F457446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 512 | 381 | 418 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100011432|Ga0307416_1000114326 |
| Length | 371 |
| Sequence | MATTTPQDKVIISCAVTGSVHTPTMSEHLALTPDQIAEQSIEAAEAGAAILHLHARDPKDGRPSADPKIFDAFVPRIRDATDAVINITTGGSTRMTLEERLAYPLQAKPEMCSLNMGSMNFSIHPAARRIAEWKHEWEKPYVEGMEDLIFRNTFRDIKHILKVLGEDCGTRFEFECYDVGHLYNLAHFVDEGLIKGPLFIQSIYGILGGLGPDPENLVVMRTTADRLFGRNGYRFSILGAGRHQMPLLTMGAVMGGNVRVGLEDSLYLAKGQLAKSCAEQVRKIRRILEELSLEIATPDEARAMLGLKGHDAVGALARNKPFTSIRSSNEEVLGRPRGHRHGGRQRPGQGACDGARPAWRPRRGQRCGGPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 6 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 7 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 10 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 11 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 12 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 13 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 14 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 15 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 16 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 17 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 18 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 19 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 20 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 21 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 22 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 23 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 24 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 25 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 26 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 27 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 28 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 29 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 30 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 31 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 32 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 33 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 34 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 35 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 36 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 37 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 38 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 39 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 40 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 41 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 42 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 43 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 44 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 45 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 46 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 47 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 48 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 49 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 50 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 51 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 52 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 53 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 54 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 55 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 56 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 57 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 58 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 59 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 60 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 61 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 62 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 63 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 64 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 65 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 66 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 67 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 68 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 69 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 70 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 71 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 72 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 73 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 74 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 75 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 76 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 77 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 78 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 79 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 80 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 81 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 82 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 83 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 84 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 85 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 86 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 87 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 88 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 89 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 90 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 91 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 92 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 93 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 94 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 95 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 96 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 97 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 98 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 99 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 100 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 102 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 103 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 104 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 105 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 106 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 107 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 108 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 110 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 114 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 127 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 128 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 131 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 150 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 232 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 233 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 234 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 235 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 238 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 239 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 240 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 241 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 242 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 243 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 244 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 245 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 246 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 358 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 362 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 363 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 371 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 374 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 377 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 379 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 380 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 381 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.05 |
| Metatranscriptomes | 0.59 |
| Isolates | 18.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.77 |
| Nodule | 12.11 |
| Rhizoplane | 5.27 |
| Rhizosphere | 53.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10049912 | 3300002067 | Bacteria | 1208 |
| 2 | JGI25156J39149_1000576 | 3300002705 | Bacteria | 21008 |
| 3 | JGI25152J39213_1002258 | 3300002773 | Bacteria | 7443 |
| 4 | JGI25151J46595_10003224 | 3300003187 | Bacteria | 9120 |
| 5 | JGI25165J46597_1000038 | 3300003214 | Bacteria | 283664 |
| 6 | JGI25153J46596_10000537 | 3300003215 | Bacteria | 23734 |
| 7 | rootH2_10255115 | 3300003320 | Bacteria | 2347 |
| 8 | JGI25160J50197_1000099 | 3300003354 | Bacteria | 86777 |
| 9 | Ga0055533_1000085 | 3300003756 | Bacteria | 124875 |
| 10 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 11 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 12 | Ga0055525_1000084 | 3300003759 | Bacteria | 155319 |
