFLLQIFEHADLSELMEHAAIPVLATSSHARQQIYDIDLRSPSAWLFGHEGQGVSEALLRMTAHRLSVPHLGPVESLNVAASAAVCLFEQVRQRLPQTAGADSSGRFSR

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541297 Duganella sp. GV083 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543026 Duganella sp. GV089 Isolate Unclassified
11 2738543029 Duganella sp. GV039 Isolate Unclassified
12 2821131069 Duganella sp. 1224 Isolate Unclassified
13 2842711865 Duganella sp. R-73148 Isolate Unclassified
14 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
15 2857553236 Duganella sp. R-74557 Isolate Unclassified
16 2857558681 Duganella sp. R-74565 Isolate Unclassified
17 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
18 2904424332 Duganella sp. 1411 Isolate Rhizosphere
19 2919476304 Duganella sp. 3397 Isolate Unclassified
20 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
21 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
105 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
205 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
208 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
209 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
214 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.73
Metatranscriptomes 0.98
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.58
Nodule 0.78
Rhizoplane 3.32
Rhizosphere 69.92
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1006937 3300002739 Bacteria 1612
2 JGI25152J39213_1000479 3300002773 Bacteria 22872
3 JGI25150J39212_1000814 3300002774 Bacteria 10539
4 JGI25159J45721_1006911 3300002987 Bacteria 3319
5 JGI25159J45721_1008077 3300002987 Bacteria 2931
6 JGI25153J46596_10001711 3300003215 Bacteria 12997
7 JGI25153J46596_10053510 3300003215 Bacteria 1141
8 rootL2_10064296 3300003322 Bacteria 3329
9 rootL2_10113386 3300003322 Bacteria 4980
10 JGI25160J50197_1009956 3300003354 Bacteria 3479
11 JGI25161J50226_1001293 3300003374 Bacteria 7945
12 JGI25161J50226_1001334 3300003374 Bacteria 7604
13 Ga0055525_1000001 3300003759 Bacteria 1016948
14 Ga0055526_1000373 3300003771 Bacteria 36351
15 Ga0055526_1001922 3300003771 Bacteria 14367
16 Ga0055526_1005082 3300003771 Bacteria 7679
17 Ga0055526_1007865 3300003771 Bacteria 5446
18 Ga0055537_1000536 3300003773 Bacteria 22027
19 Ga0055537_1002665 3300003773 Bacteria 5828
20 Ga0055537_1008944 3300003773 Bacteria 2256
21 Ga0055524_1000010 3300003775 Bacteria 282893
22 Ga0055524_1001842 3300003775 Bacteria 11609
23 Ga0055524_1004080 3300003775 Bacteria 6852
24 Ga0055534_1000314 3300003784 Bacteria 32324
25 Ga0055534_1002713 3300003784 Bacteria 5968
26 Ga0055534_1010182 3300003784 Bacteria 1989
27 Ga0055528_1000127 3300003790 Bacteria 61277
28 Ga0055530_10006155 3300003791 Bacteria 5446
29 Ga0055530_10009821 3300003791 Bacteria 3617
30 Ga0055530_10010237 3300003791 Bacteria 3493
31 Ga0055531_10010020 3300003794 Bacteria 4768
32 Ga0055531_10019872 3300003794 Bacteria 2690
33 Ga0055543_1001627 3300004625 Bacteria 8579
34 Ga0055543_1003127 3300004625 Bacteria 5066
35 Ga0055543_1030298 3300004625 Bacteria 946
36 Ga0055543_1031794 3300004625 Bacteria 919
37 Ga0065165_1000007 3300005262 Bacteria 337871
38 Ga0065165_1006178 3300005262 Bacteria 6392
39 Ga0065165_1051498 3300005262 Bacteria 1167
40 Ga0065165_1071623 3300005262 Bacteria 919
41 Ga0070660_100008672 3300005339 Bacteria 7122
42 Ga0070660_100014546 3300005339 Bacteria 5673
43 Ga0070660_100029249 3300005339 Bacteria 4127
44 Ga0070660_100211576 3300005339 Bacteria 1574
45 Ga0070661_100004451 3300005344 Bacteria 9660
46 Ga0070661_100039292 3300005344 Bacteria 3448
47 Ga0070659_100054084 3300005366 Bacteria 3161
48 Ga0070659_100069620 3300005366 Bacteria 2793
49 Ga0070663_100385228 3300005455 Bacteria 1143
50 Ga0070662_100054683 3300005457 Bacteria 2893
51 Ga0070662_100122666 3300005457 Bacteria 1993
52 Ga0070664_100182172 3300005564 Bacteria 1867
53 Ga0075362_10050022 3300006177 Bacteria 1868
54 Ga0079104_1006344 3300006946 Bacteria 4498
55 Ga0099826_10000002 3300006948 Bacteria 1125830
56 Ga0105244_10006542 3300009036 Bacteria 7517
57 Ga0105244_10026007 3300009036 Bacteria 3173
58 Ga0105244_10038138 3300009036 Bacteria 2507
59 Ga0105240_10251548 3300009093 Bacteria 2043
60 Ga0105243_10004986 3300009148 Bacteria 10407
61 Ga0105242_10099376 3300009176 Bacteria 2463
62 Ga0105239_10165906 3300010375 Bacteria 2469
63 Ga0105239_10609396 3300010375 Bacteria 1246
64 Ga0163162_10724306 3300013306 Bacteria 1115
65 Ga0182008_10003255 3300014497 Bacteria 9908
66 Ga0182006_1000043 3300015261 Bacteria 200870
67 Ga0182006_1000112 3300015261 Bacteria 87378
68 Ga0182007_10000020 3300015262 Bacteria 194053
69 Ga0182005_1000001 3300015265 Bacteria 1014869
70 Ga0182005_1000037 3300015265 Bacteria 166102
71 Ga0213872_10000385 3300021361 Bacteria 36978
72 Ga0213872_10002426 3300021361 Bacteria 10982
73 Ga0213872_10002679 3300021361 Bacteria 10303
74 Ga0213872_10160768 3300021361 Bacteria 977
75 Ga0209436_100479 3300025208 Bacteria 17653
76 Ga0209436_101373 3300025208 Bacteria 8591
77 Ga0209563_100007 3300025230 Bacteria 1579402
78 Ga0207425_1000001 3300025245 Bacteria 2525432
79 Ga0207425_1000147 3300025245 Bacteria 60295
80 Ga0207425_1000384 3300025245 Bacteria 29815
81 Ga0209646_1000106 3300025246 Bacteria 163422
82 Ga0209646_1000212 3300025246 Bacteria 64826
83 Ga0209677_103743 3300025253 Bacteria 4751
84 Ga0209148_1001738 3300025254 Bacteria 9491
85 Ga0209129_1000003 3300025258 Bacteria 903689
86 Ga0209129_1004051 3300025258 Bacteria 5974
87 Ga0209129_1015144 3300025258 Bacteria 1602
88 Ga0209565_1000202 3300025263 Bacteria 70900
89 Ga0209565_1000983 3300025263 Bacteria 14647
90 Ga0209565_1002408 3300025263 Bacteria 6772
91 Ga0209565_1003072 3300025263 Bacteria 5613
92 Ga0209565_1006392 3300025263 Bacteria 3310
93 Ga0209565_1006763 3300025263 Bacteria 3177
94 Ga0209565_1023107 3300025263 Bacteria 1280
95 Ga0209565_1037091 3300025263 Bacteria 924
96 Ga0209673_1000007 3300025273 Bacteria 634477
97 Ga0209673_1004884 3300025273 Bacteria 6991
98 Ga0209130_1000156 3300025284 Bacteria 101929
99 Ga0209130_1000990 3300025284 Bacteria 22166
100 Ga0209130_1001365 3300025284 Bacteria 16463
101 Ga0209130_1037278 3300025284 Bacteria 960
102 Ga0209675_1000009 3300025291 Bacteria 562872
103 Ga0209675_1003250 3300025291 Bacteria 7834
104 Ga0209675_1003673 3300025291 Bacteria 7171
105 Ga0209025_1001761 3300025294 Bacteria 25914
106 Ga0209564_1000011 3300025295 Bacteria 822327
107 Ga0209564_1000089 3300025295 Bacteria 249694
108 Ga0209564_1000203 3300025295 Bacteria 136358
109 Ga0209564_1001486 3300025295 Bacteria 23660
110 Ga0209564_1009456 3300025295 Bacteria 4635
111 Ga0209564_1039993 3300025295 Bacteria 1280
112 Ga0209758_1000020 3300025297 Bacteria 734220
113 Ga0209758_1000286 3300025297 Bacteria 99636
114 Ga0209050_1000058 3300025298 Bacteria 325558
115 Ga0209050_1001649 3300025298 Bacteria 22707
116 Ga0209050_1004999 3300025298 Bacteria 8622
117 Ga0209256_1000007 3300025299 Bacteria 1136599
118 Ga0209256_1000415 3300025299 Bacteria 66999
119 Ga0209256_1001989 3300025299 Bacteria 18379
120 Ga0209256_1002357 3300025299 Bacteria 15698
121 Ga0209256_1011807 3300025299 Bacteria 3439
122 Ga0207426_1001293 3300025302 Bacteria 21613
123 Ga0209257_1000003 3300025304 Bacteria 1702593