| 13 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 14 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 15 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 16 | Ga0055529_1000026 | 3300003763 | Bacteria | 293254 |
| 17 | Ga0055529_1000806 | 3300003763 | Bacteria | 19128 |
| 18 | Ga0055526_1000296 | 3300003771 | Bacteria | 41724 |
| 19 | Ga0055534_1000538 | 3300003784 | Bacteria | 20301 |
| 20 | Ga0055531_10000415 | 3300003794 | Bacteria | 40766 |
| 21 | Ga0065165_1000119 | 3300005262 | Bacteria | 134464 |
| 22 | Ga0070658_10222377 | 3300005327 | Bacteria | 1597 |
| 23 | Ga0070670_100507377 | 3300005331 | Bacteria | 1073 |
| 24 | Ga0070682_100007523 | 3300005337 | Bacteria | 6141 |
| 25 | Ga0068868_100329810 | 3300005338 | Bacteria | 1302 |
| 26 | Ga0070669_100024214 | 3300005353 | Bacteria | 4352 |
| 27 | Ga0070674_100194496 | 3300005356 | Bacteria | 1562 |
| 28 | Ga0070667_100009961 | 3300005367 | Bacteria | 7877 |
| 29 | Ga0070714_100018622 | 3300005435 | Bacteria | 5645 |
| 30 | Ga0070713_100062102 | 3300005436 | Bacteria | 3128 |
| 31 | Ga0070713_100272470 | 3300005436 | Bacteria | 1550 |
| 32 | Ga0070711_100060940 | 3300005439 | Bacteria | 2625 |
| 33 | Ga0070678_100025491 | 3300005456 | Bacteria | 3979 |
| 34 | Ga0070699_100266330 | 3300005518 | Bacteria | 1533 |
| 35 | Ga0070679_100229057 | 3300005530 | Bacteria | 1818 |
| 36 | Ga0070684_100113285 | 3300005535 | Bacteria | 2434 |
| 37 | Ga0070696_100008623 | 3300005546 | Bacteria | 6820 |
| 38 | Ga0070696_100136626 | 3300005546 | Bacteria | 1788 |
| 39 | Ga0070665_100098087 | 3300005548 | Bacteria | 2935 |
| 40 | Ga0068855_100408504 | 3300005563 | Bacteria | 1487 |
| 41 | Ga0068854_100115815 | 3300005578 | Bacteria | 2028 |
| 42 | Ga0068856_100104319 | 3300005614 | Bacteria | 2829 |
| 43 | Ga0068858_100212321 | 3300005842 | Bacteria | 1832 |
| 44 | Ga0081455_10198572 | 3300005937 | Bacteria | 1504 |
| 45 | Ga0081455_10205030 | 3300005937 | Bacteria | 1473 |
| 46 | Ga0081539_10067324 | 3300005985 | Bacteria | 1937 |
| 47 | Ga0075365_10027047 | 3300006038 | Bacteria | 3645 |
| 48 | Ga0075366_10006472 | 3300006195 | Bacteria | 6423 |
| 49 | Ga0075366_10017277 | 3300006195 | Bacteria | 4151 |
| 50 | Ga0075370_10000806 | 3300006353 | Bacteria | 12561 |
| 51 | Ga0075370_10057355 | 3300006353 | Bacteria | 2214 |
| 52 | Ga0068871_100276144 | 3300006358 | Bacteria | 1469 |
| 53 | Ga0105240_10052581 | 3300009093 | Bacteria | 5119 |
| 54 | Ga0105240_10204427 | 3300009093 | Bacteria | 2313 |
| 55 | Ga0105245_10100397 | 3300009098 | Bacteria | 2677 |
| 56 | Ga0105237_10042807 | 3300009545 | Bacteria | 4564 |
| 57 | Ga0105237_10185988 | 3300009545 | Bacteria | 2077 |
| 58 | Ga0105238_10181271 | 3300009551 | Bacteria | 2083 |
| 59 | Ga0105239_10009446 | 3300010375 | Bacteria | 10988 |
| 60 | Ga0105239_10026408 | 3300010375 | Bacteria | 6390 |
| 61 | Ga0105239_10032501 | 3300010375 | Bacteria | 5733 |
| 62 | Ga0157370_10002111 | 3300013104 | Bacteria | 24281 |
| 63 | Ga0157370_10026421 | 3300013104 | Bacteria | 5733 |
| 64 | Ga0157370_10063393 | 3300013104 | Bacteria | 3502 |
| 65 | Ga0157369_10000456 | 3300013105 | Bacteria | 54115 |
| 66 | Ga0157369_10094510 | 3300013105 | Bacteria | 3191 |
| 67 | Ga0163163_10138544 | 3300014325 | Bacteria | 2475 |
| 68 | Ga0182008_10000207 | 3300014497 | Bacteria | 46359 |
| 69 | Ga0182008_10001172 | 3300014497 | Bacteria | 18079 |
| 70 | Ga0182007_10000185 | 3300015262 | Bacteria | 42160 |
| 71 | Ga0183361_10004 | 3300016635 | Bacteria | 484183 |
| 72 | Ga0163161_10029573 | 3300017792 | Bacteria | 3895 |
| 73 | Ga0206351_10335682 | 3300020077 | Bacteria | 1452 |
| 74 | Ga0213872_10004947 | 3300021361 | Bacteria | 6929 |
| 75 | Ga0213874_10005811 | 3300021377 | Bacteria | 2893 |
| 76 | Ga0213874_10041177 | 3300021377 | Bacteria | 1382 |
| 77 | Ga0213875_10002153 | 3300021388 | Bacteria | 12022 |
| 78 | Ga0213875_10005307 | 3300021388 | Bacteria | 6932 |
| 79 | Ga0213871_10004697 | 3300021441 | Bacteria | 2754 |
| 80 | Ga0213871_10006847 | 3300021441 | Bacteria | 2433 |
| 81 | Ga0224712_10092263 | 3300022467 | Bacteria | 1271 |
| 82 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 83 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 84 | Ga0209672_102997 | 3300025228 | Bacteria | 3707 |
| 85 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 86 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 87 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 88 | Ga0209563_100297 | 3300025230 | Bacteria | 20431 |
| 89 | Ga0209437_102228 | 3300025233 | Bacteria | 3846 |
| 90 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 91 | Ga0209258_103781 | 3300025242 | Bacteria | 3113 |
| 92 | Ga0207425_1000259 | 3300025245 | Bacteria | 39126 |
| 93 | Ga0209677_106333 | 3300025253 | Bacteria | 2824 |
| 94 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 95 | Ga0209759_1000029 | 3300025256 | Bacteria | 286968 |
| 96 | Ga0209129_1000175 | 3300025258 | Bacteria | 93817 |
| 97 | Ga0209233_1000042 | 3300025261 | Bacteria | 510519 |
| 98 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 99 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 100 | Ga0209455_1000458 | 3300025272 | Bacteria | 30970 |
| 101 | Ga0209130_1002434 | 3300025284 | Bacteria | 9333 |
| 102 | Ga0209130_1007488 | 3300025284 | Bacteria | 3361 |
| 103 | Ga0209675_1000859 | 3300025291 | Bacteria | 19681 |
| 104 | Ga0209675_1002909 | 3300025291 | Bacteria | 8479 |
| 105 | Ga0209676_1003274 | 3300025292 | Bacteria | 10168 |
| 106 | Ga0209025_1000133 | 3300025294 | Bacteria | 195885 |
| 107 | Ga0209025_1036521 | 3300025294 | Bacteria | 2199 |
| 108 | Ga0209564_1000136 | 3300025295 | Bacteria | 185198 |
| 109 | Ga0209564_1003544 | 3300025295 | Bacteria | 10502 |
| 110 | Ga0209758_1000275 | 3300025297 | Bacteria | 102404 |
| 111 | Ga0209050_1000247 | 3300025298 | Bacteria | 116514 |
| 112 | Ga0209050_1001725 | 3300025298 | Bacteria | 21758 |
| 113 | Ga0207426_1000215 | 3300025302 | Bacteria | 136757 |
| 114 | Ga0209051_1002942 | 3300025303 | Bacteria | 11644 |
| 115 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 116 | Ga0209257_1034257 | 3300025304 | Bacteria | 1586 |
| 117 | Ga0209257_1035004 | 3300025304 | Bacteria | 1558 |
| 118 | Ga0207647_10020744 | 3300025904 | Bacteria | 4401 |
| 119 | Ga0207671_10001548 | 3300025914 | Bacteria | 26304 |
| 120 | Ga0207671_10055310 | 3300025914 | Bacteria | 2940 |
| 121 | Ga0207671_10098708 | 3300025914 | Bacteria | 2209 |
| 122 | Ga0207693_10015613 | 3300025915 | Bacteria | 6089 |
| 123 | Ga0207660_10111307 | 3300025917 | Bacteria | 2061 |
| 124 | Ga0207681_10011844 | 3300025923 | Bacteria | 5367 |
| 125 | Ga0207700_10152236 | 3300025928 | Bacteria | 1912 |
| 126 | Ga0207664_10019156 | 3300025929 | Bacteria | 5052 |
| 127 | Ga0207664_10308402 | 3300025929 | Bacteria | 1394 |
| 128 | Ga0207665_10151988 | 3300025939 | Bacteria | 1659 |
| 129 | Ga0207667_10435165 | 3300025949 | Bacteria | 1334 |
| 130 | Ga0207658_10221714 | 3300025986 | Bacteria | 1591 |
| 131 | Ga0207639_10033289 | 3300026041 | Bacteria | 3801 |
| 132 | Ga0207702_10090183 | 3300026078 | Bacteria | 2682 |
| 133 | Ga0207641_10167781 | 3300026088 | Bacteria | 2001 |
| 134 | Ga0207683_10038298 | 3300026121 | Bacteria | 4178 |
| 135 | Ga0209970_1001100 | 3300027614 | Bacteria | 4768 |
| 136 | Ga0209974_10047852 | 3300027876 | Bacteria | 1433 |
| 137 | Ga0268266_10059088 | 3300028379 | Bacteria | 3303 |
| 138 | Ga0268266_10092818 | 3300028379 | Bacteria | 2649 |
| 139 | Ga0268264_10608654 | 3300028381 | Bacteria | 1077 |
| 140 | Ga0268264_10612766 | 3300028381 | Bacteria | 1074 |
| 141 | Ga0307515_10088125 | 3300028794 | Bacteria | 3928 |
| 142 | Ga0307515_10120033 | 3300028794 | Bacteria | 2985 |
| 143 | Ga0307515_10207633 | 3300028794 | Bacteria | 1813 |
| 144 | Ga0265338_10021117 | 3300028800 | Bacteria | 6806 |
| 145 | Ga0265338_10078105 | 3300028800 | Bacteria | 2794 |
| 146 | Ga0316182_1008399 | 3300030745 | Bacteria | 4575 |
| 147 | Ga0265325_10010668 | 3300031241 | Bacteria | 5307 |
| 148 | Ga0265340_10001253 | 3300031247 | Bacteria | 14589 |
| 149 | Ga0265340_10006435 | 3300031247 | Bacteria | 6466 |
| 150 | Ga0265339_10016011 | 3300031249 | Bacteria | 4479 |
| 151 | Ga0265327_10006362 | 3300031251 | Bacteria | 9468 |
| 152 | Ga0265316_10016679 | 3300031344 | Bacteria | 6366 |
| 153 | Ga0307513_10003617 | 3300031456 | Bacteria | 20916 |
| 154 | Ga0307513_10006404 | 3300031456 | Bacteria | 15387 |
| 155 | Ga0307408_100191867 | 3300031548 | Bacteria | 1646 |
| 156 | Ga0265313_10000868 | 3300031595 | Bacteria | 30518 |
| 157 | Ga0265313_10012675 | 3300031595 | Bacteria | 5122 |
| 158 | Ga0265342_10009354 | 3300031712 | Bacteria | 6916 |
| 159 | Ga0307516_10007190 | 3300031730 | Bacteria | 12848 |
| 160 | Ga0307516_10144939 | 3300031730 | Bacteria | 2141 |
| 161 | Ga0307405_10109898 | 3300031731 | Bacteria | 1866 |
| 162 | Ga0307405_10113682 | 3300031731 | Bacteria | 1838 |
| 163 | Ga0307412_10189538 | 3300031911 | Bacteria | 1553 |
| 164 | Ga0307416_100011432 | 3300032002 | Bacteria | 5921 |
| 165 | Ga0307416_100152441 | 3300032002 | Bacteria | 2122 |
| 166 | Ga0307411_10270568 | 3300032005 | Bacteria | 1347 |
| 167 | Ga0307510_10070419 | 3300033180 | Bacteria | 3492 |
| 168 | Ga0373923_0015792 | 3300035111 | Bacteria | 2857 |
| 169 | Ga0373956_0152361 | 3300035119 | Bacteria | 1088 |
| 170 | Ga0373957_0012606 | 3300035120 | Bacteria | 2850 |
| 171 | Ga0373955_0077475 | 3300035172 | Bacteria | 1872 |
| 172 | Ga0373924_0042653 | 3300035410 | Bacteria | 1862 |
| 173 | Ga0373935_0017426 | 3300035692 | Bacteria | 4358 |
| 174 | Ga0373935_0092902 | 3300035692 | Bacteria | 1978 |
| 175 | Ga0373927_0131650 | 3300035695 | Bacteria | 1634 |
| 176 | Ga0373947_0068646 | 3300035725 | Bacteria | 2168 |
| 177 | Ga0373947_0133707 | 3300035725 | Bacteria | 1585 |
| 178 | Ga0373937_0028200 | 3300036401 | Bacteria | 5079 |
| 179 | Ga0373937_0037534 | 3300036401 | Bacteria | 4416 |
| 180 | Ga0373937_0248267 | 3300036401 | Bacteria | 1677 |
| 181 | Ga0395899_0012056 | 3300037312 | Bacteria | 6624 |
| 182 | Ga0395899_0080533 | 3300037312 | Bacteria | 2370 |
| 183 | Ga0395900_0041760 | 3300037418 | Bacteria | 4727 |
| 184 | Ga0395900_0129594 | 3300037418 | Bacteria | 2586 |
| 185 | Ga0395898_0202998 | 3300037466 | Bacteria | 1892 |
| 186 | Ga0395905_0018276 | 3300037471 | Bacteria | 6656 |
| 187 | Ga0395905_0031014 | 3300037471 | Bacteria | 5034 |
| 188 | Ga0395905_0033541 | 3300037471 | Bacteria | 4822 |
| 189 | Ga0395905_0271500 | 3300037471 | Bacteria | 1582 |
| 190 | Ga0436364_0358205 | 3300037853 | Bacteria | 23269 |
| 191 | Ga0436364_1116391 | 3300037853 | Bacteria | 6929 |
| 192 | Ga0436364_1387451 | 3300037853 | Bacteria | 3041 |
| 193 | Ga0395901_0034290 | 3300038443 | Bacteria | 5242 |
| 194 | Ga0395901_0081262 | 3300038443 | Bacteria | 3385 |
| 195 | Ga0436360_0364066 | 3300039438 | Bacteria | 4711 |
| 196 | Ga0436360_1115109 | 3300039438 | Bacteria | 17128 |
| 197 | Ga0436361_0215473 | 3300039447 | Bacteria | 3189 |
| 198 | Ga0436361_0238116 | 3300039447 | Bacteria | 14192 |
| 199 | Ga0436363_1449656 | 3300039450 | Bacteria | 2522 |
| 200 | Ga0436362_0075426 | 3300039453 | Bacteria | 2264 |
| 201 | Ga0436362_0206709 | 3300039453 | Bacteria | 1782 |
| 202 | Ga0436362_0928376 | 3300039453 | Bacteria | 12218 |
| 203 | Ga0439436_0027526 | 3300041404 | Bacteria | 1662 |
| 204 | Ga0439439_0005367 | 3300041406 | Bacteria | 2924 |
| 205 | Ga0439447_009443 | 3300041407 | Bacteria | 2957 |
| 206 | Ga0451791_1020741 | 3300041451 | Bacteria | 1134 |
| 207 | Ga0451793_0014015 | 3300041452 | Bacteria | 2637 |
| 208 | Ga0451804_0460381 | 3300041463 | Bacteria | 1248 |
| 209 | Ga0439442_014778 | 3300042002 | Bacteria | 1607 |
| 210 | Ga0439432_010813 | 3300042006 | Bacteria | 3154 |
| 211 | Ga0439449_0020201 | 3300042007 | Bacteria | 2495 |
| 212 | Ga0439449_0058382 | 3300042007 | Bacteria | 1424 |
| 213 | Ga0439452_003011 | 3300042010 | Bacteria | 5990 |
| 214 | Ga0439462_0016999 | 3300042015 | Bacteria | 1884 |
| 215 | Ga0450898_007356 | 3300042134 | Bacteria | 1713 |
| 216 | Ga0450906_013089 | 3300042145 | Bacteria | 1533 |
| 217 | Ga0450908_004996 | 3300042184 | Bacteria | 2547 |
| 218 | Ga0439434_0025222 | 3300042435 | Bacteria | 1794 |
| 219 | Ga0466972_0143240 | 3300044658 | Bacteria | 1124 |
| 220 | Ga0466965_0005137 | 3300044683 | Bacteria | 5874 |
| 221 | Ga0466965_0045602 | 3300044683 | Bacteria | 2168 |
| 222 | Ga0466968_0049017 | 3300044735 | Bacteria | 1798 |
| 223 | Ga0466957_0113444 | 3300044842 | Bacteria | 1721 |
| 224 | Ga0466957_0235598 | 3300044842 | Bacteria | 1213 |
| 225 | Ga0466960_0009903 | 3300044901 | Bacteria | 3943 |
| 226 | Ga0466960_0055374 | 3300044901 | Bacteria | 1928 |
| 227 | Ga0466959_0064625 | 3300045049 | Bacteria | 2657 |
| 228 | Ga0466958_0004893 | 3300045836 | Bacteria | 7135 |
| 229 | Ga0466967_0298367 | 3300045976 | Bacteria | 1550 |
| 230 | Ga0495617_059250 | 3300046452 | Bacteria | 1268 |
| 231 | Ga0495627_021365 | 3300046453 | Bacteria | 2147 |
| 232 | Ga0495592_0002222 | 3300046454 | Bacteria | 13694 |
| 233 | Ga0495603_0064901 | 3300046455 | Bacteria | 2152 |
| 234 | Ga0495590_0009693 | 3300046457 | Bacteria | 3651 |
| 235 | Ga0495629_0010469 | 3300046459 | Bacteria | 6747 |
| 236 | Ga0495638_0000016 | 3300046460 | Bacteria | 396505 |
| 237 | Ga0495651_0277595 | 3300046462 | Bacteria | 1133 |
| 238 | Ga0495653_0161473 | 3300046463 | Bacteria | 1555 |
| 239 | Ga0495650_0031922 | 3300046471 | Bacteria | 2362 |
| 240 | Ga0495582_0005593 | 3300046473 | Bacteria | 6997 |
| 241 | Ga0495639_0027894 | 3300046475 | Bacteria | 2500 |
| 242 | Ga0495664_0020193 | 3300046477 | Bacteria | 3840 |
| 243 | Ga0495664_0056850 | 3300046477 | Bacteria | 2328 |
| 244 | Ga0495664_0203836 | 3300046477 | Bacteria | 1198 |
| 245 | Ga0495584_0023511 | 3300046491 | Bacteria | 3124 |
| 246 | Ga0495583_0002328 | 3300046506 | Bacteria | 16525 |
| 247 | Ga0495606_0011615 | 3300046507 | Bacteria | 7159 |
| 248 | Ga0495608_0000402 | 3300046511 | Bacteria | 30297 |
| 249 | Ga0495616_0000024 | 3300046513 | Bacteria | 145530 |
| 250 | Ga0495628_0138673 | 3300046516 | Bacteria | 1857 |
| 251 | Ga0495628_0206503 | 3300046516 | Bacteria | 1479 |
| 252 | Ga0495630_0029290 | 3300046517 | Bacteria | 4092 |
| 253 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 254 | Ga0495632_0000981 | 3300046519 | Bacteria | 24925 |
| 255 | Ga0495632_0003923 | 3300046519 | Bacteria | 10332 |
| 256 | Ga0495637_0000108 | 3300046520 | Bacteria | 60028 |
| 257 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 258 | Ga0495643_0114130 | 3300046522 | Bacteria | 1370 |
| 259 | Ga0495648_0000013 | 3300046524 | Bacteria | 289090 |
| 260 | Ga0495648_0089805 | 3300046524 | Bacteria | 1723 |
| 261 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 262 | Ga0495666_0003213 | 3300046526 | Bacteria | 8230 |
| 263 | Ga0495642_0028045 | 3300046528 | Bacteria | 2241 |
| 264 | Ga0495652_0001389 | 3300046529 | Bacteria | 26896 |
| 265 | Ga0495652_0090181 | 3300046529 | Bacteria | 2509 |
| 266 | Ga0495665_0019047 | 3300046531 | Bacteria | 3689 |
| 267 | Ga0495640_0012384 | 3300046533 | Bacteria | 6519 |
| 268 | Ga0495640_0044587 | 3300046533 | Bacteria | 3083 |
| 269 | Ga0495586_0010277 | 3300046535 | Bacteria | 4978 |
| 270 | Ga0495587_0254247 | 3300046536 | Bacteria | 987 |
| 271 | Ga0495597_0122745 | 3300046542 | Bacteria | 1082 |
| 272 | Ga0495645_0014618 | 3300046543 | Bacteria | 5573 |
| 273 | Ga0495645_0084919 | 3300046543 | Bacteria | 2266 |
| 274 | Ga0495633_0000376 | 3300046558 | Bacteria | 47585 |
| 275 | Ga0495633_0000712 | 3300046558 | Bacteria | 30211 |
| 276 | Ga0495633_0038233 | 3300046558 | Bacteria | 2293 |
| 277 | Ga0495633_0121450 | 3300046558 | Bacteria | 1210 |
| 278 | Ga0495667_0039595 | 3300046559 | Bacteria | 3134 |
| 279 | Ga0495667_0075946 | 3300046559 | Bacteria | 2186 |
| 280 | Ga0495656_0077773 | 3300046615 | Bacteria | 1490 |
| 281 | Ga0495668_0224618 | 3300046616 | Bacteria | 1028 |
| 282 | Ga0495634_0003103 | 3300046642 | Bacteria | 13505 |
| 283 | Ga0495635_0000831 | 3300046663 | Bacteria | 20224 |
| 284 | Ga0495657_0009326 | 3300046675 | Bacteria | 7448 |
| 285 | Ga0495599_0162658 | 3300046678 | Bacteria | 1379 |
| 286 | Ga0495646_0008101 | 3300046680 | Bacteria | 6680 |
| 287 | Ga0495646_0077537 | 3300046680 | Bacteria | 1943 |
| 288 | Ga0495669_0119002 | 3300046684 | Bacteria | 1237 |
| 289 | Ga0495624_0001875 | 3300046690 | Bacteria | 16011 |
| 290 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 291 | Ga0495671_0000018 | 3300046692 | Bacteria | 291470 |
| 292 | Ga0495671_0093140 | 3300046692 | Bacteria | 1474 |
| 293 | Ga0495649_0000215 | 3300046694 | Bacteria | 50655 |
| 294 | Ga0495649_0117585 | 3300046694 | Bacteria | 1407 |
| 295 | Ga0495600_0000230 | 3300046809 | Bacteria | 30997 |
| 296 | Ga0495600_0113246 | 3300046809 | Bacteria | 1766 |
| 297 | Ga0495604_0062938 | 3300047317 | Bacteria | 2832 |
| 298 | Ga0495674_0043574 | 3300047319 | Bacteria | 3995 |
| 299 | Ga0495674_0185896 | 3300047319 | Bacteria | 1729 |
| 300 | Ga0495674_0226263 | 3300047319 | Bacteria | 1545 |
| 301 | Ga0495680_0137024 | 3300047322 | Bacteria | 1794 |
| 302 | Ga0495683_0080014 | 3300047323 | Bacteria | 1595 |
| 303 | Ga0495687_030818 | 3300047443 | Bacteria | 2467 |
| 304 | Ga0495675_0001459 | 3300047444 | Bacteria | 14311 |
| 305 | Ga0495673_0000130 | 3300047469 | Bacteria | 138192 |
| 306 | Ga0495681_0002647 | 3300047470 | Bacteria | 12699 |
| 307 | Ga0495686_0056305 | 3300047472 | Bacteria | 2457 |
| 308 | Ga0495686_0202899 | 3300047472 | Bacteria | 1137 |
| 309 | Ga0495593_0109165 | 3300047673 | Bacteria | 1413 |
| 310 | Ga0495602_0004338 | 3300048088 | Bacteria | 14783 |
| 311 | Ga0495626_0013588 | 3300048091 | Bacteria | 4228 |
| 312 | Ga0496100_0000078 | 3300048903 | Bacteria | 54410 |