124 Ga0209257_1012839 3300025304 Bacteria 3807
125 Ga0207655_1030244 3300025728 Bacteria 2521
126 Ga0207705_10005721 3300025909 Bacteria 9284
127 Ga0207705_10301176 3300025909 Bacteria 1230
128 Ga0207657_10002268 3300025919 Bacteria 20858
129 Ga0207657_10007207 3300025919 Bacteria 11416
130 Ga0207657_10073423 3300025919 Bacteria 2891
131 Ga0207657_10074523 3300025919 Bacteria 2866
132 Ga0207649_10050757 3300025920 Bacteria 2567
133 Ga0207649_10087642 3300025920 Bacteria 2031
134 Ga0207690_10013710 3300025932 Bacteria 4878
135 Ga0207690_10275713 3300025932 Bacteria 1308
136 Ga0207706_10133940 3300025933 Bacteria 2180
137 Ga0207686_10155309 3300025934 Bacteria 1598
138 Ga0207709_10027987 3300025935 Bacteria 3254
139 Ga0207679_10105252 3300025945 Bacteria 2215
140 Ga0207679_10150485 3300025945 Bacteria 1893
141 Ga0207667_10228455 3300025949 Bacteria 1906
142 Ga0207667_10535822 3300025949 Bacteria 1185
143 Ga0209281_1005163 3300027111 Bacteria 3689
144 Ga0209282_1000001 3300027666 Bacteria 2450367
145 Ga0307408_100000269 3300031548 Bacteria 52322
146 Ga0307408_100001036 3300031548 Bacteria 21360
147 Ga0307408_100076425 3300031548 Bacteria 2491
148 Ga0307408_100267789 3300031548 Bacteria 1417
149 Ga0265314_10127299 3300031711 Bacteria 1593
150 Ga0307416_100004120 3300032002 Bacteria 8705
151 Ga0307416_100685010 3300032002 Bacteria 1113
152 Ga0307414_10132138 3300032004 Bacteria 1939
153 Ga0373937_0035463 3300036401 Bacteria 4541
154 Ga0395899_0002338 3300037312 Bacteria 15438
155 Ga0395899_0002802 3300037312 Bacteria 14049
156 Ga0395899_0013536 3300037312 Bacteria 6236
157 Ga0395899_0015214 3300037312 Bacteria 5866
158 Ga0395899_0052736 3300037312 Bacteria 3013
159 Ga0395899_0144341 3300037312 Bacteria 1691
160 Ga0395899_0193207 3300037312 Bacteria 1423
161 Ga0395900_0000402 3300037418 Bacteria 62208
162 Ga0395900_0025798 3300037418 Bacteria 6015
163 Ga0395900_0051769 3300037418 Bacteria 4228
164 Ga0395900_0052005 3300037418 Bacteria 4218
165 Ga0395900_0076389 3300037418 Bacteria 3442
166 Ga0395900_0090748 3300037418 Bacteria 3140
167 Ga0395900_0095328 3300037418 Bacteria 3057
168 Ga0395900_0113362 3300037418 Bacteria 2783
169 Ga0395900_0161451 3300037418 Bacteria 2285
170 Ga0395900_0175069 3300037418 Bacteria 2182
171 Ga0395900_0343270 3300037418 Bacteria 1468
172 Ga0395900_0381389 3300037418 Bacteria 1377
173 Ga0395898_0039091 3300037466 Bacteria 4698
174 Ga0395898_0067807 3300037466 Bacteria 3453
175 Ga0395898_0133256 3300037466 Bacteria 2379
176 Ga0395898_0142160 3300037466 Bacteria 2297
177 Ga0395898_0242900 3300037466 Bacteria 1717
178 Ga0395898_0554514 3300037466 Bacteria 1091
179 Ga0395905_0002037 3300037471 Bacteria 23101
180 Ga0395905_0004238 3300037471 Bacteria 14995
181 Ga0395905_0022385 3300037471 Bacteria 5978
182 Ga0395905_0066240 3300037471 Bacteria 3383
183 Ga0395905_0107776 3300037471 Bacteria 2615
184 Ga0395905_0120568 3300037471 Bacteria 2465
185 Ga0395905_0190985 3300037471 Bacteria 1921
186 Ga0395905_0432849 3300037471 Bacteria 1212
187 Ga0395905_0729129 3300037471 Bacteria 893
188 Ga0395901_0000482 3300038443 Bacteria 46374
189 Ga0395901_0001370 3300038443 Bacteria 25495
190 Ga0395901_0019840 3300038443 Bacteria 6876
191 Ga0395901_0032932 3300038443 Bacteria 5347
192 Ga0395901_0098860 3300038443 Bacteria 3059
193 Ga0395901_0154745 3300038443 Bacteria 2408
194 Ga0395901_0168113 3300038443 Bacteria 2301
195 Ga0395901_0224276 3300038443 Bacteria 1964
196 Ga0395901_0370616 3300038443 Bacteria 1475
197 Ga0395901_0406374 3300038443 Bacteria 1398
198 Ga0395901_0411367 3300038443 Bacteria 1388
199 Ga0436361_0089764 3300039447 Bacteria 1955
200 Ga0436361_0603514 3300039447 Bacteria 10177
201 Ga0436361_0832327 3300039447 Bacteria 1881
202 Ga0436361_1198581 3300039447 Bacteria 6285
203 Ga0439448_0000980 3300042005 Bacteria 7089
204 Ga0439448_0009404 3300042005 Bacteria 2880
205 Ga0439449_0071289 3300042007 Bacteria 1280
206 Ga0439455_0008418 3300042012 Bacteria 2211
207 Ga0439455_0018532 3300042012 Bacteria 1633
208 Ga0439455_0046830 3300042012 Bacteria 1121
209 Ga0450911_004977 3300042115 Bacteria 2113
210 Ga0450904_000096 3300042139 Bacteria 19926
211 Ga0439458_0028241 3300042157 Bacteria 1327
212 Ga0451577_0133767 3300042876 Bacteria 2226
213 Ga0466972_0000060 3300044658 Bacteria 109789
214 Ga0466972_0008060 3300044658 Bacteria 5280
215 Ga0466972_0008118 3300044658 Bacteria 5262
216 Ga0466965_0000632 3300044683 Bacteria 12876
217 Ga0466965_0002407 3300044683 Bacteria 7934
218 Ga0466965_0019600 3300044683 Bacteria 3248
219 Ga0466965_0082704 3300044683 Bacteria 1624
220 Ga0466965_0177248 3300044683 Bacteria 1123
221 Ga0466966_0013212 3300044684 Bacteria 5467
222 Ga0466966_0027793 3300044684 Bacteria 3688
223 Ga0466966_0029654 3300044684 Bacteria 3557
224 Ga0466966_0072750 3300044684 Bacteria 2151
225 Ga0466966_0129284 3300044684 Bacteria 1547
226 Ga0466961_0091532 3300044693 Bacteria 1920
227 Ga0466961_0108596 3300044693 Bacteria 1746
228 Ga0466961_0251572 3300044693 Bacteria 1085
229 Ga0466964_0003150 3300044706 Bacteria 5994
230 Ga0466964_0035879 3300044706 Bacteria 1985
231 Ga0466964_0079068 3300044706 Bacteria 1407
232 Ga0466964_0169243 3300044706 Bacteria 1027
233 Ga0453684_0435103 3300044712 Bacteria 1463
234 Ga0466968_0024678 3300044735 Bacteria 2458
235 Ga0466968_0146901 3300044735 Bacteria 1081
236 Ga0466970_0300638 3300044765 Bacteria 905
237 Ga0466957_0002869 3300044842 Bacteria 9335
238 Ga0466957_0024162 3300044842 Bacteria 3596
239 Ga0466960_0138855 3300044901 Bacteria 1289
240 Ga0466959_0010890 3300045049 Bacteria 6519
241 Ga0466959_0237268 3300045049 Bacteria 1260
242 Ga0466958_0068491 3300045836 Bacteria 2169
243 Ga0466958_0237900 3300045836 Bacteria 1163
244 Ga0466967_0004678 3300045976 Bacteria 9293
245 Ga0466967_0046064 3300045976 Bacteria 3794
246 Ga0495617_000062 3300046452 Bacteria 96803
247 Ga0495617_006377 3300046452 Bacteria 4141
248 Ga0495627_000059 3300046453 Bacteria 142466
249 Ga0495627_042430 3300046453 Bacteria 1394
250 Ga0495590_0000002 3300046457 Bacteria 485720
251 Ga0495590_0000373 3300046457 Bacteria 22899
252 Ga0495638_0000072 3300046460 Bacteria 164926
253 Ga0495638_0030925 3300046460 Bacteria 3442
254 Ga0495653_0000023 3300046463 Bacteria 166207
255 Ga0495653_0145140 3300046463 Bacteria 1664
256 Ga0495650_0000019 3300046471 Bacteria 533849
257 Ga0495650_0000067 3300046471 Bacteria 269882
258 Ga0495650_0000224 3300046471 Bacteria 118058
259 Ga0495650_0000276 3300046471 Bacteria 98048
260 Ga0495650_0000750 3300046471 Bacteria 40552
261 Ga0495650_0003011 3300046471 Bacteria 12715
262 Ga0495650_0012920 3300046471 Bacteria 4455
263 Ga0495605_0000023 3300046474 Bacteria 236732
264 Ga0495605_0000919 3300046474 Bacteria 20230
265 Ga0495605_0017773 3300046474 Bacteria 3822
266 Ga0495639_0037596 3300046475 Bacteria 2170
267 Ga0495584_0001853 3300046491 Bacteria 12246
268 Ga0495584_0003055 3300046491 Bacteria 9296
269 Ga0495584_0003297 3300046491 Bacteria 8943
270 Ga0495584_0011480 3300046491 Bacteria 4538
271 Ga0495585_0001862 3300046492 Bacteria 15940
272 Ga0495594_0238390 3300046499 Bacteria 1037
273 Ga0495596_0011135 3300046500 Bacteria 3889
274 Ga0495607_0002037 3300046501 Bacteria 16926
275 Ga0495607_0004453 3300046501 Bacteria 10284