| 313 | Ga0496100_0002476 | 3300048903 | Bacteria | 9386 |
| 314 | Ga0496101_0000519 | 3300048904 | Bacteria | 24028 |
| 315 | Ga0496101_0000538 | 3300048904 | Bacteria | 23231 |
| 316 | Ga0496102_0000165 | 3300048905 | Bacteria | 89141 |
| 317 | Ga0496102_0001291 | 3300048905 | Bacteria | 22509 |
| 318 | Ga0496102_0048671 | 3300048905 | Bacteria | 3854 |
| 319 | Ga0496102_0048973 | 3300048905 | Bacteria | 3843 |
| 320 | Ga0496102_0381262 | 3300048905 | Bacteria | 1327 |
| 321 | Ga0496103_0000644 | 3300048906 | Bacteria | 26380 |
| 322 | Ga0496103_0004323 | 3300048906 | Bacteria | 8633 |
| 323 | Ga0496104_0003338 | 3300048907 | Bacteria | 13853 |
| 324 | Ga0496104_0066930 | 3300048907 | Bacteria | 3411 |
| 325 | Ga0496105_0000375 | 3300048908 | Bacteria | 29508 |
| 326 | Ga0496105_0040921 | 3300048908 | Bacteria | 3820 |
| 327 | Ga0496106_0002941 | 3300048909 | Bacteria | 12680 |
| 328 | Ga0496106_0051310 | 3300048909 | Bacteria | 3110 |
| 329 | Ga0496107_0103389 | 3300048910 | Bacteria | 2090 |
| 330 | Ga0496109_0047712 | 3300048912 | Bacteria | 3895 |
| 331 | Ga0496110_0001501 | 3300048913 | Bacteria | 16929 |
| 332 | Ga0496111_0013567 | 3300048914 | Bacteria | 5548 |
| 333 | Ga0496114_0030386 | 3300048917 | Bacteria | 4445 |
| 334 | Ga0496116_0076685 | 3300048919 | Bacteria | 2092 |
| 335 | Ga0496117_0000707 | 3300048920 | Bacteria | 52889 |
| 336 | Ga0496118_0000283 | 3300048921 | Bacteria | 89206 |
| 337 | Ga0496118_0068641 | 3300048921 | Bacteria | 2573 |
| 338 | Ga0496121_0001005 | 3300048924 | Bacteria | 50368 |
| 339 | Ga0496121_0004227 | 3300048924 | Bacteria | 19554 |
| 340 | Ga0496121_0008605 | 3300048924 | Bacteria | 11948 |
| 341 | Ga0496121_0011190 | 3300048924 | Bacteria | 10001 |
| 342 | Ga0496121_0082415 | 3300048924 | Bacteria | 2543 |
| 343 | Ga0496121_0121436 | 3300048924 | Bacteria | 1972 |
| 344 | Ga0496121_0125262 | 3300048924 | Bacteria | 1933 |
| 345 | Ga0496122_0000034 | 3300048925 | Bacteria | 320661 |
| 346 | Ga0496123_0000141 | 3300048926 | Bacteria | 147111 |
| 347 | Ga0496123_0014329 | 3300048926 | Bacteria | 6579 |
| 348 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 349 | Ga0496124_0006512 | 3300048927 | Bacteria | 12709 |
| 350 | Ga0496124_0023619 | 3300048927 | Bacteria | 5609 |
| 351 | Ga0496125_0004960 | 3300048928 | Bacteria | 15051 |
| 352 | Ga0496126_0143867 | 3300048929 | Bacteria | 2050 |
| 353 | Ga0496126_0167674 | 3300048929 | Bacteria | 1873 |
| 354 | Ga0496126_0392036 | 3300048929 | Bacteria | 1128 |
| 355 | Ga0501031_0012665 | 3300049568 | Bacteria | 5507 |
| 356 | Ga0501031_0050911 | 3300049568 | Bacteria | 2697 |
| 357 | Ga0501031_0100690 | 3300049568 | Bacteria | 1885 |
| 358 | Ga0501033_0003584 | 3300049570 | Bacteria | 12688 |
| 359 | Ga0501034_0006814 | 3300049571 | Bacteria | 12219 |
| 360 | Ga0501034_0017460 | 3300049571 | Bacteria | 7359 |
| 361 | Ga0501034_0031655 | 3300049571 | Bacteria | 5373 |
| 362 | Ga0501034_0323976 | 3300049571 | Bacteria | 1473 |
| 363 | Ga0501036_0001771 | 3300049572 | Bacteria | 16761 |
| 364 | Ga0501037_0004252 | 3300049573 | Bacteria | 10376 |
| 365 | Ga0501038_0000494 | 3300049574 | Bacteria | 34711 |
| 366 | Ga0501038_0183691 | 3300049574 | Bacteria | 1686 |
| 367 | Ga0501043_0000038 | 3300049579 | Bacteria | 128656 |
| 368 | Ga0501043_0001194 | 3300049579 | Bacteria | 22852 |
| 369 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 370 | Ga0501046_0002440 | 3300049580 | Bacteria | 17427 |
| 371 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 372 | Ga0501047_0004711 | 3300049581 | Bacteria | 12827 |
| 373 | Ga0501048_0025913 | 3300049582 | Bacteria | 4272 |
| 374 | Ga0501073_0018665 | 3300049589 | Bacteria | 5013 |
| 375 | Ga0501083_0114295 | 3300049744 | Bacteria | 1773 |
| 376 | Ga0501035_0012428 | 3300049822 | Bacteria | 7869 |
| 377 | Ga0501035_0082472 | 3300049822 | Bacteria | 2837 |
| 378 | Ga0501044_0000236 | 3300049823 | Bacteria | 69634 |
| 379 | Ga0501044_0012609 | 3300049823 | Bacteria | 9154 |
| 380 | Ga0501044_0120424 | 3300049823 | Bacteria | 2626 |
| 381 | Ga0501045_0001444 | 3300049824 | Bacteria | 15788 |
| 382 | nmdc:mga0k408_12909_c1 | 3300050493 | Bacteria | 4574 |
| 383 | nmdc:mga0k408_57926_c1 | 3300050493 | Bacteria | 2250 |
| 384 | nmdc:mga06z11_229142_c1 | 3300050494 | Bacteria | 1088 |
| 385 | nmdc:mga07m45_1871_c1 | 3300050496 | Bacteria | 9721 |
| 386 | nmdc:mga07m45_59696_c1 | 3300050496 | Bacteria | 2158 |
| 387 | Ga0495601_0071443 | 3300053077 | Bacteria | 2216 |
| 388 | Ga0495612_0004971 | 3300053078 | Bacteria | 5501 |
| 389 | Ga0495619_0048935 | 3300053085 | Bacteria | 2786 |
| 390 | Ga0500578_0000282 | 3300053086 | Bacteria | 62821 |
| 391 | Ga0500578_0011827 | 3300053086 | Bacteria | 5638 |
| 392 | Ga0500644_0007025 | 3300053088 | Bacteria | 2914 |
| 393 | Ga0500644_0010532 | 3300053088 | Bacteria | 2505 |
| 394 | Ga0500646_0005168 | 3300053090 | Bacteria | 3303 |
| 395 | Ga0500651_0007140 | 3300053093 | Bacteria | 6499 |
| 396 | Ga0500651_0037393 | 3300053093 | Bacteria | 3059 |
| 397 | Ga0500562_012690 | 3300053108 | Bacteria | 2145 |
| 398 | Ga0500562_052966 | 3300053108 | Bacteria | 1087 |
| 399 | Ga0500569_009892 | 3300053109 | Bacteria | 2228 |
| 400 | Ga0500594_0008201 | 3300053118 | Bacteria | 2377 |
| 401 | Ga0500618_024064 | 3300053125 | Bacteria | 1469 |
| 402 | Ga0500623_067945 | 3300053127 | Bacteria | 1738 |
| 403 | Ga0500642_0003827 | 3300053130 | Bacteria | 4619 |
| 404 | Ga0500652_000383 | 3300053131 | Bacteria | 15945 |
| 405 | Ga0500559_0000193 | 3300053136 | Bacteria | 49137 |
| 406 | Ga0500568_0015225 | 3300053139 | Bacteria | 3447 |
| 407 | Ga0500568_0033481 | 3300053139 | Bacteria | 2108 |
| 408 | Ga0500586_004111 | 3300053145 | Bacteria | 3517 |
| 409 | Ga0500604_0015984 | 3300053151 | Bacteria | 2062 |
| 410 | Ga0500604_0022552 | 3300053151 | Bacteria | 1788 |
| 411 | Ga0500619_000050 | 3300053154 | Bacteria | 36425 |
| 412 | Ga0500622_0000413 | 3300053156 | Bacteria | 40682 |
| 413 | Ga0500622_0001707 | 3300053156 | Bacteria | 17033 |
| 414 | Ga0500622_0126224 | 3300053156 | Bacteria | 1235 |
| 415 | Ga0500624_001172 | 3300053157 | Bacteria | 4777 |
| 416 | Ga0500645_003922 | 3300053730 | Bacteria | 5868 |
| 417 | Ga0500587_003153 | 3300053739 | Bacteria | 2321 |
| 418 | Ga0587072_017798 | 3300059643 | Bacteria | 1229 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046558 | Ga0495633_0121450 | Ga0495633_0121450_13_807 | 248 |
| 2 | 3300046616 | Ga0495668_0224618 | Ga0495668_0224618_11_805 | 248 |
| 3 | 3300042007 | Ga0439449_0058382 | Ga0439449_0058382_16_870 | 267 |
| 4 | 3300026088 | Ga0207641_10167781 | Ga0207641_101677812 | 268 |
| 5 | iso_pu_bacteria | 2961136820 | 2961142909 | 271 |
| 6 | 3300035120 | Ga0373957_0012606 | Ga0373957_0012606_1962_2834 | 273 |
| 7 | 3300046462 | Ga0495651_0277595 | Ga0495651_0277595_236_1108 | 273 |
| 8 | 3300046524 | Ga0495648_0089805 | Ga0495648_0089805_11_880 | 273 |
| 9 | 3300048924 | Ga0496121_0082415 | Ga0496121_0082415_1397_2266 | 273 |
| 10 | 3300048927 | Ga0496124_0000024 | Ga0496124_0000024_322835_323704 | 273 |
| 11 | 3300050494 | nmdc:mga06z11_229142_c1 | nmdc:mga06z11_229142_c1_188_1060 | 273 |
| 12 | 3300013105 | Ga0157369_10094510 | Ga0157369_100945102 | 274 |
| 13 | 3300046455 | Ga0495603_0064901 | Ga0495603_0064901_574_1446 | 274 |
| 14 | 3300046459 | Ga0495629_0010469 | Ga0495629_0010469_4259_5131 | 274 |
| 15 | 3300046473 | Ga0495582_0005593 | Ga0495582_0005593_4641_5513 | 274 |
| 16 | 3300046511 | Ga0495608_0000402 | Ga0495608_0000402_4485_5357 | 274 |
| 17 | 3300046517 | Ga0495630_0029290 | Ga0495630_0029290_1135_2007 | 274 |
| 18 | 3300046526 | Ga0495666_0003213 | Ga0495666_0003213_5926_6798 | 274 |
| 19 | 3300046529 | Ga0495652_0001389 | Ga0495652_0001389_24172_25044 | 274 |
| 20 | 3300046531 | Ga0495665_0019047 | Ga0495665_0019047_2525_3397 | 274 |
| 21 | 3300046533 | Ga0495640_0012384 | Ga0495640_0012384_5483_6355 | 274 |
| 22 | 3300046535 | Ga0495586_0010277 | Ga0495586_0010277_617_1489 | 274 |
| 23 | 3300046559 | Ga0495667_0039595 | Ga0495667_0039595_1080_1952 | 274 |
| 24 | 3300046642 | Ga0495634_0003103 | Ga0495634_0003103_10717_11589 | 274 |
| 25 | 3300046663 | Ga0495635_0000831 | Ga0495635_0000831_10472_11344 | 274 |
| 26 | 3300046675 | Ga0495657_0009326 | Ga0495657_0009326_886_1758 | 274 |
| 27 | 3300046680 | Ga0495646_0008101 | Ga0495646_0008101_1988_2860 | 274 |
| 28 | 3300046690 | Ga0495624_0001875 | Ga0495624_0001875_14005_14877 | 274 |
| 29 | 3300046694 | Ga0495649_0117585 | Ga0495649_0117585_36_908 | 274 |
| 30 | 3300046809 | Ga0495600_0000230 | Ga0495600_0000230_19419_20291 | 274 |
| 31 | 3300047444 | Ga0495675_0001459 | Ga0495675_0001459_4466_5338 | 274 |
| 32 | 3300047673 | Ga0495593_0109165 | Ga0495593_0109165_165_1037 | 274 |
| 33 | 3300005546 | Ga0070696_100008623 | Ga0070696_1000086236 | 287 |
| 34 | 3300003759 | Ga0055525_1000084 | Ga0055525_1000084146 | 288 |
| 35 | 3300025230 | Ga0209563_100025 | Ga0209563_100025147 | 288 |
| 36 | iso_pu_bacteria | 8047673197 | 8047678455 | 288 |
| 37 | iso_pu_bacteria | 2585428057 | 2587730920 | 289 |
| 38 | iso_pu_bacteria | 2585428058 | 2587736045 | 289 |
| 39 | iso_pu_bacteria | 2599185317 | 2600028429 | 289 |
| 40 | iso_pu_bacteria | 2600254930 | 2600357596 | 289 |
| 41 | iso_pu_bacteria | 2808606385 | 2808981022 | 289 |
| 42 | iso_pu_bacteria | 2808606388 | 2808996747 | 289 |
| 43 | iso_pu_bacteria | 2852612431 | 2852617746 | 289 |
| 44 | iso_pu_bacteria | 2852667396 | 2852672890 | 289 |
| 45 | 3300003759 | Ga0055525_1000021 | Ga0055525_1000021237 | 290 |
| 46 | 3300005327 | Ga0070658_10222377 | Ga0070658_102223772 | 290 |
| 47 | 3300014497 | Ga0182008_10001172 | Ga0182008_1000117212 | 290 |
| 48 | 3300015262 | Ga0182007_10000185 | Ga0182007_1000018520 | 290 |
| 49 | 3300025230 | Ga0209563_100005 | Ga0209563_10000590 | 290 |
| 50 | 3300037418 | Ga0395900_0129594 | Ga0395900_0129594_932_1861 | 290 |
| 51 | 3300038443 | Ga0395901_0034290 | Ga0395901_0034290_3976_4905 | 290 |
| 52 | iso_pu_bacteria | 2643221621 | 2644121231 | 290 |
| 53 | iso_pu_bacteria | 2844009547 | 2844012754 | 290 |
| 54 | iso_pu_bacteria | 2856328259 | 2856333583 | 290 |
| 55 | iso_pu_bacteria | 2856334872 | 2856335879 | 290 |
| 56 | iso_pu_bacteria | 2857367948 | 2857369893 | 290 |
| 57 | iso_pu_bacteria | 2857542790 | 2857545018 | 290 |
| 58 | iso_pu_bacteria | 2869169390 | 2869169802 | 290 |
| 59 | iso_pu_bacteria | 2869234852 | 2869239075 | 290 |
| 60 | iso_pu_bacteria | 2869242130 | 2869246955 | 290 |
| 61 | iso_pu_bacteria | 2869256925 | 2869262301 | 290 |
| 62 | iso_pu_bacteria | 2869271264 | 2869274760 | 290 |
| 63 | iso_pu_bacteria | 2871435913 | 2871441266 | 290 |
| 64 | iso_pu_bacteria | 2871481445 | 2871486183 | 290 |
| 65 | iso_pu_bacteria | 2874109183 | 2874115163 | 290 |
| 66 | iso_pu_bacteria | 2874116593 | 2874121327 | 290 |
| 67 | iso_pu_bacteria | 2874162495 | 2874164966 | 290 |
| 68 | iso_pu_bacteria | 2876386047 | 2876392757 | 290 |
| 69 | iso_pu_bacteria | 2876399893 | 2876406572 | 290 |
| 70 | iso_pu_bacteria | 2876406927 | 2876410757 | 290 |
| 71 | iso_pu_bacteria | 2876420981 | 2876422542 | 290 |
| 72 | iso_pu_bacteria | 2878730984 | 2878736264 | 290 |
| 73 | iso_pu_bacteria | 2878774303 | 2878778324 | 290 |
| 74 | iso_pu_bacteria | 2896253425 | 2896256558 | 290 |
| 75 | iso_pu_bacteria | 2903513507 | 2903515784 | 290 |
| 76 | iso_pu_bacteria | 2906386501 | 2906393399 | 290 |
| 77 | iso_pu_bacteria | 2906401398 | 2906404038 | 290 |
| 78 | iso_pu_bacteria | 2906408224 | 2906414151 | 290 |
| 79 | iso_pu_bacteria | 2906427513 | 2906428215 | 290 |
| 80 | iso_pu_bacteria | 2922172374 | 2922178425 | 290 |
| 81 | iso_pu_bacteria | 2922178524 | 2922181285 | 290 |
| 82 | iso_pu_bacteria | 2924710171 | 2924716390 | 290 |
| 83 | iso_pu_bacteria | 2924741084 | 2924744484 | 290 |
| 84 | iso_pu_bacteria | 2924748358 | 2924754240 | 290 |
| 85 | iso_pu_bacteria | 2937861824 | 2937862348 | 290 |
| 86 | iso_pu_bacteria | 2937980651 | 2937984083 | 290 |
| 87 | iso_pu_bacteria | 2958108152 | 2958111126 | 290 |
| 88 | iso_pu_bacteria | 2958122699 | 2958123644 | 290 |
| 89 | iso_pu_bacteria | 2958137437 | 2958138719 | 290 |
| 90 | iso_pu_bacteria | 2958158011 | 2958158340 | 290 |
| 91 | iso_pu_bacteria | 2961183825 | 2961188565 | 290 |
| 92 | iso_pu_bacteria | 2965025482 | 2965025876 | 290 |
| 93 | iso_pu_bacteria | 2965032056 | 2965034843 | 290 |
| 94 | iso_pu_bacteria | 2965047637 | 2965054941 | 290 |
| 95 | iso_pu_bacteria | 2965102966 | 2965109409 | 290 |
| 96 | iso_pu_bacteria | 2970510686 | 2970515481 | 290 |
| 97 | iso_pu_bacteria | 2970532167 | 2970534073 | 290 |
| 98 | iso_pu_bacteria | 2970547951 | 2970551570 | 290 |
| 99 | iso_pu_bacteria | 2970619444 | 2970625174 | 290 |
| 100 | iso_pu_bacteria | 2970627176 | 2970632828 | 290 |
| 101 | iso_pu_bacteria | 2977851361 | 2977851868 | 290 |
| 102 | iso_pu_bacteria | 2977872689 | 2977874415 | 290 |
| 103 | iso_pu_bacteria | 2977898635 | 2977904736 | 290 |
| 104 | iso_pu_bacteria | 2977907340 | 2977908536 | 290 |
| 105 | iso_pu_bacteria | 2977935797 | 2977941967 | 290 |
| 106 | iso_pu_bacteria | 2977957713 | 2977958757 | 290 |
| 107 | iso_pu_bacteria | 2979764755 | 2979766085 | 290 |
| 108 | iso_pu_bacteria | 2979772303 | 2979776881 | 290 |
| 109 | iso_pu_bacteria | 2996386984 | 2996390165 | 290 |
| 110 | iso_pu_bacteria | 3004232784 | 3004235722 | 290 |
| 111 | iso_pu_bacteria | 3004239961 | 3004247860 | 290 |
| 112 | iso_pu_bacteria | 3004248173 | 3004250246 | 290 |
| 113 | iso_pu_bacteria | 8004300914 | 8004303905 | 290 |
| 114 | iso_pu_bacteria | 8004312739 | 8004314559 | 290 |
| 115 | iso_pu_bacteria | 8004727605 | 8004730621 | 290 |
| 116 | 3300003214 | JGI25165J46597_1000038 | JGI25165J46597_100003866 | 291 |
| 117 | 3300005356 | Ga0070674_100194496 | Ga0070674_1001944962 | 291 |
| 118 | 3300005436 | Ga0070713_100062102 | Ga0070713_1000621023 | 291 |
| 119 | 3300005456 | Ga0070678_100025491 | Ga0070678_1000254912 | 291 |
| 120 | 3300005614 | Ga0068856_100104319 | Ga0068856_1001043193 | 291 |
| 121 | 3300013104 | Ga0157370_10063393 | Ga0157370_100633932 | 291 |
| 122 | 3300014325 | Ga0163163_10138544 | Ga0163163_101385443 | 291 |
| 123 | 3300020077 | Ga0206351_10335682 | Ga0206351_103356821 | 291 |
| 124 | 3300021388 | Ga0213875_10002153 | Ga0213875_100021538 | 291 |
| 125 | 3300022467 | Ga0224712_10092263 | Ga0224712_100922631 | 291 |
| 126 | 3300025233 | Ga0209437_102228 | Ga0209437_1022283 | 291 |
| 127 | 3300025261 | Ga0209233_1000042 | Ga0209233_1000042188 | 291 |
| 128 | 3300025928 | Ga0207700_10152236 | Ga0207700_101522361 | 291 |
| 129 | 3300026078 | Ga0207702_10090183 | Ga0207702_100901832 | 291 |
| 130 | 3300026121 | Ga0207683_10038298 | Ga0207683_100382985 | 291 |
| 131 | 3300037853 | Ga0436364_0358205 | Ga0436364_0358205_12427_13353 | 291 |
| 132 | 3300037853 | Ga0436364_1387451 | Ga0436364_1387451_2092_3018 | 291 |
| 133 | 3300039453 | Ga0436362_0075426 | Ga0436362_0075426_1084_2016 | 291 |
| 134 | 3300044842 | Ga0466957_0113444 | Ga0466957_0113444_285_1229 | 291 |
| 135 | 3300044842 | Ga0466957_0235598 | Ga0466957_0235598_157_1083 | 291 |
| 136 | 3300045836 | Ga0466958_0004893 | Ga0466958_0004893_5511_6455 | 291 |
| 137 | 3300046559 | Ga0495667_0075946 | Ga0495667_0075946_93_1019 | 291 |
| 138 | 3300048929 | Ga0496126_0392036 | Ga0496126_0392036_80_1006 | 291 |
| 139 | 3300059643 | Ga0587072_017798 | Ga0587072_017798_54_980 | 291 |
| 140 | iso_pu_bacteria | 2643221541 | 2643729678 | 291 |
| 141 | iso_pu_bacteria | 2643221606 | 2644044037 | 291 |
| 142 | iso_pu_bacteria | 2643221671 | 2644392507 | 291 |
| 143 | 3300005435 | Ga0070714_100018622 | Ga0070714_1000186222 | 292 |
| 144 | 3300005436 | Ga0070713_100272470 | Ga0070713_1002724702 | 292 |
| 145 | 3300005439 | Ga0070711_100060940 | Ga0070711_1000609402 | 292 |
| 146 | 3300005530 | Ga0070679_100229057 | Ga0070679_1002290572 | 292 |
| 147 | 3300005548 | Ga0070665_100098087 | Ga0070665_1000980872 | 292 |
| 148 | 3300005937 | Ga0081455_10198572 | Ga0081455_101985722 | 292 |
| 149 | 3300009098 | Ga0105245_10100397 | Ga0105245_101003973 | 292 |
| 150 | 3300010375 | Ga0105239_10032501 | Ga0105239_100325014 | 292 |
| 151 | 3300021377 | Ga0213874_10005811 | Ga0213874_100058112 | 292 |
| 152 | 3300021388 | Ga0213875_10005307 | Ga0213875_100053077 | 292 |
| 153 | 3300021441 | Ga0213871_10004697 | Ga0213871_100046972 | 292 |
| 154 | 3300025915 | Ga0207693_10015613 | Ga0207693_100156135 | 292 |
| 155 | 3300025917 | Ga0207660_10111307 | Ga0207660_101113072 | 292 |
| 156 | 3300025929 | Ga0207664_10019156 | Ga0207664_100191563 | 292 |
| 157 | 3300025939 | Ga0207665_10151988 | Ga0207665_101519882 | 292 |
| 158 | 3300028379 | Ga0268266_10092818 | Ga0268266_100928183 | 292 |
| 159 | 3300028800 | Ga0265338_10021117 | Ga0265338_100211173 | 292 |
| 160 | 3300035111 | Ga0373923_0015792 | Ga0373923_0015792_241_1170 | 292 |
| 161 | 3300035119 | Ga0373956_0152361 | Ga0373956_0152361_99_1028 | 292 |
| 162 | 3300035172 | Ga0373955_0077475 | Ga0373955_0077475_289_1353 | 292 |
| 163 | 3300035410 | Ga0373924_0042653 | Ga0373924_0042653_900_1829 | 292 |
| 164 | 3300035692 | Ga0373935_0017426 | Ga0373935_0017426_2089_3018 | 292 |
| 165 | 3300035692 | Ga0373935_0092902 | Ga0373935_0092902_565_1494 | 292 |
| 166 | 3300035695 | Ga0373927_0131650 | Ga0373927_0131650_212_1141 | 292 |
| 167 | 3300035725 | Ga0373947_0068646 | Ga0373947_0068646_512_1441 | 292 |
| 168 | 3300035725 | Ga0373947_0133707 | Ga0373947_0133707_435_1364 | 292 |
| 169 | 3300036401 | Ga0373937_0028200 | Ga0373937_0028200_3960_4979 | 292 |
| 170 | 3300036401 | Ga0373937_0037534 | Ga0373937_0037534_1964_2893 | 292 |
| 171 | 3300036401 | Ga0373937_0248267 | Ga0373937_0248267_522_1451 | 292 |
| 172 | 3300037853 | Ga0436364_1116391 | Ga0436364_1116391_469_1398 | 292 |