276 Ga0495607_0004730 3300046501 Bacteria 9954
277 Ga0495607_0007743 3300046501 Bacteria 7399
278 Ga0495607_0037691 3300046501 Bacteria 2902
279 Ga0495583_0000494 3300046506 Bacteria 57252
280 Ga0495583_0000649 3300046506 Bacteria 45956
281 Ga0495583_0002611 3300046506 Bacteria 15076
282 Ga0495583_0045706 3300046506 Bacteria 2023
283 Ga0495606_0000526 3300046507 Bacteria 61953
284 Ga0495606_0000834 3300046507 Bacteria 46481
285 Ga0495606_0000931 3300046507 Bacteria 43141
286 Ga0495606_0002107 3300046507 Bacteria 24200
287 Ga0495606_0002724 3300046507 Bacteria 19910
288 Ga0495606_0004578 3300046507 Bacteria 13718
289 Ga0495606_0010359 3300046507 Bacteria 7746
290 Ga0495606_0031294 3300046507 Bacteria 3702
291 Ga0495606_0203296 3300046507 Bacteria 1127
292 Ga0495606_0216701 3300046507 Bacteria 1081
293 Ga0495610_0000012 3300046512 Bacteria 517442
294 Ga0495610_0003343 3300046512 Bacteria 12590
295 Ga0495610_0003427 3300046512 Bacteria 12369
296 Ga0495610_0004322 3300046512 Bacteria 10549
297 Ga0495616_0000647 3300046513 Bacteria 25901
298 Ga0495616_0001174 3300046513 Bacteria 18490
299 Ga0495616_0027253 3300046513 Bacteria 3033
300 Ga0495616_0119465 3300046513 Bacteria 1218
301 Ga0495630_0067795 3300046517 Bacteria 2682
302 Ga0495632_0004300 3300046519 Bacteria 9714
303 Ga0495632_0140844 3300046519 Bacteria 1119
304 Ga0495637_0004843 3300046520 Bacteria 6928
305 Ga0495637_0008926 3300046520 Bacteria 4905
306 Ga0495643_0000312 3300046522 Bacteria 67022
307 Ga0495643_0001430 3300046522 Bacteria 22061
308 Ga0495643_0009492 3300046522 Bacteria 6044
309 Ga0495643_0020357 3300046522 Bacteria 3824
310 Ga0495643_0026402 3300046522 Bacteria 3278
311 Ga0495648_0000037 3300046524 Bacteria 195401
312 Ga0495648_0005438 3300046524 Bacteria 10578
313 Ga0495648_0009323 3300046524 Bacteria 7623
314 Ga0495648_0010335 3300046524 Bacteria 7118
315 Ga0495648_0024607 3300046524 Bacteria 4095
316 Ga0495663_0002295 3300046525 Bacteria 5798
317 Ga0495666_0028290 3300046526 Bacteria 2757
318 Ga0495642_0001598 3300046528 Bacteria 9911
319 Ga0495642_0002709 3300046528 Bacteria 7120
320 Ga0495642_0007545 3300046528 Bacteria 4167
321 Ga0495642_0021692 3300046528 Bacteria 2527
322 Ga0495652_0013032 3300046529 Bacteria 7494
323 Ga0495654_0000015 3300046530 Bacteria 307873
324 Ga0495654_0026211 3300046530 Bacteria 2999
325 Ga0495654_0032292 3300046530 Bacteria 2654
326 Ga0495654_0168023 3300046530 Bacteria 958
327 Ga0495665_0008591 3300046531 Bacteria 5542
328 Ga0495586_0004323 3300046535 Bacteria 7591
329 Ga0495609_0000019 3300046538 Bacteria 297777
330 Ga0495609_0003928 3300046538 Bacteria 8332
331 Ga0495609_0036242 3300046538 Bacteria 2228
332 Ga0495609_0086059 3300046538 Bacteria 1370
333 Ga0495597_0001102 3300046542 Bacteria 20452
334 Ga0495597_0001294 3300046542 Bacteria 18414
335 Ga0495597_0001837 3300046542 Bacteria 14516
336 Ga0495597_0061626 3300046542 Bacteria 1633
337 Ga0495622_0000117 3300046557 Bacteria 68927
338 Ga0495622_0000917 3300046557 Bacteria 15985
339 Ga0495622_0010370 3300046557 Bacteria 4309
340 Ga0495633_0002758 3300046558 Bacteria 12144
341 Ga0495633_0003472 3300046558 Bacteria 10479
342 Ga0495633_0008996 3300046558 Bacteria 5560
343 Ga0495633_0015140 3300046558 Bacteria 4007
344 Ga0495633_0020110 3300046558 Bacteria 3363
345 Ga0495633_0020787 3300046558 Bacteria 3295
346 Ga0495656_0020234 3300046615 Bacteria 2579
347 Ga0495656_0050606 3300046615 Bacteria 1775
348 Ga0495656_0150902 3300046615 Bacteria 1122
349 Ga0495668_0000028 3300046616 Bacteria 286629
350 Ga0495668_0000081 3300046616 Bacteria 157245
351 Ga0495668_0000170 3300046616 Bacteria 97074
352 Ga0495668_0001981 3300046616 Bacteria 17944
353 Ga0495668_0002045 3300046616 Bacteria 17556
354 Ga0495668_0004324 3300046616 Bacteria 10154
355 Ga0495668_0018854 3300046616 Bacteria 3986
356 Ga0495668_0082617 3300046616 Bacteria 1762
357 Ga0495634_0051744 3300046642 Bacteria 2756
358 Ga0495625_0000738 3300046660 Bacteria 45725
359 Ga0495625_0003266 3300046660 Bacteria 16390
360 Ga0495625_0013420 3300046660 Bacteria 6585
361 Ga0495625_0015431 3300046660 Bacteria 6051
362 Ga0495625_0019598 3300046660 Bacteria 5241
363 Ga0495625_0032775 3300046660 Bacteria 3848
364 Ga0495659_0000950 3300046664 Bacteria 10257
365 Ga0495661_0001518 3300046665 Bacteria 19291
366 Ga0495661_0001982 3300046665 Bacteria 16181
367 Ga0495661_0007763 3300046665 Bacteria 7469
368 Ga0495661_0007862 3300046665 Bacteria 7415
369 Ga0495661_0011701 3300046665 Bacteria 5945
370 Ga0495661_0021334 3300046665 Bacteria 4224
371 Ga0495661_0048045 3300046665 Bacteria 2594
372 Ga0495661_0053882 3300046665 Bacteria 2418
373 Ga0495588_0000110 3300046674 Bacteria 142825
374 Ga0495588_0018621 3300046674 Bacteria 3389
375 Ga0495588_0033116 3300046674 Bacteria 2608
376 Ga0495623_0039457 3300046679 Bacteria 3017
377 Ga0495669_0092370 3300046684 Bacteria 1398
378 Ga0495670_0146813 3300046691 Bacteria 1236
379 Ga0495671_0000006 3300046692 Bacteria 500471
380 Ga0495671_0033874 3300046692 Bacteria 2600
381 Ga0495671_0143049 3300046692 Bacteria 1165
382 Ga0495649_0008629 3300046694 Bacteria 6119
383 Ga0495649_0013492 3300046694 Bacteria 4713
384 Ga0495649_0025764 3300046694 Bacteria 3274
385 Ga0495649_0068690 3300046694 Bacteria 1901
386 Ga0495589_0000019 3300046794 Bacteria 200814
387 Ga0495589_0000078 3300046794 Bacteria 90390
388 Ga0495589_0095459 3300046794 Bacteria 1442
389 Ga0495660_0001199 3300046810 Bacteria 18152
390 Ga0495660_0002119 3300046810 Bacteria 12835
391 Ga0495660_0006752 3300046810 Bacteria 6770
392 Ga0495660_0007289 3300046810 Bacteria 6504
393 Ga0495660_0043702 3300046810 Bacteria 2469
394 Ga0495660_0130357 3300046810 Bacteria 1262
395 Ga0495636_0001452 3300047318 Bacteria 8973
396 Ga0495672_0000707 3300047320 Bacteria 36700
397 Ga0495672_0010109 3300047320 Bacteria 6752
398 Ga0495683_0040875 3300047323 Bacteria 2341
399 Ga0495687_000003 3300047443 Bacteria 859509
400 Ga0495687_000028 3300047443 Bacteria 293356
401 Ga0495687_001361 3300047443 Bacteria 22605
402 Ga0495687_015346 3300047443 Bacteria 3901
403 Ga0495687_019054 3300047443 Bacteria 3376
404 Ga0495687_019144 3300047443 Bacteria 3365
405 Ga0495687_025887 3300047443 Bacteria 2766
406 Ga0495675_0004466 3300047444 Bacteria 8470
407 Ga0495677_0000006 3300047445 Bacteria 199230
408 Ga0495677_0009148 3300047445 Bacteria 3660
409 Ga0495677_0034864 3300047445 Bacteria 1836
410 Ga0495677_0038686 3300047445 Bacteria 1743
411 Ga0495679_006542 3300047446 Bacteria 4989
412 Ga0495685_041365 3300047447 Bacteria 1575
413 Ga0495673_0000003 3300047469 Bacteria 1491337
414 Ga0495673_0000061 3300047469 Bacteria 230647
415 Ga0495673_0000482 3300047469 Bacteria 42471
416 Ga0495673_0046168 3300047469 Bacteria 1932
417 Ga0495681_0009544 3300047470 Bacteria 5963
418 Ga0495686_0009006 3300047472 Bacteria 7242
419 Ga0495686_0019696 3300047472 Bacteria 4506
420 Ga0495686_0064975 3300047472 Bacteria 2257
421 Ga0495602_0024394 3300048088 Bacteria 5868
422 Ga0495615_0000770 3300048090 Bacteria 4496
423 Ga0495626_0001006 3300048091 Bacteria 24207
424 Ga0495626_0001436 3300048091 Bacteria 18942
425 Ga0495626_0001679 3300048091 Bacteria 17068
426 Ga0495626_0050725 3300048091 Bacteria 1916
427 Ga0495626_0076751 3300048091 Bacteria 1491