| 173 | 3300039438 | Ga0436360_1115109 | Ga0436360_1115109_5477_6406 | 292 |
| 174 | 3300039450 | Ga0436363_1449656 | Ga0436363_1449656_418_1347 | 292 |
| 175 | 3300039453 | Ga0436362_0206709 | Ga0436362_0206709_74_1003 | 292 |
| 176 | 3300046463 | Ga0495653_0161473 | Ga0495653_0161473_188_1207 | 292 |
| 177 | 3300046477 | Ga0495664_0020193 | Ga0495664_0020193_772_1791 | 292 |
| 178 | 3300046477 | Ga0495664_0203836 | Ga0495664_0203836_86_1015 | 292 |
| 179 | 3300046516 | Ga0495628_0138673 | Ga0495628_0138673_435_1364 | 292 |
| 180 | 3300046516 | Ga0495628_0206503 | Ga0495628_0206503_287_1306 | 292 |
| 181 | 3300046529 | Ga0495652_0090181 | Ga0495652_0090181_381_1400 | 292 |
| 182 | 3300046533 | Ga0495640_0044587 | Ga0495640_0044587_1199_2218 | 292 |
| 183 | 3300046536 | Ga0495587_0254247 | Ga0495587_0254247_13_942 | 292 |
| 184 | 3300046543 | Ga0495645_0084919 | Ga0495645_0084919_481_1500 | 292 |
| 185 | 3300046678 | Ga0495599_0162658 | Ga0495599_0162658_254_1183 | 292 |
| 186 | 3300046680 | Ga0495646_0077537 | Ga0495646_0077537_638_1657 | 292 |
| 187 | 3300046809 | Ga0495600_0113246 | Ga0495600_0113246_63_1082 | 292 |
| 188 | 3300047317 | Ga0495604_0062938 | Ga0495604_0062938_1398_2417 | 292 |
| 189 | 3300047319 | Ga0495674_0043574 | Ga0495674_0043574_2336_3355 | 292 |
| 190 | 3300047319 | Ga0495674_0185896 | Ga0495674_0185896_651_1580 | 292 |
| 191 | 3300047319 | Ga0495674_0226263 | Ga0495674_0226263_438_1367 | 292 |
| 192 | 3300047322 | Ga0495680_0137024 | Ga0495680_0137024_345_1274 | 292 |
| 193 | 3300048088 | Ga0495602_0004338 | Ga0495602_0004338_7319_8338 | 292 |
| 194 | 3300053077 | Ga0495601_0071443 | Ga0495601_0071443_1083_2102 | 292 |
| 195 | 3300053078 | Ga0495612_0004971 | Ga0495612_0004971_1957_2976 | 292 |
| 196 | 3300053085 | Ga0495619_0048935 | Ga0495619_0048935_139_1158 | 292 |
| 197 | iso_pu_bacteria | 2585428062 | 2587756355 | 292 |
| 198 | iso_pu_bacteria | 2588253510 | 2588295816 | 292 |
| 199 | iso_pu_bacteria | 2643221592 | 2643971044 | 292 |
| 200 | iso_pu_bacteria | 2643221625 | 2644144207 | 292 |
| 201 | iso_pu_bacteria | 2643221648 | 2644275229 | 292 |
| 202 | iso_pu_bacteria | 2738541307 | 2738883034 | 292 |
| 203 | iso_pu_bacteria | 2738543012 | 2739244249 | 292 |
| 204 | iso_pu_bacteria | 2738543013 | 2739250700 | 292 |
| 205 | iso_pu_bacteria | 2816332133 | 2816472521 | 292 |
| 206 | iso_pu_bacteria | 2842747753 | 2842752924 | 292 |
| 207 | iso_pu_bacteria | 2881412998 | 2881413307 | 292 |
| 208 | iso_pu_bacteria | 2904541872 | 2904547008 | 292 |
| 209 | iso_pu_bacteria | 2929160207 | 2929164480 | 292 |
| 210 | iso_pu_bacteria | 2954767861 | 2954768303 | 292 |
| 211 | 3300005337 | Ga0070682_100007523 | Ga0070682_1000075232 | 293 |
| 212 | 3300005535 | Ga0070684_100113285 | Ga0070684_1001132853 | 293 |
| 213 | 3300005842 | Ga0068858_100212321 | Ga0068858_1002123212 | 293 |
| 214 | 3300006195 | Ga0075366_10017277 | Ga0075366_100172775 | 293 |
| 215 | 3300006353 | Ga0075370_10057355 | Ga0075370_100573552 | 293 |
| 216 | 3300021377 | Ga0213874_10041177 | Ga0213874_100411772 | 293 |
| 217 | 3300025304 | Ga0209257_1035004 | Ga0209257_10350042 | 293 |
| 218 | 3300027614 | Ga0209970_1001100 | Ga0209970_10011004 | 293 |
| 219 | 3300027876 | Ga0209974_10047852 | Ga0209974_100478522 | 293 |
| 220 | 3300041452 | Ga0451793_0014015 | Ga0451793_0014015_145_1077 | 293 |
| 221 | 3300041463 | Ga0451804_0460381 | Ga0451804_0460381_126_1058 | 293 |
| 222 | 3300042015 | Ga0439462_0016999 | Ga0439462_0016999_861_1793 | 293 |
| 223 | 3300046519 | Ga0495632_0003923 | Ga0495632_0003923_1275_2207 | 293 |
| 224 | 3300048905 | Ga0496102_0048973 | Ga0496102_0048973_2049_2981 | 293 |
| 225 | 3300050496 | nmdc:mga07m45_59696_c1 | nmdc:mga07m45_59696_c1_338_1270 | 293 |
| 226 | 3300053090 | Ga0500646_0005168 | Ga0500646_0005168_2025_2957 | 293 |
| 227 | 3300053109 | Ga0500569_009892 | Ga0500569_009892_246_1178 | 293 |
| 228 | 3300053127 | Ga0500623_067945 | Ga0500623_067945_184_1116 | 293 |
| 229 | 3300053130 | Ga0500642_0003827 | Ga0500642_0003827_2194_3126 | 293 |
| 230 | 3300053131 | Ga0500652_000383 | Ga0500652_000383_13636_14568 | 293 |
| 231 | 3300053139 | Ga0500568_0015225 | Ga0500568_0015225_57_989 | 293 |
| 232 | 3300053151 | Ga0500604_0015984 | Ga0500604_0015984_478_1410 | 293 |
| 233 | 3300053156 | Ga0500622_0001707 | Ga0500622_0001707_9178_10110 | 293 |
| 234 | 3300005338 | Ga0068868_100329810 | Ga0068868_1003298101 | 294 |
| 235 | 3300005518 | Ga0070699_100266330 | Ga0070699_1002663301 | 294 |
| 236 | 3300005546 | Ga0070696_100136626 | Ga0070696_1001366262 | 294 |
| 237 | 3300005937 | Ga0081455_10205030 | Ga0081455_102050302 | 294 |
| 238 | 3300005985 | Ga0081539_10067324 | Ga0081539_100673242 | 294 |
| 239 | 3300006038 | Ga0075365_10027047 | Ga0075365_100270473 | 294 |
| 240 | 3300009545 | Ga0105237_10042807 | Ga0105237_100428073 | 294 |
| 241 | 3300009545 | Ga0105237_10185988 | Ga0105237_101859883 | 294 |
| 242 | 3300010375 | Ga0105239_10026408 | Ga0105239_100264083 | 294 |
| 243 | 3300025914 | Ga0207671_10001548 | Ga0207671_1000154820 | 294 |
| 244 | 3300025914 | Ga0207671_10055310 | Ga0207671_100553101 | 294 |
| 245 | 3300028379 | Ga0268266_10059088 | Ga0268266_100590882 | 294 |
| 246 | 3300028800 | Ga0265338_10078105 | Ga0265338_100781053 | 294 |
| 247 | 3300031247 | Ga0265340_10001253 | Ga0265340_100012537 | 294 |
| 248 | 3300031249 | Ga0265339_10016011 | Ga0265339_100160112 | 294 |
| 249 | 3300031344 | Ga0265316_10016679 | Ga0265316_100166796 | 294 |
| 250 | 3300031595 | Ga0265313_10000868 | Ga0265313_1000086815 | 294 |
| 251 | 3300031712 | Ga0265342_10009354 | Ga0265342_100093542 | 294 |
| 252 | 3300031730 | Ga0307516_10144939 | Ga0307516_101449392 | 294 |
| 253 | 3300044658 | Ga0466972_0143240 | Ga0466972_0143240_90_1043 | 294 |
| 254 | 3300046452 | Ga0495617_059250 | Ga0495617_059250_188_1120 | 294 |
| 255 | 3300046460 | Ga0495638_0000016 | Ga0495638_0000016_229380_230312 | 294 |
| 256 | 3300046491 | Ga0495584_0023511 | Ga0495584_0023511_1487_2419 | 294 |
| 257 | 3300046506 | Ga0495583_0002328 | Ga0495583_0002328_574_1506 | 294 |
| 258 | 3300046513 | Ga0495616_0000024 | Ga0495616_0000024_121033_121965 | 294 |
| 259 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_56186_57118 | 294 |
| 260 | 3300046519 | Ga0495632_0000981 | Ga0495632_0000981_19364_20296 | 294 |
| 261 | 3300046520 | Ga0495637_0000108 | Ga0495637_0000108_52851_53783 | 294 |
| 262 | 3300046522 | Ga0495643_0000020 | Ga0495643_0000020_40972_41904 | 294 |
| 263 | 3300046524 | Ga0495648_0000013 | Ga0495648_0000013_166194_167126 | 294 |
| 264 | 3300046525 | Ga0495663_0000002 | Ga0495663_0000002_54516_55448 | 294 |
| 265 | 3300046558 | Ga0495633_0000376 | Ga0495633_0000376_30462_31394 | 294 |
| 266 | 3300046558 | Ga0495633_0000712 | Ga0495633_0000712_20573_21505 | 294 |
| 267 | 3300046558 | Ga0495633_0038233 | Ga0495633_0038233_1207_2139 | 294 |
| 268 | 3300046692 | Ga0495671_0000016 | Ga0495671_0000016_40972_41904 | 294 |
| 269 | 3300046692 | Ga0495671_0000018 | Ga0495671_0000018_168576_169508 | 294 |
| 270 | 3300046692 | Ga0495671_0093140 | Ga0495671_0093140_243_1175 | 294 |
| 271 | 3300047469 | Ga0495673_0000130 | Ga0495673_0000130_15091_16023 | 294 |
| 272 | 3300047470 | Ga0495681_0002647 | Ga0495681_0002647_4788_5720 | 294 |
| 273 | 3300047472 | Ga0495686_0056305 | Ga0495686_0056305_1466_2398 | 294 |
| 274 | 3300048924 | Ga0496121_0001005 | Ga0496121_0001005_39722_40654 | 294 |
| 275 | 3300049571 | Ga0501034_0017460 | Ga0501034_0017460_750_1688 | 294 |
| 276 | 3300049571 | Ga0501034_0323976 | Ga0501034_0323976_366_1304 | 294 |
| 277 | 3300049574 | Ga0501038_0183691 | Ga0501038_0183691_600_1538 | 294 |
| 278 | 3300053118 | Ga0500594_0008201 | Ga0500594_0008201_1408_2340 | 294 |
| 279 | 3300053154 | Ga0500619_000050 | Ga0500619_000050_28722_29660 | 294 |
| 280 | 3300053157 | Ga0500624_001172 | Ga0500624_001172_3079_4011 | 294 |
| 281 | iso_pu_bacteria | 2643221683 | 2644467759 | 294 |
| 282 | iso_pu_bacteria | 2945909444 | 2945909472 | 294 |
| 283 | iso_pu_bacteria | 2945984333 | 2945988548 | 294 |
| 284 | 3300006195 | Ga0075366_10006472 | Ga0075366_100064727 | 295 |
| 285 | 3300021361 | Ga0213872_10004947 | Ga0213872_100049474 | 295 |
| 286 | 3300021441 | Ga0213871_10006847 | Ga0213871_100068472 | 295 |
| 287 | 3300025929 | Ga0207664_10308402 | Ga0207664_103084022 | 295 |
| 288 | 3300031456 | Ga0307513_10003617 | Ga0307513_1000361718 | 295 |
| 289 | 3300031548 | Ga0307408_100191867 | Ga0307408_1001918672 | 295 |
| 290 | 3300031730 | Ga0307516_10007190 | Ga0307516_100071904 | 295 |
| 291 | 3300031731 | Ga0307405_10113682 | Ga0307405_101136822 | 295 |
| 292 | 3300031911 | Ga0307412_10189538 | Ga0307412_101895382 | 295 |
| 293 | 3300032002 | Ga0307416_100152441 | Ga0307416_1001524412 | 295 |
| 294 | 3300032005 | Ga0307411_10270568 | Ga0307411_102705682 | 295 |
| 295 | 3300037471 | Ga0395905_0031014 | Ga0395905_0031014_1282_2220 | 295 |
| 296 | 3300039438 | Ga0436360_0364066 | Ga0436360_0364066_825_1766 | 295 |
| 297 | 3300039447 | Ga0436361_0215473 | Ga0436361_0215473_626_1567 | 295 |
| 298 | 3300039447 | Ga0436361_0238116 | Ga0436361_0238116_7984_8925 | 295 |
| 299 | 3300039453 | Ga0436362_0928376 | Ga0436362_0928376_4807_5748 | 295 |
| 300 | 3300041404 | Ga0439436_0027526 | Ga0439436_0027526_374_1312 | 295 |
| 301 | 3300041406 | Ga0439439_0005367 | Ga0439439_0005367_426_1364 | 295 |
| 302 | 3300041407 | Ga0439447_009443 | Ga0439447_009443_855_1793 | 295 |
| 303 | 3300042002 | Ga0439442_014778 | Ga0439442_014778_406_1344 | 295 |
| 304 | 3300042006 | Ga0439432_010813 | Ga0439432_010813_374_1312 | 295 |
| 305 | 3300042010 | Ga0439452_003011 | Ga0439452_003011_3987_4925 | 295 |
| 306 | 3300042134 | Ga0450898_007356 | Ga0450898_007356_194_1132 | 295 |
| 307 | 3300042145 | Ga0450906_013089 | Ga0450906_013089_517_1455 | 295 |
| 308 | 3300042184 | Ga0450908_004996 | Ga0450908_004996_753_1691 | 295 |
| 309 | 3300042435 | Ga0439434_0025222 | Ga0439434_0025222_39_977 | 295 |
| 310 | 3300044735 | Ga0466968_0049017 | Ga0466968_0049017_18_962 | 295 |
| 311 | 3300045049 | Ga0466959_0064625 | Ga0466959_0064625_1316_2257 | 295 |
| 312 | 3300045976 | Ga0466967_0298367 | Ga0466967_0298367_241_1203 | 295 |
| 313 | 3300048924 | Ga0496121_0125262 | Ga0496121_0125262_383_1324 | 295 |
| 314 | 3300049589 | Ga0501073_0018665 | Ga0501073_0018665_2790_3731 | 295 |
| 315 | 3300049744 | Ga0501083_0114295 | Ga0501083_0114295_659_1600 | 295 |
| 316 | 3300050493 | nmdc:mga0k408_12909_c1 | nmdc:mga0k408_12909_c1_882_1826 | 295 |
| 317 | 3300050496 | nmdc:mga07m45_1871_c1 | nmdc:mga07m45_1871_c1_4989_5933 | 295 |
| 318 | 3300053093 | Ga0500651_0007140 | Ga0500651_0007140_2219_3160 | 295 |
| 319 | 3300002067 | JGI24735J21928_10049912 | JGI24735J21928_100499122 | 296 |
| 320 | 3300002705 | JGI25156J39149_1000576 | JGI25156J39149_100057615 | 296 |
| 321 | 3300002773 | JGI25152J39213_1002258 | JGI25152J39213_10022584 | 296 |
| 322 | 3300003187 | JGI25151J46595_10003224 | JGI25151J46595_100032248 | 296 |
| 323 | 3300003215 | JGI25153J46596_10000537 | JGI25153J46596_100005378 | 296 |
| 324 | 3300003320 | rootH2_10255115 | rootH2_102551152 | 296 |
| 325 | 3300003354 | JGI25160J50197_1000099 | JGI25160J50197_10000997 | 296 |
| 326 | 3300003756 | Ga0055533_1000085 | Ga0055533_1000085101 | 296 |
| 327 | 3300003758 | Ga0055532_1000001 | Ga0055532_1000001191 | 296 |
| 328 | 3300003760 | Ga0055527_1000002 | Ga0055527_1000002568 | 296 |
| 329 | 3300003761 | Ga0055535_1000001 | Ga0055535_1000001813 | 296 |
| 330 | 3300003762 | Ga0055542_1000001 | Ga0055542_1000001191 | 296 |
| 331 | 3300003763 | Ga0055529_1000026 | Ga0055529_100002693 | 296 |
| 332 | 3300003763 | Ga0055529_1000806 | Ga0055529_10008066 | 296 |
| 333 | 3300003771 | Ga0055526_1000296 | Ga0055526_100029625 | 296 |
| 334 | 3300003784 | Ga0055534_1000538 | Ga0055534_100053814 | 296 |
| 335 | 3300003794 | Ga0055531_10000415 | Ga0055531_100004156 | 296 |
| 336 | 3300005262 | Ga0065165_1000119 | Ga0065165_100011953 | 296 |
| 337 | 3300005331 | Ga0070670_100507377 | Ga0070670_1005073771 | 296 |
| 338 | 3300005353 | Ga0070669_100024214 | Ga0070669_1000242142 | 296 |
| 339 | 3300005367 | Ga0070667_100009961 | Ga0070667_1000099615 | 296 |
| 340 | 3300005563 | Ga0068855_100408504 | Ga0068855_1004085042 | 296 |
| 341 | 3300005578 | Ga0068854_100115815 | Ga0068854_1001158152 | 296 |
| 342 | 3300006353 | Ga0075370_10000806 | Ga0075370_100008065 | 296 |
| 343 | 3300006358 | Ga0068871_100276144 | Ga0068871_1002761442 | 296 |
| 344 | 3300009093 | Ga0105240_10052581 | Ga0105240_100525812 | 296 |
| 345 | 3300009093 | Ga0105240_10204427 | Ga0105240_102044272 | 296 |
| 346 | 3300009551 | Ga0105238_10181271 | Ga0105238_101812713 | 296 |
| 347 | 3300010375 | Ga0105239_10009446 | Ga0105239_100094469 | 296 |
| 348 | 3300013104 | Ga0157370_10002111 | Ga0157370_1000211120 | 296 |
| 349 | 3300013104 | Ga0157370_10026421 | Ga0157370_100264212 | 296 |
| 350 | 3300013105 | Ga0157369_10000456 | Ga0157369_1000045649 | 296 |
| 351 | 3300014497 | Ga0182008_10000207 | Ga0182008_100002075 | 296 |
| 352 | 3300016635 | Ga0183361_10004 | Ga0183361_10004410 | 296 |
| 353 | 3300017792 | Ga0163161_10029573 | Ga0163161_100295732 | 296 |
| 354 | 3300025226 | Ga0209674_100005 | Ga0209674_100005561 | 296 |
| 355 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011022 | 296 |
| 356 | 3300025228 | Ga0209672_102997 | Ga0209672_1029973 | 296 |
| 357 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011022 | 296 |
| 358 | 3300025230 | Ga0209563_100297 | Ga0209563_10029717 | 296 |
| 359 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011022 | 296 |
| 360 | 3300025242 | Ga0209258_103781 | Ga0209258_1037813 | 296 |
| 361 | 3300025245 | Ga0207425_1000259 | Ga0207425_100025926 | 296 |
| 362 | 3300025253 | Ga0209677_106333 | Ga0209677_1063332 | 296 |
| 363 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031022 | 296 |
| 364 | 3300025256 | Ga0209759_1000029 | Ga0209759_1000029180 | 296 |
| 365 | 3300025258 | Ga0209129_1000175 | Ga0209129_100017542 | 296 |
| 366 | 3300025261 | Ga0209233_1000043 | Ga0209233_1000043448 | 296 |
| 367 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011022 | 296 |
| 368 | 3300025272 | Ga0209455_1000458 | Ga0209455_100045833 | 296 |
| 369 | 3300025284 | Ga0209130_1002434 | Ga0209130_10024348 | 296 |
| 370 | 3300025284 | Ga0209130_1007488 | Ga0209130_10074882 | 296 |
| 371 | 3300025291 | Ga0209675_1000859 | Ga0209675_10008599 | 296 |
| 372 | 3300025291 | Ga0209675_1002909 | Ga0209675_10029098 | 296 |
| 373 | 3300025292 | Ga0209676_1003274 | Ga0209676_100327412 | 296 |
| 374 | 3300025294 | Ga0209025_1000133 | Ga0209025_100013392 | 296 |
| 375 | 3300025294 | Ga0209025_1036521 | Ga0209025_10365212 | 296 |
| 376 | 3300025295 | Ga0209564_1000136 | Ga0209564_1000136124 | 296 |
| 377 | 3300025295 | Ga0209564_1003544 | Ga0209564_10035449 | 296 |
| 378 | 3300025297 | Ga0209758_1000275 | Ga0209758_100027573 | 296 |
| 379 | 3300025298 | Ga0209050_1000247 | Ga0209050_100024759 | 296 |
| 380 | 3300025298 | Ga0209050_1001725 | Ga0209050_10017255 | 296 |
| 381 | 3300025302 | Ga0207426_1000215 | Ga0207426_100021552 | 296 |
| 382 | 3300025303 | Ga0209051_1002942 | Ga0209051_100294211 | 296 |
| 383 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022698 | 296 |
| 384 | 3300025304 | Ga0209257_1034257 | Ga0209257_10342571 | 296 |
| 385 | 3300025904 | Ga0207647_10020744 | Ga0207647_100207443 | 296 |
| 386 | 3300025914 | Ga0207671_10098708 | Ga0207671_100987081 | 296 |
| 387 | 3300025923 | Ga0207681_10011844 | Ga0207681_100118445 | 296 |
| 388 | 3300025949 | Ga0207667_10435165 | Ga0207667_104351652 | 296 |
| 389 | 3300025986 | Ga0207658_10221714 | Ga0207658_102217142 | 296 |
| 390 | 3300026041 | Ga0207639_10033289 | Ga0207639_100332894 | 296 |
| 391 | 3300028381 | Ga0268264_10608654 | Ga0268264_106086542 | 296 |
| 392 | 3300028381 | Ga0268264_10612766 | Ga0268264_106127661 | 296 |
| 393 | 3300028794 | Ga0307515_10088125 | Ga0307515_100881251 | 296 |
| 394 | 3300028794 | Ga0307515_10120033 | Ga0307515_101200333 | 296 |
| 395 | 3300028794 | Ga0307515_10207633 | Ga0307515_102076332 | 296 |
| 396 | 3300030745 | Ga0316182_1008399 | Ga0316182_10083991 | 296 |
| 397 | 3300031241 | Ga0265325_10010668 | Ga0265325_100106682 | 296 |
| 398 | 3300031247 | Ga0265340_10006435 | Ga0265340_100064353 | 296 |
| 399 | 3300031251 | Ga0265327_10006362 | Ga0265327_100063628 | 296 |
| 400 | 3300031456 | Ga0307513_10006404 | Ga0307513_100064049 | 296 |
| 401 | 3300031595 | Ga0265313_10012675 | Ga0265313_100126753 | 296 |
| 402 | 3300031731 | Ga0307405_10109898 | Ga0307405_101098982 | 296 |
| 403 | 3300032002 | Ga0307416_100011432 | Ga0307416_1000114326 | 296 |
| 404 | 3300033180 | Ga0307510_10070419 | Ga0307510_100704193 | 296 |
| 405 | 3300037312 | Ga0395899_0012056 | Ga0395899_0012056_2789_3730 | 296 |
| 406 | 3300037312 | Ga0395899_0080533 | Ga0395899_0080533_297_1238 | 296 |
| 407 | 3300037418 | Ga0395900_0041760 | Ga0395900_0041760_2781_3722 | 296 |
| 408 | 3300037466 | Ga0395898_0202998 | Ga0395898_0202998_407_1360 | 296 |
| 409 | 3300037471 | Ga0395905_0018276 | Ga0395905_0018276_1684_2625 | 296 |
| 410 | 3300037471 | Ga0395905_0033541 | Ga0395905_0033541_3665_4606 | 296 |
| 411 | 3300037471 | Ga0395905_0271500 | Ga0395905_0271500_524_1465 | 296 |
| 412 | 3300038443 | Ga0395901_0081262 | Ga0395901_0081262_1671_2612 | 296 |
| 413 | 3300041451 | Ga0451791_1020741 | Ga0451791_1020741_158_1099 | 296 |
| 414 | 3300042007 | Ga0439449_0020201 | Ga0439449_0020201_1306_2259 | 296 |
| 415 | 3300044683 | Ga0466965_0005137 | Ga0466965_0005137_4756_5697 | 296 |
| 416 | 3300044683 | Ga0466965_0045602 | Ga0466965_0045602_348_1313 | 296 |
| 417 | 3300044901 | Ga0466960_0009903 | Ga0466960_0009903_2065_3030 | 296 |
| 418 | 3300044901 | Ga0466960_0055374 | Ga0466960_0055374_276_1217 | 296 |