428 Ga0496101_0172319 3300048904 Bacteria 1664
429 Ga0496102_0000064 3300048905 Bacteria 161979
430 Ga0496102_0074884 3300048905 Bacteria 3112
431 Ga0496102_0202535 3300048905 Bacteria 1871
432 Ga0496102_0433904 3300048905 Bacteria 1233
433 Ga0496103_0002045 3300048906 Bacteria 12944
434 Ga0496103_0036769 3300048906 Bacteria 2999
435 Ga0496103_0129735 3300048906 Bacteria 1610
436 Ga0496104_0193706 3300048907 Bacteria 1945
437 Ga0496106_0068464 3300048909 Bacteria 2707
438 Ga0496107_0178376 3300048910 Bacteria 1577
439 Ga0496110_0603143 3300048913 Bacteria 996
440 Ga0496111_0009750 3300048914 Bacteria 6420
441 Ga0496113_0002875 3300048916 Bacteria 10135
442 Ga0496114_0076055 3300048917 Bacteria 2829
443 Ga0496114_0084557 3300048917 Bacteria 2687
444 Ga0496117_0000094 3300048920 Bacteria 201853
445 Ga0496118_0000071 3300048921 Bacteria 201853
446 Ga0496120_0030167 3300048923 Bacteria 3301
447 Ga0496121_0024308 3300048924 Bacteria 5800
448 Ga0496121_0028994 3300048924 Bacteria 5134
449 Ga0496122_0001881 3300048925 Bacteria 31854
450 Ga0496122_0003123 3300048925 Bacteria 22187
451 Ga0496122_0017643 3300048925 Bacteria 6656
452 Ga0496122_0094582 3300048925 Bacteria 2022
453 Ga0496123_0002748 3300048926 Bacteria 21045
454 Ga0496123_0007315 3300048926 Bacteria 10468
455 Ga0496123_0131803 3300048926 Bacteria 1383
456 Ga0496124_0029289 3300048927 Bacteria 4909
457 Ga0496124_0034348 3300048927 Bacteria 4452
458 Ga0496124_0062512 3300048927 Bacteria 3115
459 Ga0496124_0096792 3300048927 Bacteria 2397
460 Ga0496124_0197648 3300048927 Bacteria 1532
461 Ga0496125_0001032 3300048928 Bacteria 43195
462 Ga0496125_0050523 3300048928 Bacteria 3442
463 Ga0496125_0056763 3300048928 Bacteria 3176
464 Ga0496125_0332165 3300048928 Bacteria 916
465 Ga0496126_0040743 3300048929 Bacteria 4304
466 Ga0496126_0285151 3300048929 Bacteria 1367
467 Ga0495678_000030 3300049459 Bacteria 217986
468 Ga0495678_001311 3300049459 Bacteria 20052
469 Ga0495678_001785 3300049459 Bacteria 15917
470 Ga0495678_067685 3300049459 Bacteria 1318
471 Ga0495682_0004334 3300049460 Bacteria 6100
472 Ga0501047_0081371 3300049581 Bacteria 3113
473 Ga0501222_006825 3300049662 Bacteria 1529
474 Ga0501227_049945 3300049665 Bacteria 1053
475 Ga0501249_006855 3300049679 Bacteria 2349
476 Ga0501269_000119 3300049766 Bacteria 24695
477 Ga0501279_000471 3300049775 Bacteria 5345
478 Ga0501280_000265 3300049776 Bacteria 13260
479 Ga0501035_0000878 3300049822 Bacteria 31885
480 Ga0501044_0049381 3300049823 Bacteria 4344
481 Ga0500618_000747 3300053125 Bacteria 18449
482 Ga0500618_018689 3300053125 Bacteria 1713
483 Ga0500586_000768 3300053145 Bacteria 6577
484 Ga0587066_002247 3300059490 Bacteria 2097
485 Ga0587080_026178 3300059503 Bacteria 989
486 Ga0587094_003660 3300059513 Bacteria 1693
487 Ga0587076_002986 3300059645 Bacteria 1965
488 Ga0587111_0001000 3300060346 Bacteria 3154
489 Ga0466962_0007329 3300061719 Bacteria 5294
490 Ga0466962_0083878 3300061719 Bacteria 1524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046500 Ga0495596_0011135 Ga0495596_0011135_3181_3873 229
2 3300044683 Ga0466965_0019600 Ga0466965_0019600_1705_2499 247
3 3300044842 Ga0466957_0024162 Ga0466957_0024162_2085_2879 247
4 iso_pu_bacteria 8047673197 8047673231 252
5 3300047447 Ga0495685_041365 Ga0495685_041365_466_1233 255
6 3300003322 rootL2_10113386 rootL2_101133863 256
7 3300042012 Ga0439455_0046830 Ga0439455_0046830_145_924 256
8 3300042115 Ga0450911_004977 Ga0450911_004977_205_984 256
9 3300044658 Ga0466972_0008118 Ga0466972_0008118_317_1108 256
10 3300044683 Ga0466965_0002407 Ga0466965_0002407_5241_6032 256
11 3300044684 Ga0466966_0013212 Ga0466966_0013212_2162_2941 256
12 3300044693 Ga0466961_0091532 Ga0466961_0091532_563_1342 256
13 3300044706 Ga0466964_0035879 Ga0466964_0035879_755_1534 256
14 3300044735 Ga0466968_0146901 Ga0466968_0146901_216_995 256
15 3300044901 Ga0466960_0138855 Ga0466960_0138855_315_1094 256
16 3300045049 Ga0466959_0237268 Ga0466959_0237268_16_795 256
17 3300045836 Ga0466958_0068491 Ga0466958_0068491_647_1426 256
18 3300046507 Ga0495606_0203296 Ga0495606_0203296_140_919 256
19 3300046513 Ga0495616_0119465 Ga0495616_0119465_14_793 256
20 3300046528 Ga0495642_0001598 Ga0495642_0001598_4509_5300 256
21 3300046665 Ga0495661_0053882 Ga0495661_0053882_1219_1998 256
22 3300046810 Ga0495660_0043702 Ga0495660_0043702_297_1076 256
23 3300048925 Ga0496122_0001881 Ga0496122_0001881_26906_27682 256
24 3300048926 Ga0496123_0007315 Ga0496123_0007315_3296_4072 256
25 3300048927 Ga0496124_0197648 Ga0496124_0197648_611_1402 256
26 3300037312 Ga0395899_0144341 Ga0395899_0144341_754_1533 257
27 3300037312 Ga0395899_0193207 Ga0395899_0193207_571_1350 257
28 3300037418 Ga0395900_0090748 Ga0395900_0090748_905_1684 257
29 3300037466 Ga0395898_0133256 Ga0395898_0133256_723_1502 257
30 3300038443 Ga0395901_0154745 Ga0395901_0154745_229_1008 257
31 3300049776 Ga0501280_000265 Ga0501280_000265_5426_6202 257
32 iso_pu_bacteria 2600255292 2601669114 257
33 iso_pu_bacteria 2643221554 2643790509 257
34 iso_pu_bacteria 2643221603 2644027260 257
35 iso_pu_bacteria 2643221638 2644211449 257
36 iso_pu_bacteria 2738541297 2738830216 257
37 iso_pu_bacteria 2738541357 2739154012 257
38 iso_pu_bacteria 2738543003 2739195932 257
39 iso_pu_bacteria 2738543026 2739322408 257
40 iso_pu_bacteria 2738543029 2739340649 257
41 iso_pu_bacteria 2821131069 2821132126 257
42 iso_pu_bacteria 2842711865 2842712621 257
43 iso_pu_bacteria 2857547612 2857551298 257
44 iso_pu_bacteria 2857553236 2857557611 257
45 iso_pu_bacteria 2857558681 2857560993 257
46 iso_pu_bacteria 2885080285 2885084055 257
47 iso_pu_bacteria 2904424332 2904425414 257
48 iso_pu_bacteria 2919476304 2919477335 257
49 iso_pu_bacteria 2932410948 2932416410 257
50 iso_pu_bacteria 2932416698 2932417189 257
51 3300003322 rootL2_10064296 rootL2_100642963 258
52 3300003759 Ga0055525_1000001 Ga0055525_1000001828 258
53 3300005262 Ga0065165_1051498 Ga0065165_10514982 258
54 3300005339 Ga0070660_100008672 Ga0070660_1000086725 258
55 3300005457 Ga0070662_100054683 Ga0070662_1000546833 258
56 3300010375 Ga0105239_10609396 Ga0105239_106093962 258
57 3300025230 Ga0209563_100007 Ga0209563_100007270 258
58 3300025253 Ga0209677_103743 Ga0209677_1037433 258
59 3300025254 Ga0209148_1001738 Ga0209148_10017387 258
60 3300025919 Ga0207657_10007207 Ga0207657_100072078 258
61 3300025932 Ga0207690_10013710 Ga0207690_100137103 258
62 3300025933 Ga0207706_10133940 Ga0207706_101339402 258
63 3300037312 Ga0395899_0013536 Ga0395899_0013536_2089_2880 258
64 3300037418 Ga0395900_0000402 Ga0395900_0000402_46941_47729 258
65 3300037418 Ga0395900_0051769 Ga0395900_0051769_3154_3942 258
66 3300037418 Ga0395900_0052005 Ga0395900_0052005_3271_4059 258
67 3300037418 Ga0395900_0095328 Ga0395900_0095328_470_1261 258
68 3300037418 Ga0395900_0381389 Ga0395900_0381389_452_1240 258
69 3300037466 Ga0395898_0554514 Ga0395898_0554514_43_831 258
70 3300038443 Ga0395901_0001370 Ga0395901_0001370_9579_10367 258
71 3300038443 Ga0395901_0032932 Ga0395901_0032932_1493_2281 258
72 3300038443 Ga0395901_0406374 Ga0395901_0406374_300_1088 258
73 3300044683 Ga0466965_0082704 Ga0466965_0082704_155_943 258
74 3300044683 Ga0466965_0177248 Ga0466965_0177248_31_819 258
75 3300044684 Ga0466966_0029654 Ga0466966_0029654_2690_3478 258
76 3300044684 Ga0466966_0129284 Ga0466966_0129284_680_1468 258
77 3300044693 Ga0466961_0108596 Ga0466961_0108596_689_1477 258
78 3300045049 Ga0466959_0010890 Ga0466959_0010890_2217_3005 258
79 3300046474 Ga0495605_0000919 Ga0495605_0000919_5097_5888 258
80 3300046491 Ga0495584_0001853 Ga0495584_0001853_6292_7095 258
81 3300046507 Ga0495606_0031294 Ga0495606_0031294_2390_3193 258
82 3300046519 Ga0495632_0140844 Ga0495632_0140844_14_805 258
83 3300046522 Ga0495643_0020357 Ga0495643_0020357_2105_2896 258
84 3300046524 Ga0495648_0010335 Ga0495648_0010335_4571_5374 258
85 3300046665 Ga0495661_0001982 Ga0495661_0001982_1014_1817 258
86 3300046665 Ga0495661_0048045 Ga0495661_0048045_183_974 258
87 3300046674 Ga0495588_0000110 Ga0495588_0000110_137086_137877 258
88 3300046694 Ga0495649_0068690 Ga0495649_0068690_616_1407 258
89 3300046794 Ga0495589_0000078 Ga0495589_0000078_75270_76061 258
90 3300046810 Ga0495660_0001199 Ga0495660_0001199_12265_13056 258
91 3300047443 Ga0495687_000028 Ga0495687_000028_289882_290685 258
92 3300047443 Ga0495687_001361 Ga0495687_001361_19086_19877 258
93 3300047445 Ga0495677_0034864 Ga0495677_0034864_458_1249 258
94 3300048091 Ga0495626_0001006 Ga0495626_0001006_18442_19233 258
95 3300048907 Ga0496104_0193706 Ga0496104_0193706_994_1782 258
96 3300048916 Ga0496113_0002875 Ga0496113_0002875_5931_6719 258
97 3300048925 Ga0496122_0017643 Ga0496122_0017643_652_1440 258
98 3300048927 Ga0496124_0062512 Ga0496124_0062512_111_899 258
99 3300048928 Ga0496125_0332165 Ga0496125_0332165_19_807 258
100 3300049581 Ga0501047_0081371 Ga0501047_0081371_290_1078 258
101 3300049822 Ga0501035_0000878 Ga0501035_0000878_3815_4603 258
102 3300049823 Ga0501044_0049381 Ga0501044_0049381_2934_3722 258
103 3300061719 Ga0466962_0083878 Ga0466962_0083878_689_1477 258
104 iso_pu_bacteria 2643221556 2643799835 258
105 iso_pu_bacteria 2643221684 2644474835 258
106 3300036401 Ga0373937_0035463 Ga0373937_0035463_2197_2991 259
107 3300037418 Ga0395900_0113362 Ga0395900_0113362_989_1774 259
108 3300037471 Ga0395905_0004238 Ga0395905_0004238_13962_14750 259
109 3300037471 Ga0395905_0066240 Ga0395905_0066240_2447_3232 259
110 3300038443 Ga0395901_0224276 Ga0395901_0224276_110_895 259
111 3300042876 Ga0451577_0133767 Ga0451577_0133767_1288_2082 259
112 3300044712 Ga0453684_0435103 Ga0453684_0435103_353_1177 259
113 3300046522 Ga0495643_0009492 Ga0495643_0009492_3984_4778 259
114 3300046528 Ga0495642_0002709 Ga0495642_0002709_3416_4210 259
115 3300046542 Ga0495597_0061626 Ga0495597_0061626_828_1622 259
116 3300046616 Ga0495668_0082617 Ga0495668_0082617_295_1089 259
117 3300046665 Ga0495661_0007862 Ga0495661_0007862_3343_4137 259
118 3300047443 Ga0495687_015346 Ga0495687_015346_1171_1965 259
119 3300044684 Ga0466966_0072750 Ga0466966_0072750_1142_1942 260
120 3300046471 Ga0495650_0000224 Ga0495650_0000224_9299_10081 260
121 3300002739 JGI25158J39367_1006937 JGI25158J39367_10069372 261
122 3300002773 JGI25152J39213_1000479 JGI25152J39213_100047914 261
123 3300002774 JGI25150J39212_1000814 JGI25150J39212_10008148 261
124 3300002987 JGI25159J45721_1006911 JGI25159J45721_10069113 261
125 3300002987 JGI25159J45721_1008077 JGI25159J45721_10080773 261
126 3300003215 JGI25153J46596_10001711 JGI25153J46596_100017118 261
127 3300003215 JGI25153J46596_10053510 JGI25153J46596_100535101 261
128 3300003354 JGI25160J50197_1009956 JGI25160J50197_10099564 261
129 3300003374 JGI25161J50226_1001293 JGI25161J50226_10012935 261
130 3300003374 JGI25161J50226_1001334 JGI25161J50226_10013347 261
131 3300003771 Ga0055526_1000373 Ga0055526_100037316 261
132 3300003771 Ga0055526_1001922 Ga0055526_100192215 261
133 3300003771 Ga0055526_1005082 Ga0055526_10050827 261
134 3300003771 Ga0055526_1007865 Ga0055526_10078654 261
135 3300003773 Ga0055537_1000536 Ga0055537_100053620 261
136 3300003773 Ga0055537_1002665 Ga0055537_10026653 261
137 3300003773 Ga0055537_1008944 Ga0055537_10089442 261
138 3300003775 Ga0055524_1000010 Ga0055524_100001016 261
139 3300003775 Ga0055524_1001842 Ga0055524_10018424 261
140 3300003775 Ga0055524_1004080 Ga0055524_10040806 261
141 3300003784 Ga0055534_1000314 Ga0055534_100031416 261
142 3300003784 Ga0055534_1002713 Ga0055534_10027134 261
143 3300003784 Ga0055534_1010182 Ga0055534_10101822 261
144 3300003790 Ga0055528_1000127 Ga0055528_100012741 261
145 3300003791 Ga0055530_10006155 Ga0055530_100061553 261
146 3300003791 Ga0055530_10009821 Ga0055530_100098213 261
147 3300003791 Ga0055530_10010237 Ga0055530_100102372 261
148 3300003794 Ga0055531_10010020 Ga0055531_100100203 261
149 3300003794 Ga0055531_10019872 Ga0055531_100198721 261
150 3300004625 Ga0055543_1001627 Ga0055543_10016274 261
151 3300004625 Ga0055543_1003127 Ga0055543_10031276 261
152 3300004625 Ga0055543_1030298 Ga0055543_10302981 261
153 3300004625 Ga0055543_1031794 Ga0055543_10317941 261
154 3300005262 Ga0065165_1000007 Ga0065165_100000716 261
155 3300005262 Ga0065165_1006178 Ga0065165_10061784 261
156 3300005262 Ga0065165_1071623 Ga0065165_10716231 261
157 3300005339 Ga0070660_100014546 Ga0070660_1000145463 261
158 3300005339 Ga0070660_100029249 Ga0070660_1000292493 261
159 3300005339 Ga0070660_100211576 Ga0070660_1002115762 261
160 3300005344 Ga0070661_100004451 Ga0070661_1000044511 261
161 3300005344 Ga0070661_100039292 Ga0070661_1000392923 261
162 3300005366 Ga0070659_100054084 Ga0070659_1000540844 261
163 3300005366 Ga0070659_100069620 Ga0070659_1000696203 261
164 3300005455 Ga0070663_100385228 Ga0070663_1003852282 261
165 3300005457 Ga0070662_100122666 Ga0070662_1001226661 261
166 3300005564 Ga0070664_100182172 Ga0070664_1001821722 261
167 3300006177 Ga0075362_10050022 Ga0075362_100500222 261
168 3300006946 Ga0079104_1006344 Ga0079104_10063445 261
169 3300006948 Ga0099826_10000002 Ga0099826_10000002413 261
170 3300009036 Ga0105244_10006542 Ga0105244_100065426 261
171 3300009036 Ga0105244_10026007 Ga0105244_100260073 261
172 3300009036 Ga0105244_10038138 Ga0105244_100381382 261
173 3300009093 Ga0105240_10251548 Ga0105240_102515481 261
174 3300009148 Ga0105243_10004986 Ga0105243_100049868 261
175 3300009176 Ga0105242_10099376 Ga0105242_100993762 261
176 3300010375 Ga0105239_10165906 Ga0105239_101659063 261
177 3300013306 Ga0163162_10724306 Ga0163162_107243062 261
178 3300014497 Ga0182008_10003255 Ga0182008_100032554 261
179 3300015261 Ga0182006_1000043 Ga0182006_1000043156 261
180 3300015261 Ga0182006_1000112 Ga0182006_100011228 261
181 3300015262 Ga0182007_10000020 Ga0182007_1000002078 261
182 3300015265 Ga0182005_1000001 Ga0182005_100000179 261
183 3300015265 Ga0182005_1000037 Ga0182005_1000037115 261
184 3300021361 Ga0213872_10000385 Ga0213872_1000038537 261
185 3300021361 Ga0213872_10002426 Ga0213872_100024268 261
186 3300021361 Ga0213872_10002679 Ga0213872_100026794 261
187 3300021361 Ga0213872_10160768 Ga0213872_101607681 261
188 3300025208 Ga0209436_100479 Ga0209436_10047916 261
189 3300025208 Ga0209436_101373 Ga0209436_1013737 261
190 3300025245 Ga0207425_1000001 Ga0207425_1000001809 261
191 3300025245 Ga0207425_1000147 Ga0207425_100014743 261
192 3300025245 Ga0207425_1000384 Ga0207425_100038422 261
193 3300025246 Ga0209646_1000106 Ga0209646_1000106117 261
194 3300025246 Ga0209646_1000212 Ga0209646_100021251 261
195 3300025258 Ga0209129_1000003 Ga0209129_1000003809 261
196 3300025258 Ga0209129_1004051 Ga0209129_10040515 261
197 3300025258 Ga0209129_1015144 Ga0209129_10151442 261
198 3300025263 Ga0209565_1000202 Ga0209565_100020253 261
199 3300025263 Ga0209565_1000983 Ga0209565_10009832 261
200 3300025263 Ga0209565_1002408 Ga0209565_10024085 261
201 3300025263 Ga0209565_1003072 Ga0209565_10030721 261
202 3300025263 Ga0209565_1006392 Ga0209565_10063922 261
203 3300025263 Ga0209565_1006763 Ga0209565_10067634 261
204 3300025263 Ga0209565_1023107 Ga0209565_10231072 261
205 3300025263 Ga0209565_1037091 Ga0209565_10370911 261
206 3300025273 Ga0209673_1000007 Ga0209673_1000007498 261
207 3300025273 Ga0209673_1004884 Ga0209673_10048842 261
208 3300025284 Ga0209130_1000156 Ga0209130_10001564 261
209 3300025284 Ga0209130_1000990 Ga0209130_100099022 261
210 3300025284 Ga0209130_1001365 Ga0209130_100136514 261
211 3300025284 Ga0209130_1037278 Ga0209130_10372782 261
212 3300025291 Ga0209675_1000009 Ga0209675_100000920 261
213 3300025291 Ga0209675_1003250 Ga0209675_10032508 261
214 3300025291 Ga0209675_1003673 Ga0209675_10036734 261
215 3300025294 Ga0209025_1001761 Ga0209025_100176120 261
216 3300025295 Ga0209564_1000011 Ga0209564_1000011352 261
217 3300025295 Ga0209564_1000089 Ga0209564_1000089211 261
218 3300025295 Ga0209564_1000203 Ga0209564_100020384 261
219 3300025295 Ga0209564_1001486 Ga0209564_10014867 261
220 3300025295 Ga0209564_1009456 Ga0209564_10094563 261
221 3300025295 Ga0209564_1039993 Ga0209564_10399932 261
222 3300025297 Ga0209758_1000020 Ga0209758_1000020467 261
223 3300025297 Ga0209758_1000286 Ga0209758_100028638 261
224 3300025298 Ga0209050_1000058 Ga0209050_10000587 261
225 3300025298 Ga0209050_1001649 Ga0209050_100164914 261
226 3300025298 Ga0209050_1004999 Ga0209050_10049995 261
227 3300025299 Ga0209256_1000007 Ga0209256_1000007397 261
228 3300025299 Ga0209256_1000415 Ga0209256_100041562 261
229 3300025299 Ga0209256_1001989 Ga0209256_10019895 261
230 3300025299 Ga0209256_1002357 Ga0209256_100235715 261
231 3300025299 Ga0209256_1011807 Ga0209256_10118072 261
232 3300025302 Ga0207426_1001293 Ga0207426_10012938 261
233 3300025304 Ga0209257_1000003 Ga0209257_1000003301 261
234 3300025304 Ga0209257_1012839 Ga0209257_10128393 261
235 3300025728 Ga0207655_1030244 Ga0207655_10302442 261
236 3300025909 Ga0207705_10005721 Ga0207705_100057218 261
237 3300025909 Ga0207705_10301176 Ga0207705_103011762 261
238 3300025919 Ga0207657_10002268 Ga0207657_1000226820 261
239 3300025919 Ga0207657_10073423 Ga0207657_100734233 261
240 3300025919 Ga0207657_10074523 Ga0207657_100745233 261
241 3300025920 Ga0207649_10050757 Ga0207649_100507572 261
242 3300025920 Ga0207649_10087642 Ga0207649_100876422 261
243 3300025932 Ga0207690_10275713 Ga0207690_102757132 261
244 3300025934 Ga0207686_10155309 Ga0207686_101553092 261
245 3300025935 Ga0207709_10027987 Ga0207709_100279872 261
246 3300025945 Ga0207679_10105252 Ga0207679_101052522 261
247 3300025945 Ga0207679_10150485 Ga0207679_101504852 261
248 3300025949 Ga0207667_10228455 Ga0207667_102284552 261
249 3300025949 Ga0207667_10535822 Ga0207667_105358222 261
250 3300027111 Ga0209281_1005163 Ga0209281_10051632 261
251 3300027666 Ga0209282_1000001 Ga0209282_1000001737 261
252 3300031548 Ga0307408_100000269 Ga0307408_10000026930 261
253 3300031548 Ga0307408_100001036 Ga0307408_1000010368 261
254 3300031548 Ga0307408_100076425 Ga0307408_1000764253 261
255 3300031548 Ga0307408_100267789 Ga0307408_1002677892 261
256 3300031711 Ga0265314_10127299 Ga0265314_101272992 261
257 3300032002 Ga0307416_100004120 Ga0307416_1000041205 261
258 3300032002 Ga0307416_100685010 Ga0307416_1006850102 261
259 3300032004 Ga0307414_10132138 Ga0307414_101321382 261
260 3300037312 Ga0395899_0002338 Ga0395899_0002338_1406_2206 261
261 3300037312 Ga0395899_0002802 Ga0395899_0002802_6698_7513 261
262 3300037312 Ga0395899_0015214 Ga0395899_0015214_4597_5391 261
263 3300037312 Ga0395899_0052736 Ga0395899_0052736_628_1428 261
264 3300037418 Ga0395900_0025798 Ga0395900_0025798_3388_4182 261
265 3300037418 Ga0395900_0076389 Ga0395900_0076389_505_1299 261
266 3300037418 Ga0395900_0161451 Ga0395900_0161451_1262_2050 261
267 3300037418 Ga0395900_0175069 Ga0395900_0175069_497_1285 261
268 3300037418 Ga0395900_0343270 Ga0395900_0343270_438_1253 261
269 3300037466 Ga0395898_0039091 Ga0395898_0039091_2200_2994 261
270 3300037466 Ga0395898_0067807 Ga0395898_0067807_372_1160 261
271 3300037466 Ga0395898_0142160 Ga0395898_0142160_120_914 261
272 3300037466 Ga0395898_0242900 Ga0395898_0242900_500_1300 261
273 3300037471 Ga0395905_0002037 Ga0395905_0002037_21759_22544 261
274 3300037471 Ga0395905_0022385 Ga0395905_0022385_2562_3356 261
275 3300037471 Ga0395905_0107776 Ga0395905_0107776_880_1674 261
276 3300037471 Ga0395905_0120568 Ga0395905_0120568_1480_2268 261
277 3300037471 Ga0395905_0190985 Ga0395905_0190985_737_1552 261
278 3300037471 Ga0395905_0432849 Ga0395905_0432849_283_1077 261
279 3300037471 Ga0395905_0729129 Ga0395905_0729129_13_801 261
280 3300038443 Ga0395901_0000482 Ga0395901_0000482_15080_15904 261
281 3300038443 Ga0395901_0019840 Ga0395901_0019840_2695_3489 261
282 3300038443 Ga0395901_0098860 Ga0395901_0098860_1774_2568 261
283 3300038443 Ga0395901_0168113 Ga0395901_0168113_223_1023 261
284 3300038443 Ga0395901_0370616 Ga0395901_0370616_204_1019 261
285 3300038443 Ga0395901_0411367 Ga0395901_0411367_403_1191 261
286 3300039447 Ga0436361_0089764 Ga0436361_0089764_1104_1889 261
287 3300039447 Ga0436361_0603514 Ga0436361_0603514_7243_8028 261
288 3300039447 Ga0436361_0832327 Ga0436361_0832327_67_852 261
289 3300039447 Ga0436361_1198581 Ga0436361_1198581_690_1475 261
290 3300042005 Ga0439448_0000980 Ga0439448_0000980_3621_4415 261
291 3300042005 Ga0439448_0009404 Ga0439448_0009404_642_1436 261
292 3300042007 Ga0439449_0071289 Ga0439449_0071289_418_1212 261
293 3300042012 Ga0439455_0008418 Ga0439455_0008418_38_832 261
294 3300042012 Ga0439455_0018532 Ga0439455_0018532_692_1486 261
295 3300042139 Ga0450904_000096 Ga0450904_000096_1454_2239 261
296 3300042157 Ga0439458_0028241 Ga0439458_0028241_50_856 261
297 3300044658 Ga0466972_0000060 Ga0466972_0000060_24441_25232 261
298 3300044658 Ga0466972_0008060 Ga0466972_0008060_2612_3403 261
299 3300044683 Ga0466965_0000632 Ga0466965_0000632_11525_12316 261
300 3300044684 Ga0466966_0027793 Ga0466966_0027793_2134_2955 261
301 3300044693 Ga0466961_0251572 Ga0466961_0251572_44_838 261
302 3300044706 Ga0466964_0003150 Ga0466964_0003150_4088_4894 261
303 3300044706 Ga0466964_0079068 Ga0466964_0079068_257_1048 261
304 3300044706 Ga0466964_0169243 Ga0466964_0169243_30_821 261
305 3300044735 Ga0466968_0024678 Ga0466968_0024678_148_939 261
306 3300044765 Ga0466970_0300638 Ga0466970_0300638_59_853 261
307 3300044842 Ga0466957_0002869 Ga0466957_0002869_4359_5153 261
308 3300045836 Ga0466958_0237900 Ga0466958_0237900_174_968 261
309 3300045976 Ga0466967_0004678 Ga0466967_0004678_3231_4025 261
310 3300045976 Ga0466967_0046064 Ga0466967_0046064_2167_2973 261
311 3300046452 Ga0495617_000062 Ga0495617_000062_11481_12266 261
312 3300046452 Ga0495617_006377 Ga0495617_006377_2975_3760 261
313 3300046453 Ga0495627_000059 Ga0495627_000059_107523_108308 261
314 3300046453 Ga0495627_042430 Ga0495627_042430_71_856 261
315 3300046457 Ga0495590_0000002 Ga0495590_0000002_95846_96631 261
316 3300046457 Ga0495590_0000373 Ga0495590_0000373_14046_14846 261
317 3300046460 Ga0495638_0000072 Ga0495638_0000072_152686_153471 261
318 3300046460 Ga0495638_0030925 Ga0495638_0030925_2318_3103 261
319 3300046463 Ga0495653_0000023 Ga0495653_0000023_107778_108563 261
320 3300046463 Ga0495653_0145140 Ga0495653_0145140_10_795 261
321 3300046471 Ga0495650_0000019 Ga0495650_0000019_384000_384785 261
322 3300046471 Ga0495650_0000067 Ga0495650_0000067_5398_6183 261
323 3300046471 Ga0495650_0000276 Ga0495650_0000276_59213_59998 261
324 3300046471 Ga0495650_0000750 Ga0495650_0000750_14377_15162 261
325 3300046471 Ga0495650_0003011 Ga0495650_0003011_10270_11055 261
326 3300046471 Ga0495650_0012920 Ga0495650_0012920_2324_3109 261
327 3300046474 Ga0495605_0000023 Ga0495605_0000023_200918_201703 261
328 3300046474 Ga0495605_0017773 Ga0495605_0017773_2911_3705 261
329 3300046475 Ga0495639_0037596 Ga0495639_0037596_739_1524 261
330 3300046491 Ga0495584_0003055 Ga0495584_0003055_7539_8324 261
331 3300046491 Ga0495584_0003297 Ga0495584_0003297_5514_6308 261
332 3300046491 Ga0495584_0011480 Ga0495584_0011480_2334_3134 261
333 3300046492 Ga0495585_0001862 Ga0495585_0001862_3038_3823 261
334 3300046499 Ga0495594_0238390 Ga0495594_0238390_75_869 261
335 3300046501 Ga0495607_0002037 Ga0495607_0002037_12558_13343 261
336 3300046501 Ga0495607_0004453 Ga0495607_0004453_6164_6964 261
337 3300046501 Ga0495607_0004730 Ga0495607_0004730_6164_6949 261
338 3300046501 Ga0495607_0007743 Ga0495607_0007743_153_938 261
339 3300046501 Ga0495607_0037691 Ga0495607_0037691_1015_1800 261
340 3300046506 Ga0495583_0000494 Ga0495583_0000494_49743_50528 261
341 3300046506 Ga0495583_0000649 Ga0495583_0000649_33708_34493 261
342 3300046506 Ga0495583_0002611 Ga0495583_0002611_7403_8188 261
343 3300046506 Ga0495583_0045706 Ga0495583_0045706_179_964 261
344 3300046507 Ga0495606_0000526 Ga0495606_0000526_44598_45383 261
345 3300046507 Ga0495606_0000834 Ga0495606_0000834_14229_15014 261
346 3300046507 Ga0495606_0000931 Ga0495606_0000931_31046_31831 261
347 3300046507 Ga0495606_0002107 Ga0495606_0002107_17996_18781 261
348 3300046507 Ga0495606_0002724 Ga0495606_0002724_6422_7207 261
349 3300046507 Ga0495606_0004578 Ga0495606_0004578_6297_7082 261
350 3300046507 Ga0495606_0010359 Ga0495606_0010359_812_1597 261
351 3300046507 Ga0495606_0216701 Ga0495606_0216701_29_814 261
352 3300046512 Ga0495610_0000012 Ga0495610_0000012_502484_503269 261
353 3300046512 Ga0495610_0003343 Ga0495610_0003343_4057_4842 261
354 3300046512 Ga0495610_0003427 Ga0495610_0003427_6277_7062 261
355 3300046512 Ga0495610_0004322 Ga0495610_0004322_9563_10348 261
356 3300046513 Ga0495616_0000647 Ga0495616_0000647_10347_11132 261
357 3300046513 Ga0495616_0001174 Ga0495616_0001174_14740_15540 261
358 3300046513 Ga0495616_0027253 Ga0495616_0027253_958_1743 261
359 3300046517 Ga0495630_0067795 Ga0495630_0067795_167_967 261
360 3300046519 Ga0495632_0004300 Ga0495632_0004300_4003_4788 261
361 3300046520 Ga0495637_0004843 Ga0495637_0004843_3280_4065 261
362 3300046520 Ga0495637_0008926 Ga0495637_0008926_2918_3703 261
363 3300046522 Ga0495643_0000312 Ga0495643_0000312_32484_33269 261
364 3300046522 Ga0495643_0001430 Ga0495643_0001430_9806_10591 261
365 3300046522 Ga0495643_0026402 Ga0495643_0026402_2276_3070 261
366 3300046524 Ga0495648_0000037 Ga0495648_0000037_42512_43297 261
367 3300046524 Ga0495648_0005438 Ga0495648_0005438_9108_9893 261
368 3300046524 Ga0495648_0009323 Ga0495648_0009323_2531_3316 261
369 3300046524 Ga0495648_0024607 Ga0495648_0024607_1385_2170 261
370 3300046525 Ga0495663_0002295 Ga0495663_0002295_2830_3615 261
371 3300046526 Ga0495666_0028290 Ga0495666_0028290_477_1277 261
372 3300046528 Ga0495642_0007545 Ga0495642_0007545_1670_2464 261
373 3300046528 Ga0495642_0021692 Ga0495642_0021692_511_1296 261
374 3300046529 Ga0495652_0013032 Ga0495652_0013032_2896_3696 261
375 3300046530 Ga0495654_0000015 Ga0495654_0000015_167131_167916 261
376 3300046530 Ga0495654_0026211 Ga0495654_0026211_728_1522 261
377 3300046530 Ga0495654_0032292 Ga0495654_0032292_829_1614 261
378 3300046530 Ga0495654_0168023 Ga0495654_0168023_127_912 261
379 3300046531 Ga0495665_0008591 Ga0495665_0008591_1267_2067 261
380 3300046535 Ga0495586_0004323 Ga0495586_0004323_911_1711 261
381 3300046538 Ga0495609_0000019 Ga0495609_0000019_15008_15808 261
382 3300046538 Ga0495609_0003928 Ga0495609_0003928_706_1491 261
383 3300046538 Ga0495609_0036242 Ga0495609_0036242_353_1138 261
384 3300046538 Ga0495609_0086059 Ga0495609_0086059_93_887 261
385 3300046542 Ga0495597_0001102 Ga0495597_0001102_11405_12190 261
386 3300046542 Ga0495597_0001294 Ga0495597_0001294_13681_14475 261
387 3300046542 Ga0495597_0001837 Ga0495597_0001837_11426_12211 261
388 3300046557 Ga0495622_0000117 Ga0495622_0000117_39045_39830 261
389 3300046557 Ga0495622_0000917 Ga0495622_0000917_3829_4614 261
390 3300046557 Ga0495622_0010370 Ga0495622_0010370_1564_2349 261
391 3300046558 Ga0495633_0002758 Ga0495633_0002758_5539_6324 261
392 3300046558 Ga0495633_0003472 Ga0495633_0003472_5431_6216 261
393 3300046558 Ga0495633_0008996 Ga0495633_0008996_2640_3425 261
394 3300046558 Ga0495633_0015140 Ga0495633_0015140_157_942 261
395 3300046558 Ga0495633_0020110 Ga0495633_0020110_1839_2624 261
396 3300046558 Ga0495633_0020787 Ga0495633_0020787_1539_2324 261
397 3300046615 Ga0495656_0020234 Ga0495656_0020234_910_1695 261
398 3300046615 Ga0495656_0050606 Ga0495656_0050606_854_1642 261
399 3300046615 Ga0495656_0150902 Ga0495656_0150902_163_948 261
400 3300046616 Ga0495668_0000028 Ga0495668_0000028_207660_208445 261
401 3300046616 Ga0495668_0000081 Ga0495668_0000081_144001_144786 261
402 3300046616 Ga0495668_0000170 Ga0495668_0000170_82304_83089 261
403 3300046616 Ga0495668_0001981 Ga0495668_0001981_5760_6545 261
404 3300046616 Ga0495668_0002045 Ga0495668_0002045_2539_3333 261
405 3300046616 Ga0495668_0004324 Ga0495668_0004324_182_967 261
406 3300046616 Ga0495668_0018854 Ga0495668_0018854_53_838 261
407 3300046642 Ga0495634_0051744 Ga0495634_0051744_289_1089 261
408 3300046660 Ga0495625_0000738 Ga0495625_0000738_11481_12266 261
409 3300046660 Ga0495625_0003266 Ga0495625_0003266_1343_2128 261
410 3300046660 Ga0495625_0013420 Ga0495625_0013420_3012_3797 261
411 3300046660 Ga0495625_0015431 Ga0495625_0015431_1838_2623 261
412 3300046660 Ga0495625_0019598 Ga0495625_0019598_1141_1926 261
413 3300046660 Ga0495625_0032775 Ga0495625_0032775_2008_2793 261
414 3300046664 Ga0495659_0000950 Ga0495659_0000950_8198_8983 261
415 3300046665 Ga0495661_0001518 Ga0495661_0001518_4019_4819 261
416 3300046665 Ga0495661_0007763 Ga0495661_0007763_4749_5534 261
417 3300046665 Ga0495661_0011701 Ga0495661_0011701_3672_4457 261
418 3300046665 Ga0495661_0021334 Ga0495661_0021334_2144_2929 261
419 3300046674 Ga0495588_0018621 Ga0495588_0018621_683_1468 261
420 3300046674 Ga0495588_0033116 Ga0495588_0033116_415_1215 261
421 3300046679 Ga0495623_0039457 Ga0495623_0039457_1722_2522 261
422 3300046684 Ga0495669_0092370 Ga0495669_0092370_164_949 261
423 3300046691 Ga0495670_0146813 Ga0495670_0146813_316_1101 261
424 3300046692 Ga0495671_0000006 Ga0495671_0000006_390397_391182 261
425 3300046692 Ga0495671_0033874 Ga0495671_0033874_1315_2100 261
426 3300046692 Ga0495671_0143049 Ga0495671_0143049_77_862 261
427 3300046694 Ga0495649_0008629 Ga0495649_0008629_1725_2510 261
428 3300046694 Ga0495649_0013492 Ga0495649_0013492_1646_2431 261
429 3300046694 Ga0495649_0025764 Ga0495649_0025764_1243_2028 261
430 3300046794 Ga0495589_0000019 Ga0495589_0000019_196036_196836 261
431 3300046794 Ga0495589_0095459 Ga0495589_0095459_528_1322 261
432 3300046810 Ga0495660_0002119 Ga0495660_0002119_7136_7921 261
433 3300046810 Ga0495660_0006752 Ga0495660_0006752_2240_3025 261
434 3300046810 Ga0495660_0007289 Ga0495660_0007289_722_1507 261
435 3300046810 Ga0495660_0130357 Ga0495660_0130357_461_1246 261
436 3300047318 Ga0495636_0001452 Ga0495636_0001452_4771_5556 261
437 3300047320 Ga0495672_0000707 Ga0495672_0000707_5138_5923 261
438 3300047320 Ga0495672_0010109 Ga0495672_0010109_3083_3877 261
439 3300047323 Ga0495683_0040875 Ga0495683_0040875_1072_1857 261
440 3300047443 Ga0495687_000003 Ga0495687_000003_15035_15835 261
441 3300047443 Ga0495687_019054 Ga0495687_019054_959_1744 261
442 3300047443 Ga0495687_019144 Ga0495687_019144_948_1733 261
443 3300047443 Ga0495687_025887 Ga0495687_025887_779_1564 261
444 3300047444 Ga0495675_0004466 Ga0495675_0004466_6488_7288 261
445 3300047445 Ga0495677_0000006 Ga0495677_0000006_4166_4966 261
446 3300047445 Ga0495677_0009148 Ga0495677_0009148_1193_1978 261
447 3300047445 Ga0495677_0038686 Ga0495677_0038686_746_1531 261
448 3300047446 Ga0495679_006542 Ga0495679_006542_644_1429 261
449 3300047469 Ga0495673_0000003 Ga0495673_0000003_671964_672749 261
450 3300047469 Ga0495673_0000061 Ga0495673_0000061_63206_63991 261
451 3300047469 Ga0495673_0000482 Ga0495673_0000482_6555_7340 261
452 3300047469 Ga0495673_0046168 Ga0495673_0046168_865_1650 261
453 3300047470 Ga0495681_0009544 Ga0495681_0009544_3630_4415 261
454 3300047472 Ga0495686_0009006 Ga0495686_0009006_5760_6545 261
455 3300047472 Ga0495686_0019696 Ga0495686_0019696_698_1483 261
456 3300047472 Ga0495686_0064975 Ga0495686_0064975_938_1729 261
457 3300048088 Ga0495602_0024394 Ga0495602_0024394_1724_2524 261
458 3300048090 Ga0495615_0000770 Ga0495615_0000770_2897_3682 261
459 3300048091 Ga0495626_0001436 Ga0495626_0001436_14497_15297 261
460 3300048091 Ga0495626_0001679 Ga0495626_0001679_555_1340 261
461 3300048091 Ga0495626_0050725 Ga0495626_0050725_891_1676 261
462 3300048091 Ga0495626_0076751 Ga0495626_0076751_630_1421 261
463 3300048904 Ga0496101_0172319 Ga0496101_0172319_636_1430 261
464 3300048905 Ga0496102_0000064 Ga0496102_0000064_31108_31899 261
465 3300048905 Ga0496102_0074884 Ga0496102_0074884_1072_1857 261
466 3300048905 Ga0496102_0202535 Ga0496102_0202535_91_900 261
467 3300048905 Ga0496102_0433904 Ga0496102_0433904_53_847 261
468 3300048906 Ga0496103_0002045 Ga0496103_0002045_5894_6679 261
469 3300048906 Ga0496103_0036769 Ga0496103_0036769_1150_1959 261
470 3300048906 Ga0496103_0129735 Ga0496103_0129735_30_827 261
471 3300048909 Ga0496106_0068464 Ga0496106_0068464_816_1604 261
472 3300048910 Ga0496107_0178376 Ga0496107_0178376_69_857 261
473 3300048913 Ga0496110_0603143 Ga0496110_0603143_159_956 261
474 3300048914 Ga0496111_0009750 Ga0496111_0009750_5474_6259 261
475 3300048917 Ga0496114_0076055 Ga0496114_0076055_202_996 261
476 3300048917 Ga0496114_0084557 Ga0496114_0084557_1788_2573 261
477 3300048920 Ga0496117_0000094 Ga0496117_0000094_157171_157956 261
478 3300048921 Ga0496118_0000071 Ga0496118_0000071_157171_157956 261
479 3300048923 Ga0496120_0030167 Ga0496120_0030167_2185_2970 261
480 3300048924 Ga0496121_0024308 Ga0496121_0024308_1812_2597 261
481 3300048924 Ga0496121_0028994 Ga0496121_0028994_3195_3980 261
482 3300048925 Ga0496122_0003123 Ga0496122_0003123_7325_8110 261
483 3300048925 Ga0496122_0094582 Ga0496122_0094582_83_868 261
484 3300048926 Ga0496123_0002748 Ga0496123_0002748_12395_13180 261
485 3300048926 Ga0496123_0131803 Ga0496123_0131803_484_1269 261
486 3300048927 Ga0496124_0029289 Ga0496124_0029289_1122_1907 261
487 3300048927 Ga0496124_0034348 Ga0496124_0034348_3117_3917 261
488 3300048927 Ga0496124_0096792 Ga0496124_0096792_1043_1828 261
489 3300048928 Ga0496125_0001032 Ga0496125_0001032_36095_36889 261
490 3300048928 Ga0496125_0050523 Ga0496125_0050523_1124_1909 261
491 3300048928 Ga0496125_0056763 Ga0496125_0056763_623_1408 261
492 3300048929 Ga0496126_0040743 Ga0496126_0040743_2228_3013 261
493 3300048929 Ga0496126_0285151 Ga0496126_0285151_102_896 261
494 3300049459 Ga0495678_000030 Ga0495678_000030_10721_11506 261
495 3300049459 Ga0495678_001311 Ga0495678_001311_179_964 261
496 3300049459 Ga0495678_001785 Ga0495678_001785_10200_10985 261
497 3300049459 Ga0495678_067685 Ga0495678_067685_334_1119 261
498 3300049460 Ga0495682_0004334 Ga0495682_0004334_1724_2509 261
499 3300049662 Ga0501222_006825 Ga0501222_006825_564_1349 261
500 3300049665 Ga0501227_049945 Ga0501227_049945_226_1011 261
501 3300049679 Ga0501249_006855 Ga0501249_006855_1391_2176 261
502 3300049766 Ga0501269_000119 Ga0501269_000119_12023_12808 261
503 3300049775 Ga0501279_000471 Ga0501279_000471_4040_4825 261
504 3300053125 Ga0500618_000747 Ga0500618_000747_16335_17120 261
505 3300053125 Ga0500618_018689 Ga0500618_018689_634_1419 261
506 3300053145 Ga0500586_000768 Ga0500586_000768_289_1074 261
507 3300059490 Ga0587066_002247 Ga0587066_002247_615_1430 261
508 3300059503 Ga0587080_026178 Ga0587080_026178_33_833 261
509 3300059513 Ga0587094_003660 Ga0587094_003660_596_1411 261
510 3300059645 Ga0587076_002986 Ga0587076_002986_797_1612 261
511 3300060346 Ga0587111_0001000 Ga0587111_0001000_852_1667 261
512 3300061719 Ga0466962_0007329 Ga0466962_0007329_3134_3955 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

115

253

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9393 115 258
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.892 2 255
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8918 115 258
1x7p-assembly1.cif.gz_A crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.8774 9 261
1v2x-assembly1.cif.gz_A-2 trmh 0.8767 112 260
ID Description Score Start End Superfamily
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9525 107 255 3.40.1280.10
af_Q8W497_402_589_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9478 115 260 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9339 107 255 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9294 115 259 3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9172 117 254 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A259P4I9-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9788 186 260 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7C2ULJ2-F1-model_v4 RNA methyltransferase 0.9687 1 260 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A0S7CYE3-F1-model_v4 Uncharacterized tRNA/rRNA methyltransferase YsgA 0.965 117 260 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A1H8EG83-F1-model_v4 RNA methyltransferase, TrmH family 0.961 1 260 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A0M3CBX5-F1-model_v4 deleted 0.9605 121 261

Feature Viewer

pLDDT pTM Quality
94.51 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map