| 419 | 3300046453 | Ga0495627_021365 | Ga0495627_021365_973_1914 | 296 |
| 420 | 3300046454 | Ga0495592_0002222 | Ga0495592_0002222_6813_7775 | 296 |
| 421 | 3300046457 | Ga0495590_0009693 | Ga0495590_0009693_330_1292 | 296 |
| 422 | 3300046471 | Ga0495650_0031922 | Ga0495650_0031922_449_1684 | 296 |
| 423 | 3300046475 | Ga0495639_0027894 | Ga0495639_0027894_418_1377 | 296 |
| 424 | 3300046477 | Ga0495664_0056850 | Ga0495664_0056850_258_1196 | 296 |
| 425 | 3300046507 | Ga0495606_0011615 | Ga0495606_0011615_1054_2016 | 296 |
| 426 | 3300046522 | Ga0495643_0114130 | Ga0495643_0114130_158_1120 | 296 |
| 427 | 3300046528 | Ga0495642_0028045 | Ga0495642_0028045_1266_2225 | 296 |
| 428 | 3300046542 | Ga0495597_0122745 | Ga0495597_0122745_98_1060 | 296 |
| 429 | 3300046543 | Ga0495645_0014618 | Ga0495645_0014618_1721_2659 | 296 |
| 430 | 3300046615 | Ga0495656_0077773 | Ga0495656_0077773_486_1445 | 296 |
| 431 | 3300046684 | Ga0495669_0119002 | Ga0495669_0119002_260_1219 | 296 |
| 432 | 3300046694 | Ga0495649_0000215 | Ga0495649_0000215_6946_7908 | 296 |
| 433 | 3300047323 | Ga0495683_0080014 | Ga0495683_0080014_623_1561 | 296 |
| 434 | 3300047443 | Ga0495687_030818 | Ga0495687_030818_300_1238 | 296 |
| 435 | 3300047472 | Ga0495686_0202899 | Ga0495686_0202899_115_1056 | 296 |
| 436 | 3300048091 | Ga0495626_0013588 | Ga0495626_0013588_815_1777 | 296 |
| 437 | 3300048903 | Ga0496100_0000078 | Ga0496100_0000078_5469_6407 | 296 |
| 438 | 3300048903 | Ga0496100_0002476 | Ga0496100_0002476_6579_7538 | 296 |
| 439 | 3300048904 | Ga0496101_0000519 | Ga0496101_0000519_10690_11649 | 296 |
| 440 | 3300048904 | Ga0496101_0000538 | Ga0496101_0000538_5535_6473 | 296 |
| 441 | 3300048905 | Ga0496102_0000165 | Ga0496102_0000165_5387_6325 | 296 |
| 442 | 3300048905 | Ga0496102_0001291 | Ga0496102_0001291_16855_17796 | 296 |
| 443 | 3300048905 | Ga0496102_0048671 | Ga0496102_0048671_2758_3717 | 296 |
| 444 | 3300048905 | Ga0496102_0381262 | Ga0496102_0381262_142_1083 | 296 |
| 445 | 3300048906 | Ga0496103_0000644 | Ga0496103_0000644_18780_19718 | 296 |
| 446 | 3300048906 | Ga0496103_0004323 | Ga0496103_0004323_6552_7511 | 296 |
| 447 | 3300048907 | Ga0496104_0003338 | Ga0496104_0003338_47_1006 | 296 |
| 448 | 3300048907 | Ga0496104_0066930 | Ga0496104_0066930_730_1668 | 296 |
| 449 | 3300048908 | Ga0496105_0000375 | Ga0496105_0000375_12994_13953 | 296 |
| 450 | 3300048908 | Ga0496105_0040921 | Ga0496105_0040921_1253_2191 | 296 |
| 451 | 3300048909 | Ga0496106_0002941 | Ga0496106_0002941_4650_5591 | 296 |
| 452 | 3300048909 | Ga0496106_0051310 | Ga0496106_0051310_1900_2859 | 296 |
| 453 | 3300048910 | Ga0496107_0103389 | Ga0496107_0103389_1024_1983 | 296 |
| 454 | 3300048912 | Ga0496109_0047712 | Ga0496109_0047712_984_1943 | 296 |
| 455 | 3300048913 | Ga0496110_0001501 | Ga0496110_0001501_11844_12803 | 296 |
| 456 | 3300048914 | Ga0496111_0013567 | Ga0496111_0013567_3683_4642 | 296 |
| 457 | 3300048917 | Ga0496114_0030386 | Ga0496114_0030386_3218_4177 | 296 |
| 458 | 3300048919 | Ga0496116_0076685 | Ga0496116_0076685_800_1741 | 296 |
| 459 | 3300048920 | Ga0496117_0000707 | Ga0496117_0000707_5374_6312 | 296 |
| 460 | 3300048921 | Ga0496118_0000283 | Ga0496118_0000283_82895_83833 | 296 |
| 461 | 3300048921 | Ga0496118_0068641 | Ga0496118_0068641_523_1464 | 296 |
| 462 | 3300048924 | Ga0496121_0004227 | Ga0496121_0004227_391_1329 | 296 |
| 463 | 3300048924 | Ga0496121_0008605 | Ga0496121_0008605_1432_2370 | 296 |
| 464 | 3300048924 | Ga0496121_0011190 | Ga0496121_0011190_20_961 | 296 |
| 465 | 3300048924 | Ga0496121_0121436 | Ga0496121_0121436_138_1082 | 296 |
| 466 | 3300048925 | Ga0496122_0000034 | Ga0496122_0000034_210128_211069 | 296 |
| 467 | 3300048926 | Ga0496123_0000141 | Ga0496123_0000141_138585_139526 | 296 |
| 468 | 3300048926 | Ga0496123_0014329 | Ga0496123_0014329_2117_3058 | 296 |
| 469 | 3300048927 | Ga0496124_0006512 | Ga0496124_0006512_7646_8662 | 296 |
| 470 | 3300048927 | Ga0496124_0023619 | Ga0496124_0023619_2012_2953 | 296 |
| 471 | 3300048928 | Ga0496125_0004960 | Ga0496125_0004960_7645_8589 | 296 |
| 472 | 3300048929 | Ga0496126_0143867 | Ga0496126_0143867_331_1272 | 296 |
| 473 | 3300048929 | Ga0496126_0167674 | Ga0496126_0167674_53_991 | 296 |
| 474 | 3300049568 | Ga0501031_0012665 | Ga0501031_0012665_1211_2152 | 296 |
| 475 | 3300049568 | Ga0501031_0050911 | Ga0501031_0050911_1170_2171 | 296 |
| 476 | 3300049568 | Ga0501031_0100690 | Ga0501031_0100690_121_1062 | 296 |
| 477 | 3300049570 | Ga0501033_0003584 | Ga0501033_0003584_3090_4031 | 296 |
| 478 | 3300049571 | Ga0501034_0006814 | Ga0501034_0006814_8317_9258 | 296 |
| 479 | 3300049571 | Ga0501034_0031655 | Ga0501034_0031655_1380_2381 | 296 |
| 480 | 3300049572 | Ga0501036_0001771 | Ga0501036_0001771_3117_4058 | 296 |
| 481 | 3300049573 | Ga0501037_0004252 | Ga0501037_0004252_4582_5523 | 296 |
| 482 | 3300049574 | Ga0501038_0000494 | Ga0501038_0000494_28230_29171 | 296 |
| 483 | 3300049579 | Ga0501043_0000038 | Ga0501043_0000038_126368_127330 | 296 |
| 484 | 3300049579 | Ga0501043_0001194 | Ga0501043_0001194_12718_13659 | 296 |
| 485 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_1350_2312 | 296 |
| 486 | 3300049580 | Ga0501046_0002440 | Ga0501046_0002440_10846_11787 | 296 |
| 487 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_185561_186523 | 296 |
| 488 | 3300049581 | Ga0501047_0004711 | Ga0501047_0004711_7802_8743 | 296 |
| 489 | 3300049582 | Ga0501048_0025913 | Ga0501048_0025913_3256_4218 | 296 |
| 490 | 3300049822 | Ga0501035_0012428 | Ga0501035_0012428_663_1601 | 296 |
| 491 | 3300049822 | Ga0501035_0082472 | Ga0501035_0082472_1840_2781 | 296 |
| 492 | 3300049823 | Ga0501044_0000236 | Ga0501044_0000236_52526_53464 | 296 |
| 493 | 3300049823 | Ga0501044_0012609 | Ga0501044_0012609_1429_2370 | 296 |
| 494 | 3300049823 | Ga0501044_0120424 | Ga0501044_0120424_759_1760 | 296 |
| 495 | 3300049824 | Ga0501045_0001444 | Ga0501045_0001444_1236_2198 | 296 |
| 496 | 3300050493 | nmdc:mga0k408_57926_c1 | nmdc:mga0k408_57926_c1_1040_1993 | 296 |
| 497 | 3300053086 | Ga0500578_0000282 | Ga0500578_0000282_26302_27243 | 296 |
| 498 | 3300053086 | Ga0500578_0011827 | Ga0500578_0011827_3623_4564 | 296 |
| 499 | 3300053088 | Ga0500644_0007025 | Ga0500644_0007025_62_1003 | 296 |
| 500 | 3300053088 | Ga0500644_0010532 | Ga0500644_0010532_455_1396 | 296 |
| 501 | 3300053093 | Ga0500651_0037393 | Ga0500651_0037393_206_1147 | 296 |
| 502 | 3300053108 | Ga0500562_012690 | Ga0500562_012690_1156_2097 | 296 |
| 503 | 3300053108 | Ga0500562_052966 | Ga0500562_052966_14_955 | 296 |
| 504 | 3300053125 | Ga0500618_024064 | Ga0500618_024064_23_979 | 296 |
| 505 | 3300053136 | Ga0500559_0000193 | Ga0500559_0000193_23876_24817 | 296 |
| 506 | 3300053139 | Ga0500568_0033481 | Ga0500568_0033481_321_1262 | 296 |
| 507 | 3300053145 | Ga0500586_004111 | Ga0500586_004111_2459_3415 | 296 |
| 508 | 3300053151 | Ga0500604_0022552 | Ga0500604_0022552_403_1344 | 296 |
| 509 | 3300053156 | Ga0500622_0000413 | Ga0500622_0000413_15891_16832 | 296 |
| 510 | 3300053156 | Ga0500622_0126224 | Ga0500622_0126224_129_1070 | 296 |
| 511 | 3300053730 | Ga0500645_003922 | Ga0500645_003922_3153_4094 | 296 |
| 512 | 3300053739 | Ga0500587_003153 | Ga0500587_003153_1161_2102 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e02-assembly1.cif.gz_A | crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution | 0.9551 | 5 | 293 |
| 3e49-assembly1.cif.gz_D | crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution | 0.9519 | 5 | 296 |
| 3lot-assembly1.cif.gz_C | crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution | 0.9512 | 6 | 296 |
| 3e49-assembly1.cif.gz_D | crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution | 0.9363 | 5 | 296 |
| 3lot-assembly1.cif.gz_C | crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution | 0.9324 | 6 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e49C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9321 | 5 | 296 | 3.20.20.70 |
| 3e49C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9167 | 5 | 296 | 3.20.20.70 |
| 2y7dC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.876 | 6 | 289 | 3.20.20.70 |
| 3no5E00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8684 | 5 | 285 | 3.20.20.70 |
| af_P71976_1_271_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8667 | 7 | 290 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A654ZM87-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9943 | 215 | 290 |
GO:0043720
GO:0046872 |
| AF-A0A496WKL7-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9933 | 169 | 284 |
GO:0043720
GO:0046872 |
| AF-A0A7Z9MTX4-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9907 | 221 | 296 |
GO:0043720
GO:0046872 |
| AF-A0A1Z8V441-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9898 | 7 | 87 |
GO:0043720
GO:0046872 |
| AF-A0A2E7NU08-F1-model_v4 | deleted | 0.9897 | 150 | 296 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar