F457446

General Info

Members Datasets Scaffolds Average Seq Length
512 381 418 309

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100011432|Ga0307416_1000114326
Length 371
Sequence MATTTPQDKVIISCAVTGSVHTPTMSEHLALTPDQIAEQSIEAAEAGAAILHLHARDPKDGRPSADPKIFDAFVPRIRDATDAVINITTGGSTRMTLEERLAYPLQAKPEMCSLNMGSMNFSIHPAARRIAEWKHEWEKPYVEGMEDLIFRNTFRDIKHILKVLGEDCGTRFEFECYDVGHLYNLAHFVDEGLIKGPLFIQSIYGILGGLGPDPENLVVMRTTADRLFGRNGYRFSILGAGRHQMPLLTMGAVMGGNVRVGLEDSLYLAKGQLAKSCAEQVRKIRRILEELSLEIATPDEARAMLGLKGHDAVGALARNKPFTSIRSSNEEVLGRPRGHRHGGRQRPGQGACDGARPAWRPRRGQRCGGPA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
6 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
7 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738543012 Acidovorax sp. CF301 Isolate Unclassified
17 2738543013 Variovorax sp. BT01 Isolate Unclassified
18 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
19 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
20 2816332133 Acidovorax radicis 2721A Isolate Unclassified
21 2842747753 Variovorax sp. R-72060 Isolate Unclassified
22 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
23 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
24 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
25 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
26 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
27 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
28 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
29 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
30 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
31 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
32 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
33 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
34 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
35 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
36 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
37 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
38 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
39 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
40 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
41 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
42 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
43 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
44 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
45 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
46 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
47 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
48 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
49 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
50 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
51 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
52 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
53 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
54 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
55 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
56 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
57 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
58 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
59 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
60 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
61 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
62 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
63 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
64 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
65 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
66 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
67 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
68 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
69 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
70 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
71 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
72 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
73 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
74 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
75 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
76 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
77 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
78 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
79 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
80 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
81 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
82 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
83 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
84 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
85 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
86 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
87 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
88 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
89 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
90 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
91 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
92 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
93 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
97 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
100 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
101 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
102 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
103 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
104 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
105 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
110 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
113 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
118 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
119 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
122 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
123 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
124 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
128 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
131 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
233 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
234 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
235 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
238 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
241 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
242 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
355 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
358 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
359 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
362 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
365 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
377 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
379 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
380 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
381 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.05
Metatranscriptomes 0.59
Isolates 18.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.77
Nodule 12.11
Rhizoplane 5.27
Rhizosphere 53.91
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10049912 3300002067 Bacteria 1208
2 JGI25156J39149_1000576 3300002705 Bacteria 21008
3 JGI25152J39213_1002258 3300002773 Bacteria 7443
4 JGI25151J46595_10003224 3300003187 Bacteria 9120
5 JGI25165J46597_1000038 3300003214 Bacteria 283664
6 JGI25153J46596_10000537 3300003215 Bacteria 23734
7 rootH2_10255115 3300003320 Bacteria 2347
8 JGI25160J50197_1000099 3300003354 Bacteria 86777
9 Ga0055533_1000085 3300003756 Bacteria 124875
10 Ga0055532_1000001 3300003758 Bacteria 1119836
11 Ga0055525_1000021 3300003759 Bacteria 370802
12 Ga0055525_1000084 3300003759 Bacteria 155319
13 Ga0055527_1000002 3300003760 Bacteria 830488
14 Ga0055535_1000001 3300003761 Bacteria 1119836
15 Ga0055542_1000001 3300003762 Bacteria 1119836
16 Ga0055529_1000026 3300003763 Bacteria 293254
17 Ga0055529_1000806 3300003763 Bacteria 19128
18 Ga0055526_1000296 3300003771 Bacteria 41724
19 Ga0055534_1000538 3300003784 Bacteria 20301
20 Ga0055531_10000415 3300003794 Bacteria 40766
21 Ga0065165_1000119 3300005262 Bacteria 134464
22 Ga0070658_10222377 3300005327 Bacteria 1597
23 Ga0070670_100507377 3300005331 Bacteria 1073
24 Ga0070682_100007523 3300005337 Bacteria 6141
25 Ga0068868_100329810 3300005338 Bacteria 1302
26 Ga0070669_100024214 3300005353 Bacteria 4352
27 Ga0070674_100194496 3300005356 Bacteria 1562
28 Ga0070667_100009961 3300005367 Bacteria 7877
29 Ga0070714_100018622 3300005435 Bacteria 5645
30 Ga0070713_100062102 3300005436 Bacteria 3128
31 Ga0070713_100272470 3300005436 Bacteria 1550
32 Ga0070711_100060940 3300005439 Bacteria 2625
33 Ga0070678_100025491 3300005456 Bacteria 3979
34 Ga0070699_100266330 3300005518 Bacteria 1533
35 Ga0070679_100229057 3300005530 Bacteria 1818
36 Ga0070684_100113285 3300005535 Bacteria 2434
37 Ga0070696_100008623 3300005546 Bacteria 6820
38 Ga0070696_100136626 3300005546 Bacteria 1788
39 Ga0070665_100098087 3300005548 Bacteria 2935
40 Ga0068855_100408504 3300005563 Bacteria 1487
41 Ga0068854_100115815 3300005578 Bacteria 2028
42 Ga0068856_100104319 3300005614 Bacteria 2829
43 Ga0068858_100212321 3300005842 Bacteria 1832
44 Ga0081455_10198572 3300005937 Bacteria 1504
45 Ga0081455_10205030 3300005937 Bacteria 1473
46 Ga0081539_10067324 3300005985 Bacteria 1937
47 Ga0075365_10027047 3300006038 Bacteria 3645
48 Ga0075366_10006472 3300006195 Bacteria 6423
49 Ga0075366_10017277 3300006195 Bacteria 4151
50 Ga0075370_10000806 3300006353 Bacteria 12561
51 Ga0075370_10057355 3300006353 Bacteria 2214
52 Ga0068871_100276144 3300006358 Bacteria 1469
53 Ga0105240_10052581 3300009093 Bacteria 5119
54 Ga0105240_10204427 3300009093 Bacteria 2313
55 Ga0105245_10100397 3300009098 Bacteria 2677
56 Ga0105237_10042807 3300009545 Bacteria 4564
57 Ga0105237_10185988 3300009545 Bacteria 2077
58 Ga0105238_10181271 3300009551 Bacteria 2083
59 Ga0105239_10009446 3300010375 Bacteria 10988
60 Ga0105239_10026408 3300010375 Bacteria 6390
61 Ga0105239_10032501 3300010375 Bacteria 5733
62 Ga0157370_10002111 3300013104 Bacteria 24281
63 Ga0157370_10026421 3300013104 Bacteria 5733
64 Ga0157370_10063393 3300013104 Bacteria 3502
65 Ga0157369_10000456 3300013105 Bacteria 54115
66 Ga0157369_10094510 3300013105 Bacteria 3191
67 Ga0163163_10138544 3300014325 Bacteria 2475
68 Ga0182008_10000207 3300014497 Bacteria 46359
69 Ga0182008_10001172 3300014497 Bacteria 18079
70 Ga0182007_10000185 3300015262 Bacteria 42160
71 Ga0183361_10004 3300016635 Bacteria 484183
72 Ga0163161_10029573 3300017792 Bacteria 3895
73 Ga0206351_10335682 3300020077 Bacteria 1452
74 Ga0213872_10004947 3300021361 Bacteria 6929
75 Ga0213874_10005811 3300021377 Bacteria 2893
76 Ga0213874_10041177 3300021377 Bacteria 1382
77 Ga0213875_10002153 3300021388 Bacteria 12022
78 Ga0213875_10005307 3300021388 Bacteria 6932
79 Ga0213871_10004697 3300021441 Bacteria 2754
80 Ga0213871_10006847 3300021441 Bacteria 2433
81 Ga0224712_10092263 3300022467 Bacteria 1271
82 Ga0209674_100005 3300025226 Bacteria 1708125
83 Ga0209672_100001 3300025228 Bacteria 2828210
84 Ga0209672_102997 3300025228 Bacteria 3707
85 Ga0209147_100001 3300025229 Bacteria 2384371
86 Ga0209563_100005 3300025230 Bacteria 1774893
87 Ga0209563_100025 3300025230 Bacteria 596456
88 Ga0209563_100297 3300025230 Bacteria 20431
89 Ga0209437_102228 3300025233 Bacteria 3846
90 Ga0209258_100001 3300025242 Bacteria 2384269
91 Ga0209258_103781 3300025242 Bacteria 3113
92 Ga0207425_1000259 3300025245 Bacteria 39126
93 Ga0209677_106333 3300025253 Bacteria 2824
94 Ga0209148_1000003 3300025254 Bacteria 2384288
95 Ga0209759_1000029 3300025256 Bacteria 286968
96 Ga0209129_1000175 3300025258 Bacteria 93817
97 Ga0209233_1000042 3300025261 Bacteria 510519
98 Ga0209233_1000043 3300025261 Bacteria 509723
99 Ga0209455_1000001 3300025272 Bacteria 2384278
100 Ga0209455_1000458 3300025272 Bacteria 30970
101 Ga0209130_1002434 3300025284 Bacteria 9333
102 Ga0209130_1007488 3300025284 Bacteria 3361
103 Ga0209675_1000859 3300025291 Bacteria 19681
104 Ga0209675_1002909 3300025291 Bacteria 8479
105 Ga0209676_1003274 3300025292 Bacteria 10168
106 Ga0209025_1000133 3300025294 Bacteria 195885
107 Ga0209025_1036521 3300025294 Bacteria 2199
108 Ga0209564_1000136 3300025295 Bacteria 185198
109 Ga0209564_1003544 3300025295 Bacteria 10502
110 Ga0209758_1000275 3300025297 Bacteria 102404
111 Ga0209050_1000247 3300025298 Bacteria 116514
112 Ga0209050_1001725 3300025298 Bacteria 21758
113 Ga0207426_1000215 3300025302 Bacteria 136757
114 Ga0209051_1002942 3300025303 Bacteria 11644
115 Ga0209257_1000022 3300025304 Bacteria 765258
116 Ga0209257_1034257 3300025304 Bacteria 1586
117 Ga0209257_1035004 3300025304 Bacteria 1558
118 Ga0207647_10020744 3300025904 Bacteria 4401
119 Ga0207671_10001548 3300025914 Bacteria 26304
120 Ga0207671_10055310 3300025914 Bacteria 2940
121 Ga0207671_10098708 3300025914 Bacteria 2209
122 Ga0207693_10015613 3300025915 Bacteria 6089
123 Ga0207660_10111307 3300025917 Bacteria 2061
124 Ga0207681_10011844 3300025923 Bacteria 5367
125 Ga0207700_10152236 3300025928 Bacteria 1912
126 Ga0207664_10019156 3300025929 Bacteria 5052
127 Ga0207664_10308402 3300025929 Bacteria 1394
128 Ga0207665_10151988 3300025939 Bacteria 1659
129 Ga0207667_10435165 3300025949 Bacteria 1334
130 Ga0207658_10221714 3300025986 Bacteria 1591
131 Ga0207639_10033289 3300026041 Bacteria 3801
132 Ga0207702_10090183 3300026078 Bacteria 2682
133 Ga0207641_10167781 3300026088 Bacteria 2001
134 Ga0207683_10038298 3300026121 Bacteria 4178
135 Ga0209970_1001100 3300027614 Bacteria 4768
136 Ga0209974_10047852 3300027876 Bacteria 1433
137 Ga0268266_10059088 3300028379 Bacteria 3303
138 Ga0268266_10092818 3300028379 Bacteria 2649
139 Ga0268264_10608654 3300028381 Bacteria 1077
140 Ga0268264_10612766 3300028381 Bacteria 1074
141 Ga0307515_10088125 3300028794 Bacteria 3928
142 Ga0307515_10120033 3300028794 Bacteria 2985
143 Ga0307515_10207633 3300028794 Bacteria 1813
144 Ga0265338_10021117 3300028800 Bacteria 6806
145 Ga0265338_10078105 3300028800 Bacteria 2794
146 Ga0316182_1008399 3300030745 Bacteria 4575
147 Ga0265325_10010668 3300031241 Bacteria 5307
148 Ga0265340_10001253 3300031247 Bacteria 14589
149 Ga0265340_10006435 3300031247 Bacteria 6466
150 Ga0265339_10016011 3300031249 Bacteria 4479
151 Ga0265327_10006362 3300031251 Bacteria 9468
152 Ga0265316_10016679 3300031344 Bacteria 6366
153 Ga0307513_10003617 3300031456 Bacteria 20916
154 Ga0307513_10006404 3300031456 Bacteria 15387
155 Ga0307408_100191867 3300031548 Bacteria 1646
156 Ga0265313_10000868 3300031595 Bacteria 30518
157 Ga0265313_10012675 3300031595 Bacteria 5122
158 Ga0265342_10009354 3300031712 Bacteria 6916
159 Ga0307516_10007190 3300031730 Bacteria 12848
160 Ga0307516_10144939 3300031730 Bacteria 2141
161 Ga0307405_10109898 3300031731 Bacteria 1866
162 Ga0307405_10113682 3300031731 Bacteria 1838
163 Ga0307412_10189538 3300031911 Bacteria 1553
164 Ga0307416_100011432 3300032002 Bacteria 5921
165 Ga0307416_100152441 3300032002 Bacteria 2122
166 Ga0307411_10270568 3300032005 Bacteria 1347
167 Ga0307510_10070419 3300033180 Bacteria 3492
168 Ga0373923_0015792 3300035111 Bacteria 2857
169 Ga0373956_0152361 3300035119 Bacteria 1088
170 Ga0373957_0012606 3300035120 Bacteria 2850
171 Ga0373955_0077475 3300035172 Bacteria 1872
172 Ga0373924_0042653 3300035410 Bacteria 1862
173 Ga0373935_0017426 3300035692 Bacteria 4358
174 Ga0373935_0092902 3300035692 Bacteria 1978
175 Ga0373927_0131650 3300035695 Bacteria 1634
176 Ga0373947_0068646 3300035725 Bacteria 2168
177 Ga0373947_0133707 3300035725 Bacteria 1585
178 Ga0373937_0028200 3300036401 Bacteria 5079
179 Ga0373937_0037534 3300036401 Bacteria 4416
180 Ga0373937_0248267 3300036401 Bacteria 1677
181 Ga0395899_0012056 3300037312 Bacteria 6624
182 Ga0395899_0080533 3300037312 Bacteria 2370
183 Ga0395900_0041760 3300037418 Bacteria 4727
184 Ga0395900_0129594 3300037418 Bacteria 2586
185 Ga0395898_0202998 3300037466 Bacteria 1892
186 Ga0395905_0018276 3300037471 Bacteria 6656
187 Ga0395905_0031014 3300037471 Bacteria 5034
188 Ga0395905_0033541 3300037471 Bacteria 4822
189 Ga0395905_0271500 3300037471 Bacteria 1582
190 Ga0436364_0358205 3300037853 Bacteria 23269
191 Ga0436364_1116391 3300037853 Bacteria 6929
192 Ga0436364_1387451 3300037853 Bacteria 3041
193 Ga0395901_0034290 3300038443 Bacteria 5242
194 Ga0395901_0081262 3300038443 Bacteria 3385
195 Ga0436360_0364066 3300039438 Bacteria 4711
196 Ga0436360_1115109 3300039438 Bacteria 17128
197 Ga0436361_0215473 3300039447 Bacteria 3189
198 Ga0436361_0238116 3300039447 Bacteria 14192
199 Ga0436363_1449656 3300039450 Bacteria 2522
200 Ga0436362_0075426 3300039453 Bacteria 2264
201 Ga0436362_0206709 3300039453 Bacteria 1782
202 Ga0436362_0928376 3300039453 Bacteria 12218
203 Ga0439436_0027526 3300041404 Bacteria 1662
204 Ga0439439_0005367 3300041406 Bacteria 2924
205 Ga0439447_009443 3300041407 Bacteria 2957
206 Ga0451791_1020741 3300041451 Bacteria 1134
207 Ga0451793_0014015 3300041452 Bacteria 2637
208 Ga0451804_0460381 3300041463 Bacteria 1248
209 Ga0439442_014778 3300042002 Bacteria 1607
210 Ga0439432_010813 3300042006 Bacteria 3154
211 Ga0439449_0020201 3300042007 Bacteria 2495
212 Ga0439449_0058382 3300042007 Bacteria 1424
213 Ga0439452_003011 3300042010 Bacteria 5990
214 Ga0439462_0016999 3300042015 Bacteria 1884
215 Ga0450898_007356 3300042134 Bacteria 1713
216 Ga0450906_013089 3300042145 Bacteria 1533
217 Ga0450908_004996 3300042184 Bacteria 2547
218 Ga0439434_0025222 3300042435 Bacteria 1794
219 Ga0466972_0143240 3300044658 Bacteria 1124
220 Ga0466965_0005137 3300044683 Bacteria 5874
221 Ga0466965_0045602 3300044683 Bacteria 2168
222 Ga0466968_0049017 3300044735 Bacteria 1798
223 Ga0466957_0113444 3300044842 Bacteria 1721
224 Ga0466957_0235598 3300044842 Bacteria 1213
225 Ga0466960_0009903 3300044901 Bacteria 3943
226 Ga0466960_0055374 3300044901 Bacteria 1928
227 Ga0466959_0064625 3300045049 Bacteria 2657
228 Ga0466958_0004893 3300045836 Bacteria 7135
229 Ga0466967_0298367 3300045976 Bacteria 1550
230 Ga0495617_059250 3300046452 Bacteria 1268
231 Ga0495627_021365 3300046453 Bacteria 2147
232 Ga0495592_0002222 3300046454 Bacteria 13694
233 Ga0495603_0064901 3300046455 Bacteria 2152
234 Ga0495590_0009693 3300046457 Bacteria 3651
235 Ga0495629_0010469 3300046459 Bacteria 6747
236 Ga0495638_0000016 3300046460 Bacteria 396505
237 Ga0495651_0277595 3300046462 Bacteria 1133
238 Ga0495653_0161473 3300046463 Bacteria 1555
239 Ga0495650_0031922 3300046471 Bacteria 2362
240 Ga0495582_0005593 3300046473 Bacteria 6997
241 Ga0495639_0027894 3300046475 Bacteria 2500
242 Ga0495664_0020193 3300046477 Bacteria 3840
243 Ga0495664_0056850 3300046477 Bacteria 2328
244 Ga0495664_0203836 3300046477 Bacteria 1198
245 Ga0495584_0023511 3300046491 Bacteria 3124
246 Ga0495583_0002328 3300046506 Bacteria 16525
247 Ga0495606_0011615 3300046507 Bacteria 7159
248 Ga0495608_0000402 3300046511 Bacteria 30297
249 Ga0495616_0000024 3300046513 Bacteria 145530
250 Ga0495628_0138673 3300046516 Bacteria 1857
251 Ga0495628_0206503 3300046516 Bacteria 1479
252 Ga0495630_0029290 3300046517 Bacteria 4092
253 Ga0495632_0000001 3300046519 Bacteria 873295
254 Ga0495632_0000981 3300046519 Bacteria 24925
255 Ga0495632_0003923 3300046519 Bacteria 10332
256 Ga0495637_0000108 3300046520 Bacteria 60028
257 Ga0495643_0000020 3300046522 Bacteria 294973
258 Ga0495643_0114130 3300046522 Bacteria 1370
259 Ga0495648_0000013 3300046524 Bacteria 289090
260 Ga0495648_0089805 3300046524 Bacteria 1723
261 Ga0495663_0000002 3300046525 Bacteria 495384
262 Ga0495666_0003213 3300046526 Bacteria 8230
263 Ga0495642_0028045 3300046528 Bacteria 2241
264 Ga0495652_0001389 3300046529 Bacteria 26896
265 Ga0495652_0090181 3300046529 Bacteria 2509
266 Ga0495665_0019047 3300046531 Bacteria 3689
267 Ga0495640_0012384 3300046533 Bacteria 6519
268 Ga0495640_0044587 3300046533 Bacteria 3083
269 Ga0495586_0010277 3300046535 Bacteria 4978
270 Ga0495587_0254247 3300046536 Bacteria 987
271 Ga0495597_0122745 3300046542 Bacteria 1082
272 Ga0495645_0014618 3300046543 Bacteria 5573
273 Ga0495645_0084919 3300046543 Bacteria 2266
274 Ga0495633_0000376 3300046558 Bacteria 47585
275 Ga0495633_0000712 3300046558 Bacteria 30211
276 Ga0495633_0038233 3300046558 Bacteria 2293
277 Ga0495633_0121450 3300046558 Bacteria 1210
278 Ga0495667_0039595 3300046559 Bacteria 3134
279 Ga0495667_0075946 3300046559 Bacteria 2186
280 Ga0495656_0077773 3300046615 Bacteria 1490
281 Ga0495668_0224618 3300046616 Bacteria 1028
282 Ga0495634_0003103 3300046642 Bacteria 13505
283 Ga0495635_0000831 3300046663 Bacteria 20224
284 Ga0495657_0009326 3300046675 Bacteria 7448
285 Ga0495599_0162658 3300046678 Bacteria 1379
286 Ga0495646_0008101 3300046680 Bacteria 6680
287 Ga0495646_0077537 3300046680 Bacteria 1943
288 Ga0495669_0119002 3300046684 Bacteria 1237
289 Ga0495624_0001875 3300046690 Bacteria 16011
290 Ga0495671_0000016 3300046692 Bacteria 294821
291 Ga0495671_0000018 3300046692 Bacteria 291470
292 Ga0495671_0093140 3300046692 Bacteria 1474
293 Ga0495649_0000215 3300046694 Bacteria 50655
294 Ga0495649_0117585 3300046694 Bacteria 1407
295 Ga0495600_0000230 3300046809 Bacteria 30997
296 Ga0495600_0113246 3300046809 Bacteria 1766
297 Ga0495604_0062938 3300047317 Bacteria 2832
298 Ga0495674_0043574 3300047319 Bacteria 3995
299 Ga0495674_0185896 3300047319 Bacteria 1729
300 Ga0495674_0226263 3300047319 Bacteria 1545
301 Ga0495680_0137024 3300047322 Bacteria 1794
302 Ga0495683_0080014 3300047323 Bacteria 1595
303 Ga0495687_030818 3300047443 Bacteria 2467
304 Ga0495675_0001459 3300047444 Bacteria 14311
305 Ga0495673_0000130 3300047469 Bacteria 138192
306 Ga0495681_0002647 3300047470 Bacteria 12699
307 Ga0495686_0056305 3300047472 Bacteria 2457
308 Ga0495686_0202899 3300047472 Bacteria 1137
309 Ga0495593_0109165 3300047673 Bacteria 1413
310 Ga0495602_0004338 3300048088 Bacteria 14783
311 Ga0495626_0013588 3300048091 Bacteria 4228
312 Ga0496100_0000078 3300048903 Bacteria 54410
313 Ga0496100_0002476 3300048903 Bacteria 9386
314 Ga0496101_0000519 3300048904 Bacteria 24028
315 Ga0496101_0000538 3300048904 Bacteria 23231
316 Ga0496102_0000165 3300048905 Bacteria 89141
317 Ga0496102_0001291 3300048905 Bacteria 22509
318 Ga0496102_0048671 3300048905 Bacteria 3854
319 Ga0496102_0048973 3300048905 Bacteria 3843
320 Ga0496102_0381262 3300048905 Bacteria 1327
321 Ga0496103_0000644 3300048906 Bacteria 26380
322 Ga0496103_0004323 3300048906 Bacteria 8633
323 Ga0496104_0003338 3300048907 Bacteria 13853
324 Ga0496104_0066930 3300048907 Bacteria 3411
325 Ga0496105_0000375 3300048908 Bacteria 29508
326 Ga0496105_0040921 3300048908 Bacteria 3820
327 Ga0496106_0002941 3300048909 Bacteria 12680
328 Ga0496106_0051310 3300048909 Bacteria 3110
329 Ga0496107_0103389 3300048910 Bacteria 2090
330 Ga0496109_0047712 3300048912 Bacteria 3895
331 Ga0496110_0001501 3300048913 Bacteria 16929
332 Ga0496111_0013567 3300048914 Bacteria 5548
333 Ga0496114_0030386 3300048917 Bacteria 4445
334 Ga0496116_0076685 3300048919 Bacteria 2092
335 Ga0496117_0000707 3300048920 Bacteria 52889
336 Ga0496118_0000283 3300048921 Bacteria 89206
337 Ga0496118_0068641 3300048921 Bacteria 2573
338 Ga0496121_0001005 3300048924 Bacteria 50368
339 Ga0496121_0004227 3300048924 Bacteria 19554
340 Ga0496121_0008605 3300048924 Bacteria 11948
341 Ga0496121_0011190 3300048924 Bacteria 10001
342 Ga0496121_0082415 3300048924 Bacteria 2543
343 Ga0496121_0121436 3300048924 Bacteria 1972
344 Ga0496121_0125262 3300048924 Bacteria 1933
345 Ga0496122_0000034 3300048925 Bacteria 320661
346 Ga0496123_0000141 3300048926 Bacteria 147111
347 Ga0496123_0014329 3300048926 Bacteria 6579
348 Ga0496124_0000024 3300048927 Bacteria 414291
349 Ga0496124_0006512 3300048927 Bacteria 12709
350 Ga0496124_0023619 3300048927 Bacteria 5609
351 Ga0496125_0004960 3300048928 Bacteria 15051
352 Ga0496126_0143867 3300048929 Bacteria 2050
353 Ga0496126_0167674 3300048929 Bacteria 1873
354 Ga0496126_0392036 3300048929 Bacteria 1128
355 Ga0501031_0012665 3300049568 Bacteria 5507
356 Ga0501031_0050911 3300049568 Bacteria 2697
357 Ga0501031_0100690 3300049568 Bacteria 1885
358 Ga0501033_0003584 3300049570 Bacteria 12688
359 Ga0501034_0006814 3300049571 Bacteria 12219
360 Ga0501034_0017460 3300049571 Bacteria 7359
361 Ga0501034_0031655 3300049571 Bacteria 5373
362 Ga0501034_0323976 3300049571 Bacteria 1473
363 Ga0501036_0001771 3300049572 Bacteria 16761
364 Ga0501037_0004252 3300049573 Bacteria 10376
365 Ga0501038_0000494 3300049574 Bacteria 34711
366 Ga0501038_0183691 3300049574 Bacteria 1686
367 Ga0501043_0000038 3300049579 Bacteria 128656
368 Ga0501043_0001194 3300049579 Bacteria 22852
369 Ga0501046_0000049 3300049580 Bacteria 135088
370 Ga0501046_0002440 3300049580 Bacteria 17427
371 Ga0501047_0000039 3300049581 Bacteria 187849
372 Ga0501047_0004711 3300049581 Bacteria 12827
373 Ga0501048_0025913 3300049582 Bacteria 4272
374 Ga0501073_0018665 3300049589 Bacteria 5013
375 Ga0501083_0114295 3300049744 Bacteria 1773
376 Ga0501035_0012428 3300049822 Bacteria 7869
377 Ga0501035_0082472 3300049822 Bacteria 2837
378 Ga0501044_0000236 3300049823 Bacteria 69634
379 Ga0501044_0012609 3300049823 Bacteria 9154
380 Ga0501044_0120424 3300049823 Bacteria 2626
381 Ga0501045_0001444 3300049824 Bacteria 15788
382 nmdc:mga0k408_12909_c1 3300050493 Bacteria 4574
383 nmdc:mga0k408_57926_c1 3300050493 Bacteria 2250
384 nmdc:mga06z11_229142_c1 3300050494 Bacteria 1088
385 nmdc:mga07m45_1871_c1 3300050496 Bacteria 9721
386 nmdc:mga07m45_59696_c1 3300050496 Bacteria 2158
387 Ga0495601_0071443 3300053077 Bacteria 2216
388 Ga0495612_0004971 3300053078 Bacteria 5501
389 Ga0495619_0048935 3300053085 Bacteria 2786
390 Ga0500578_0000282 3300053086 Bacteria 62821
391 Ga0500578_0011827 3300053086 Bacteria 5638
392 Ga0500644_0007025 3300053088 Bacteria 2914
393 Ga0500644_0010532 3300053088 Bacteria 2505
394 Ga0500646_0005168 3300053090 Bacteria 3303
395 Ga0500651_0007140 3300053093 Bacteria 6499
396 Ga0500651_0037393 3300053093 Bacteria 3059
397 Ga0500562_012690 3300053108 Bacteria 2145
398 Ga0500562_052966 3300053108 Bacteria 1087
399 Ga0500569_009892 3300053109 Bacteria 2228
400 Ga0500594_0008201 3300053118 Bacteria 2377
401 Ga0500618_024064 3300053125 Bacteria 1469
402 Ga0500623_067945 3300053127 Bacteria 1738
403 Ga0500642_0003827 3300053130 Bacteria 4619
404 Ga0500652_000383 3300053131 Bacteria 15945
405 Ga0500559_0000193 3300053136 Bacteria 49137
406 Ga0500568_0015225 3300053139 Bacteria 3447
407 Ga0500568_0033481 3300053139 Bacteria 2108
408 Ga0500586_004111 3300053145 Bacteria 3517
409 Ga0500604_0015984 3300053151 Bacteria 2062
410 Ga0500604_0022552 3300053151 Bacteria 1788
411 Ga0500619_000050 3300053154 Bacteria 36425
412 Ga0500622_0000413 3300053156 Bacteria 40682
413 Ga0500622_0001707 3300053156 Bacteria 17033
414 Ga0500622_0126224 3300053156 Bacteria 1235
415 Ga0500624_001172 3300053157 Bacteria 4777
416 Ga0500645_003922 3300053730 Bacteria 5868
417 Ga0500587_003153 3300053739 Bacteria 2321
418 Ga0587072_017798 3300059643 Bacteria 1229

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0121450 Ga0495633_0121450_13_807 248
2 3300046616 Ga0495668_0224618 Ga0495668_0224618_11_805 248
3 3300042007 Ga0439449_0058382 Ga0439449_0058382_16_870 267
4 3300026088 Ga0207641_10167781 Ga0207641_101677812 268
5 iso_pu_bacteria 2961136820 2961142909 271
6 3300035120 Ga0373957_0012606 Ga0373957_0012606_1962_2834 273
7 3300046462 Ga0495651_0277595 Ga0495651_0277595_236_1108 273
8 3300046524 Ga0495648_0089805 Ga0495648_0089805_11_880 273
9 3300048924 Ga0496121_0082415 Ga0496121_0082415_1397_2266 273
10 3300048927 Ga0496124_0000024 Ga0496124_0000024_322835_323704 273
11 3300050494 nmdc:mga06z11_229142_c1 nmdc:mga06z11_229142_c1_188_1060 273
12 3300013105 Ga0157369_10094510 Ga0157369_100945102 274
13 3300046455 Ga0495603_0064901 Ga0495603_0064901_574_1446 274
14 3300046459 Ga0495629_0010469 Ga0495629_0010469_4259_5131 274
15 3300046473 Ga0495582_0005593 Ga0495582_0005593_4641_5513 274
16 3300046511 Ga0495608_0000402 Ga0495608_0000402_4485_5357 274
17 3300046517 Ga0495630_0029290 Ga0495630_0029290_1135_2007 274
18 3300046526 Ga0495666_0003213 Ga0495666_0003213_5926_6798 274
19 3300046529 Ga0495652_0001389 Ga0495652_0001389_24172_25044 274
20 3300046531 Ga0495665_0019047 Ga0495665_0019047_2525_3397 274
21 3300046533 Ga0495640_0012384 Ga0495640_0012384_5483_6355 274
22 3300046535 Ga0495586_0010277 Ga0495586_0010277_617_1489 274
23 3300046559 Ga0495667_0039595 Ga0495667_0039595_1080_1952 274
24 3300046642 Ga0495634_0003103 Ga0495634_0003103_10717_11589 274
25 3300046663 Ga0495635_0000831 Ga0495635_0000831_10472_11344 274
26 3300046675 Ga0495657_0009326 Ga0495657_0009326_886_1758 274
27 3300046680 Ga0495646_0008101 Ga0495646_0008101_1988_2860 274
28 3300046690 Ga0495624_0001875 Ga0495624_0001875_14005_14877 274
29 3300046694 Ga0495649_0117585 Ga0495649_0117585_36_908 274
30 3300046809 Ga0495600_0000230 Ga0495600_0000230_19419_20291 274
31 3300047444 Ga0495675_0001459 Ga0495675_0001459_4466_5338 274
32 3300047673 Ga0495593_0109165 Ga0495593_0109165_165_1037 274
33 3300005546 Ga0070696_100008623 Ga0070696_1000086236 287
34 3300003759 Ga0055525_1000084 Ga0055525_1000084146 288
35 3300025230 Ga0209563_100025 Ga0209563_100025147 288
36 iso_pu_bacteria 8047673197 8047678455 288
37 iso_pu_bacteria 2585428057 2587730920 289
38 iso_pu_bacteria 2585428058 2587736045 289
39 iso_pu_bacteria 2599185317 2600028429 289
40 iso_pu_bacteria 2600254930 2600357596 289
41 iso_pu_bacteria 2808606385 2808981022 289
42 iso_pu_bacteria 2808606388 2808996747 289
43 iso_pu_bacteria 2852612431 2852617746 289
44 iso_pu_bacteria 2852667396 2852672890 289
45 3300003759 Ga0055525_1000021 Ga0055525_1000021237 290
46 3300005327 Ga0070658_10222377 Ga0070658_102223772 290
47 3300014497 Ga0182008_10001172 Ga0182008_1000117212 290
48 3300015262 Ga0182007_10000185 Ga0182007_1000018520 290
49 3300025230 Ga0209563_100005 Ga0209563_10000590 290
50 3300037418 Ga0395900_0129594 Ga0395900_0129594_932_1861 290
51 3300038443 Ga0395901_0034290 Ga0395901_0034290_3976_4905 290
52 iso_pu_bacteria 2643221621 2644121231 290
53 iso_pu_bacteria 2844009547 2844012754 290
54 iso_pu_bacteria 2856328259 2856333583 290
55 iso_pu_bacteria 2856334872 2856335879 290
56 iso_pu_bacteria 2857367948 2857369893 290
57 iso_pu_bacteria 2857542790 2857545018 290
58 iso_pu_bacteria 2869169390 2869169802 290
59 iso_pu_bacteria 2869234852 2869239075 290
60 iso_pu_bacteria 2869242130 2869246955 290
61 iso_pu_bacteria 2869256925 2869262301 290
62 iso_pu_bacteria 2869271264 2869274760 290
63 iso_pu_bacteria 2871435913 2871441266 290
64 iso_pu_bacteria 2871481445 2871486183 290
65 iso_pu_bacteria 2874109183 2874115163 290
66 iso_pu_bacteria 2874116593 2874121327 290
67 iso_pu_bacteria 2874162495 2874164966 290
68 iso_pu_bacteria 2876386047 2876392757 290
69 iso_pu_bacteria 2876399893 2876406572 290
70 iso_pu_bacteria 2876406927 2876410757 290
71 iso_pu_bacteria 2876420981 2876422542 290
72 iso_pu_bacteria 2878730984 2878736264 290
73 iso_pu_bacteria 2878774303 2878778324 290
74 iso_pu_bacteria 2896253425 2896256558 290
75 iso_pu_bacteria 2903513507 2903515784 290
76 iso_pu_bacteria 2906386501 2906393399 290
77 iso_pu_bacteria 2906401398 2906404038 290
78 iso_pu_bacteria 2906408224 2906414151 290
79 iso_pu_bacteria 2906427513 2906428215 290
80 iso_pu_bacteria 2922172374 2922178425 290
81 iso_pu_bacteria 2922178524 2922181285 290
82 iso_pu_bacteria 2924710171 2924716390 290
83 iso_pu_bacteria 2924741084 2924744484 290
84 iso_pu_bacteria 2924748358 2924754240 290
85 iso_pu_bacteria 2937861824 2937862348 290
86 iso_pu_bacteria 2937980651 2937984083 290
87 iso_pu_bacteria 2958108152 2958111126 290
88 iso_pu_bacteria 2958122699 2958123644 290
89 iso_pu_bacteria 2958137437 2958138719 290
90 iso_pu_bacteria 2958158011 2958158340 290
91 iso_pu_bacteria 2961183825 2961188565 290
92 iso_pu_bacteria 2965025482 2965025876 290
93 iso_pu_bacteria 2965032056 2965034843 290
94 iso_pu_bacteria 2965047637 2965054941 290
95 iso_pu_bacteria 2965102966 2965109409 290
96 iso_pu_bacteria 2970510686 2970515481 290
97 iso_pu_bacteria 2970532167 2970534073 290
98 iso_pu_bacteria 2970547951 2970551570 290
99 iso_pu_bacteria 2970619444 2970625174 290
100 iso_pu_bacteria 2970627176 2970632828 290
101 iso_pu_bacteria 2977851361 2977851868 290
102 iso_pu_bacteria 2977872689 2977874415 290
103 iso_pu_bacteria 2977898635 2977904736 290
104 iso_pu_bacteria 2977907340 2977908536 290
105 iso_pu_bacteria 2977935797 2977941967 290
106 iso_pu_bacteria 2977957713 2977958757 290
107 iso_pu_bacteria 2979764755 2979766085 290
108 iso_pu_bacteria 2979772303 2979776881 290
109 iso_pu_bacteria 2996386984 2996390165 290
110 iso_pu_bacteria 3004232784 3004235722 290
111 iso_pu_bacteria 3004239961 3004247860 290
112 iso_pu_bacteria 3004248173 3004250246 290
113 iso_pu_bacteria 8004300914 8004303905 290
114 iso_pu_bacteria 8004312739 8004314559 290
115 iso_pu_bacteria 8004727605 8004730621 290
116 3300003214 JGI25165J46597_1000038 JGI25165J46597_100003866 291
117 3300005356 Ga0070674_100194496 Ga0070674_1001944962 291
118 3300005436 Ga0070713_100062102 Ga0070713_1000621023 291
119 3300005456 Ga0070678_100025491 Ga0070678_1000254912 291
120 3300005614 Ga0068856_100104319 Ga0068856_1001043193 291
121 3300013104 Ga0157370_10063393 Ga0157370_100633932 291
122 3300014325 Ga0163163_10138544 Ga0163163_101385443 291
123 3300020077 Ga0206351_10335682 Ga0206351_103356821 291
124 3300021388 Ga0213875_10002153 Ga0213875_100021538 291
125 3300022467 Ga0224712_10092263 Ga0224712_100922631 291
126 3300025233 Ga0209437_102228 Ga0209437_1022283 291
127 3300025261 Ga0209233_1000042 Ga0209233_1000042188 291
128 3300025928 Ga0207700_10152236 Ga0207700_101522361 291
129 3300026078 Ga0207702_10090183 Ga0207702_100901832 291
130 3300026121 Ga0207683_10038298 Ga0207683_100382985 291
131 3300037853 Ga0436364_0358205 Ga0436364_0358205_12427_13353 291
132 3300037853 Ga0436364_1387451 Ga0436364_1387451_2092_3018 291
133 3300039453 Ga0436362_0075426 Ga0436362_0075426_1084_2016 291
134 3300044842 Ga0466957_0113444 Ga0466957_0113444_285_1229 291
135 3300044842 Ga0466957_0235598 Ga0466957_0235598_157_1083 291
136 3300045836 Ga0466958_0004893 Ga0466958_0004893_5511_6455 291
137 3300046559 Ga0495667_0075946 Ga0495667_0075946_93_1019 291
138 3300048929 Ga0496126_0392036 Ga0496126_0392036_80_1006 291
139 3300059643 Ga0587072_017798 Ga0587072_017798_54_980 291
140 iso_pu_bacteria 2643221541 2643729678 291
141 iso_pu_bacteria 2643221606 2644044037 291
142 iso_pu_bacteria 2643221671 2644392507 291
143 3300005435 Ga0070714_100018622 Ga0070714_1000186222 292
144 3300005436 Ga0070713_100272470 Ga0070713_1002724702 292
145 3300005439 Ga0070711_100060940 Ga0070711_1000609402 292
146 3300005530 Ga0070679_100229057 Ga0070679_1002290572 292
147 3300005548 Ga0070665_100098087 Ga0070665_1000980872 292
148 3300005937 Ga0081455_10198572 Ga0081455_101985722 292
149 3300009098 Ga0105245_10100397 Ga0105245_101003973 292
150 3300010375 Ga0105239_10032501 Ga0105239_100325014 292
151 3300021377 Ga0213874_10005811 Ga0213874_100058112 292
152 3300021388 Ga0213875_10005307 Ga0213875_100053077 292
153 3300021441 Ga0213871_10004697 Ga0213871_100046972 292
154 3300025915 Ga0207693_10015613 Ga0207693_100156135 292
155 3300025917 Ga0207660_10111307 Ga0207660_101113072 292
156 3300025929 Ga0207664_10019156 Ga0207664_100191563 292
157 3300025939 Ga0207665_10151988 Ga0207665_101519882 292
158 3300028379 Ga0268266_10092818 Ga0268266_100928183 292
159 3300028800 Ga0265338_10021117 Ga0265338_100211173 292
160 3300035111 Ga0373923_0015792 Ga0373923_0015792_241_1170 292
161 3300035119 Ga0373956_0152361 Ga0373956_0152361_99_1028 292
162 3300035172 Ga0373955_0077475 Ga0373955_0077475_289_1353 292
163 3300035410 Ga0373924_0042653 Ga0373924_0042653_900_1829 292
164 3300035692 Ga0373935_0017426 Ga0373935_0017426_2089_3018 292
165 3300035692 Ga0373935_0092902 Ga0373935_0092902_565_1494 292
166 3300035695 Ga0373927_0131650 Ga0373927_0131650_212_1141 292
167 3300035725 Ga0373947_0068646 Ga0373947_0068646_512_1441 292
168 3300035725 Ga0373947_0133707 Ga0373947_0133707_435_1364 292
169 3300036401 Ga0373937_0028200 Ga0373937_0028200_3960_4979 292
170 3300036401 Ga0373937_0037534 Ga0373937_0037534_1964_2893 292
171 3300036401 Ga0373937_0248267 Ga0373937_0248267_522_1451 292
172 3300037853 Ga0436364_1116391 Ga0436364_1116391_469_1398 292
173 3300039438 Ga0436360_1115109 Ga0436360_1115109_5477_6406 292
174 3300039450 Ga0436363_1449656 Ga0436363_1449656_418_1347 292
175 3300039453 Ga0436362_0206709 Ga0436362_0206709_74_1003 292
176 3300046463 Ga0495653_0161473 Ga0495653_0161473_188_1207 292
177 3300046477 Ga0495664_0020193 Ga0495664_0020193_772_1791 292
178 3300046477 Ga0495664_0203836 Ga0495664_0203836_86_1015 292
179 3300046516 Ga0495628_0138673 Ga0495628_0138673_435_1364 292
180 3300046516 Ga0495628_0206503 Ga0495628_0206503_287_1306 292
181 3300046529 Ga0495652_0090181 Ga0495652_0090181_381_1400 292
182 3300046533 Ga0495640_0044587 Ga0495640_0044587_1199_2218 292
183 3300046536 Ga0495587_0254247 Ga0495587_0254247_13_942 292
184 3300046543 Ga0495645_0084919 Ga0495645_0084919_481_1500 292
185 3300046678 Ga0495599_0162658 Ga0495599_0162658_254_1183 292
186 3300046680 Ga0495646_0077537 Ga0495646_0077537_638_1657 292
187 3300046809 Ga0495600_0113246 Ga0495600_0113246_63_1082 292
188 3300047317 Ga0495604_0062938 Ga0495604_0062938_1398_2417 292
189 3300047319 Ga0495674_0043574 Ga0495674_0043574_2336_3355 292
190 3300047319 Ga0495674_0185896 Ga0495674_0185896_651_1580 292
191 3300047319 Ga0495674_0226263 Ga0495674_0226263_438_1367 292
192 3300047322 Ga0495680_0137024 Ga0495680_0137024_345_1274 292
193 3300048088 Ga0495602_0004338 Ga0495602_0004338_7319_8338 292
194 3300053077 Ga0495601_0071443 Ga0495601_0071443_1083_2102 292
195 3300053078 Ga0495612_0004971 Ga0495612_0004971_1957_2976 292
196 3300053085 Ga0495619_0048935 Ga0495619_0048935_139_1158 292
197 iso_pu_bacteria 2585428062 2587756355 292
198 iso_pu_bacteria 2588253510 2588295816 292
199 iso_pu_bacteria 2643221592 2643971044 292
200 iso_pu_bacteria 2643221625 2644144207 292
201 iso_pu_bacteria 2643221648 2644275229 292
202 iso_pu_bacteria 2738541307 2738883034 292
203 iso_pu_bacteria 2738543012 2739244249 292
204 iso_pu_bacteria 2738543013 2739250700 292
205 iso_pu_bacteria 2816332133 2816472521 292
206 iso_pu_bacteria 2842747753 2842752924 292
207 iso_pu_bacteria 2881412998 2881413307 292
208 iso_pu_bacteria 2904541872 2904547008 292
209 iso_pu_bacteria 2929160207 2929164480 292
210 iso_pu_bacteria 2954767861 2954768303 292
211 3300005337 Ga0070682_100007523 Ga0070682_1000075232 293
212 3300005535 Ga0070684_100113285 Ga0070684_1001132853 293
213 3300005842 Ga0068858_100212321 Ga0068858_1002123212 293
214 3300006195 Ga0075366_10017277 Ga0075366_100172775 293
215 3300006353 Ga0075370_10057355 Ga0075370_100573552 293
216 3300021377 Ga0213874_10041177 Ga0213874_100411772 293
217 3300025304 Ga0209257_1035004 Ga0209257_10350042 293
218 3300027614 Ga0209970_1001100 Ga0209970_10011004 293
219 3300027876 Ga0209974_10047852 Ga0209974_100478522 293
220 3300041452 Ga0451793_0014015 Ga0451793_0014015_145_1077 293
221 3300041463 Ga0451804_0460381 Ga0451804_0460381_126_1058 293
222 3300042015 Ga0439462_0016999 Ga0439462_0016999_861_1793 293
223 3300046519 Ga0495632_0003923 Ga0495632_0003923_1275_2207 293
224 3300048905 Ga0496102_0048973 Ga0496102_0048973_2049_2981 293
225 3300050496 nmdc:mga07m45_59696_c1 nmdc:mga07m45_59696_c1_338_1270 293
226 3300053090 Ga0500646_0005168 Ga0500646_0005168_2025_2957 293
227 3300053109 Ga0500569_009892 Ga0500569_009892_246_1178 293
228 3300053127 Ga0500623_067945 Ga0500623_067945_184_1116 293
229 3300053130 Ga0500642_0003827 Ga0500642_0003827_2194_3126 293
230 3300053131 Ga0500652_000383 Ga0500652_000383_13636_14568 293
231 3300053139 Ga0500568_0015225 Ga0500568_0015225_57_989 293
232 3300053151 Ga0500604_0015984 Ga0500604_0015984_478_1410 293
233 3300053156 Ga0500622_0001707 Ga0500622_0001707_9178_10110 293
234 3300005338 Ga0068868_100329810 Ga0068868_1003298101 294
235 3300005518 Ga0070699_100266330 Ga0070699_1002663301 294
236 3300005546 Ga0070696_100136626 Ga0070696_1001366262 294
237 3300005937 Ga0081455_10205030 Ga0081455_102050302 294
238 3300005985 Ga0081539_10067324 Ga0081539_100673242 294
239 3300006038 Ga0075365_10027047 Ga0075365_100270473 294
240 3300009545 Ga0105237_10042807 Ga0105237_100428073 294
241 3300009545 Ga0105237_10185988 Ga0105237_101859883 294
242 3300010375 Ga0105239_10026408 Ga0105239_100264083 294
243 3300025914 Ga0207671_10001548 Ga0207671_1000154820 294
244 3300025914 Ga0207671_10055310 Ga0207671_100553101 294
245 3300028379 Ga0268266_10059088 Ga0268266_100590882 294
246 3300028800 Ga0265338_10078105 Ga0265338_100781053 294
247 3300031247 Ga0265340_10001253 Ga0265340_100012537 294
248 3300031249 Ga0265339_10016011 Ga0265339_100160112 294
249 3300031344 Ga0265316_10016679 Ga0265316_100166796 294
250 3300031595 Ga0265313_10000868 Ga0265313_1000086815 294
251 3300031712 Ga0265342_10009354 Ga0265342_100093542 294
252 3300031730 Ga0307516_10144939 Ga0307516_101449392 294
253 3300044658 Ga0466972_0143240 Ga0466972_0143240_90_1043 294
254 3300046452 Ga0495617_059250 Ga0495617_059250_188_1120 294
255 3300046460 Ga0495638_0000016 Ga0495638_0000016_229380_230312 294
256 3300046491 Ga0495584_0023511 Ga0495584_0023511_1487_2419 294
257 3300046506 Ga0495583_0002328 Ga0495583_0002328_574_1506 294
258 3300046513 Ga0495616_0000024 Ga0495616_0000024_121033_121965 294
259 3300046519 Ga0495632_0000001 Ga0495632_0000001_56186_57118 294
260 3300046519 Ga0495632_0000981 Ga0495632_0000981_19364_20296 294
261 3300046520 Ga0495637_0000108 Ga0495637_0000108_52851_53783 294
262 3300046522 Ga0495643_0000020 Ga0495643_0000020_40972_41904 294
263 3300046524 Ga0495648_0000013 Ga0495648_0000013_166194_167126 294
264 3300046525 Ga0495663_0000002 Ga0495663_0000002_54516_55448 294
265 3300046558 Ga0495633_0000376 Ga0495633_0000376_30462_31394 294
266 3300046558 Ga0495633_0000712 Ga0495633_0000712_20573_21505 294
267 3300046558 Ga0495633_0038233 Ga0495633_0038233_1207_2139 294
268 3300046692 Ga0495671_0000016 Ga0495671_0000016_40972_41904 294
269 3300046692 Ga0495671_0000018 Ga0495671_0000018_168576_169508 294
270 3300046692 Ga0495671_0093140 Ga0495671_0093140_243_1175 294
271 3300047469 Ga0495673_0000130 Ga0495673_0000130_15091_16023 294
272 3300047470 Ga0495681_0002647 Ga0495681_0002647_4788_5720 294
273 3300047472 Ga0495686_0056305 Ga0495686_0056305_1466_2398 294
274 3300048924 Ga0496121_0001005 Ga0496121_0001005_39722_40654 294
275 3300049571 Ga0501034_0017460 Ga0501034_0017460_750_1688 294
276 3300049571 Ga0501034_0323976 Ga0501034_0323976_366_1304 294
277 3300049574 Ga0501038_0183691 Ga0501038_0183691_600_1538 294
278 3300053118 Ga0500594_0008201 Ga0500594_0008201_1408_2340 294
279 3300053154 Ga0500619_000050 Ga0500619_000050_28722_29660 294
280 3300053157 Ga0500624_001172 Ga0500624_001172_3079_4011 294
281 iso_pu_bacteria 2643221683 2644467759 294
282 iso_pu_bacteria 2945909444 2945909472 294
283 iso_pu_bacteria 2945984333 2945988548 294
284 3300006195 Ga0075366_10006472 Ga0075366_100064727 295
285 3300021361 Ga0213872_10004947 Ga0213872_100049474 295
286 3300021441 Ga0213871_10006847 Ga0213871_100068472 295
287 3300025929 Ga0207664_10308402 Ga0207664_103084022 295
288 3300031456 Ga0307513_10003617 Ga0307513_1000361718 295
289 3300031548 Ga0307408_100191867 Ga0307408_1001918672 295
290 3300031730 Ga0307516_10007190 Ga0307516_100071904 295
291 3300031731 Ga0307405_10113682 Ga0307405_101136822 295
292 3300031911 Ga0307412_10189538 Ga0307412_101895382 295
293 3300032002 Ga0307416_100152441 Ga0307416_1001524412 295
294 3300032005 Ga0307411_10270568 Ga0307411_102705682 295
295 3300037471 Ga0395905_0031014 Ga0395905_0031014_1282_2220 295
296 3300039438 Ga0436360_0364066 Ga0436360_0364066_825_1766 295
297 3300039447 Ga0436361_0215473 Ga0436361_0215473_626_1567 295
298 3300039447 Ga0436361_0238116 Ga0436361_0238116_7984_8925 295
299 3300039453 Ga0436362_0928376 Ga0436362_0928376_4807_5748 295
300 3300041404 Ga0439436_0027526 Ga0439436_0027526_374_1312 295
301 3300041406 Ga0439439_0005367 Ga0439439_0005367_426_1364 295
302 3300041407 Ga0439447_009443 Ga0439447_009443_855_1793 295
303 3300042002 Ga0439442_014778 Ga0439442_014778_406_1344 295
304 3300042006 Ga0439432_010813 Ga0439432_010813_374_1312 295
305 3300042010 Ga0439452_003011 Ga0439452_003011_3987_4925 295
306 3300042134 Ga0450898_007356 Ga0450898_007356_194_1132 295
307 3300042145 Ga0450906_013089 Ga0450906_013089_517_1455 295
308 3300042184 Ga0450908_004996 Ga0450908_004996_753_1691 295
309 3300042435 Ga0439434_0025222 Ga0439434_0025222_39_977 295
310 3300044735 Ga0466968_0049017 Ga0466968_0049017_18_962 295
311 3300045049 Ga0466959_0064625 Ga0466959_0064625_1316_2257 295
312 3300045976 Ga0466967_0298367 Ga0466967_0298367_241_1203 295
313 3300048924 Ga0496121_0125262 Ga0496121_0125262_383_1324 295
314 3300049589 Ga0501073_0018665 Ga0501073_0018665_2790_3731 295
315 3300049744 Ga0501083_0114295 Ga0501083_0114295_659_1600 295
316 3300050493 nmdc:mga0k408_12909_c1 nmdc:mga0k408_12909_c1_882_1826 295
317 3300050496 nmdc:mga07m45_1871_c1 nmdc:mga07m45_1871_c1_4989_5933 295
318 3300053093 Ga0500651_0007140 Ga0500651_0007140_2219_3160 295
319 3300002067 JGI24735J21928_10049912 JGI24735J21928_100499122 296
320 3300002705 JGI25156J39149_1000576 JGI25156J39149_100057615 296
321 3300002773 JGI25152J39213_1002258 JGI25152J39213_10022584 296
322 3300003187 JGI25151J46595_10003224 JGI25151J46595_100032248 296
323 3300003215 JGI25153J46596_10000537 JGI25153J46596_100005378 296
324 3300003320 rootH2_10255115 rootH2_102551152 296
325 3300003354 JGI25160J50197_1000099 JGI25160J50197_10000997 296
326 3300003756 Ga0055533_1000085 Ga0055533_1000085101 296
327 3300003758 Ga0055532_1000001 Ga0055532_1000001191 296
328 3300003760 Ga0055527_1000002 Ga0055527_1000002568 296
329 3300003761 Ga0055535_1000001 Ga0055535_1000001813 296
330 3300003762 Ga0055542_1000001 Ga0055542_1000001191 296
331 3300003763 Ga0055529_1000026 Ga0055529_100002693 296
332 3300003763 Ga0055529_1000806 Ga0055529_10008066 296
333 3300003771 Ga0055526_1000296 Ga0055526_100029625 296
334 3300003784 Ga0055534_1000538 Ga0055534_100053814 296
335 3300003794 Ga0055531_10000415 Ga0055531_100004156 296
336 3300005262 Ga0065165_1000119 Ga0065165_100011953 296
337 3300005331 Ga0070670_100507377 Ga0070670_1005073771 296
338 3300005353 Ga0070669_100024214 Ga0070669_1000242142 296
339 3300005367 Ga0070667_100009961 Ga0070667_1000099615 296
340 3300005563 Ga0068855_100408504 Ga0068855_1004085042 296
341 3300005578 Ga0068854_100115815 Ga0068854_1001158152 296
342 3300006353 Ga0075370_10000806 Ga0075370_100008065 296
343 3300006358 Ga0068871_100276144 Ga0068871_1002761442 296
344 3300009093 Ga0105240_10052581 Ga0105240_100525812 296
345 3300009093 Ga0105240_10204427 Ga0105240_102044272 296
346 3300009551 Ga0105238_10181271 Ga0105238_101812713 296
347 3300010375 Ga0105239_10009446 Ga0105239_100094469 296
348 3300013104 Ga0157370_10002111 Ga0157370_1000211120 296
349 3300013104 Ga0157370_10026421 Ga0157370_100264212 296
350 3300013105 Ga0157369_10000456 Ga0157369_1000045649 296
351 3300014497 Ga0182008_10000207 Ga0182008_100002075 296
352 3300016635 Ga0183361_10004 Ga0183361_10004410 296
353 3300017792 Ga0163161_10029573 Ga0163161_100295732 296
354 3300025226 Ga0209674_100005 Ga0209674_100005561 296
355 3300025228 Ga0209672_100001 Ga0209672_1000011022 296
356 3300025228 Ga0209672_102997 Ga0209672_1029973 296
357 3300025229 Ga0209147_100001 Ga0209147_1000011022 296
358 3300025230 Ga0209563_100297 Ga0209563_10029717 296
359 3300025242 Ga0209258_100001 Ga0209258_1000011022 296
360 3300025242 Ga0209258_103781 Ga0209258_1037813 296
361 3300025245 Ga0207425_1000259 Ga0207425_100025926 296
362 3300025253 Ga0209677_106333 Ga0209677_1063332 296
363 3300025254 Ga0209148_1000003 Ga0209148_10000031022 296
364 3300025256 Ga0209759_1000029 Ga0209759_1000029180 296
365 3300025258 Ga0209129_1000175 Ga0209129_100017542 296
366 3300025261 Ga0209233_1000043 Ga0209233_1000043448 296
367 3300025272 Ga0209455_1000001 Ga0209455_10000011022 296
368 3300025272 Ga0209455_1000458 Ga0209455_100045833 296
369 3300025284 Ga0209130_1002434 Ga0209130_10024348 296
370 3300025284 Ga0209130_1007488 Ga0209130_10074882 296
371 3300025291 Ga0209675_1000859 Ga0209675_10008599 296
372 3300025291 Ga0209675_1002909 Ga0209675_10029098 296
373 3300025292 Ga0209676_1003274 Ga0209676_100327412 296
374 3300025294 Ga0209025_1000133 Ga0209025_100013392 296
375 3300025294 Ga0209025_1036521 Ga0209025_10365212 296
376 3300025295 Ga0209564_1000136 Ga0209564_1000136124 296
377 3300025295 Ga0209564_1003544 Ga0209564_10035449 296
378 3300025297 Ga0209758_1000275 Ga0209758_100027573 296
379 3300025298 Ga0209050_1000247 Ga0209050_100024759 296
380 3300025298 Ga0209050_1001725 Ga0209050_10017255 296
381 3300025302 Ga0207426_1000215 Ga0207426_100021552 296
382 3300025303 Ga0209051_1002942 Ga0209051_100294211 296
383 3300025304 Ga0209257_1000022 Ga0209257_1000022698 296
384 3300025304 Ga0209257_1034257 Ga0209257_10342571 296
385 3300025904 Ga0207647_10020744 Ga0207647_100207443 296
386 3300025914 Ga0207671_10098708 Ga0207671_100987081 296
387 3300025923 Ga0207681_10011844 Ga0207681_100118445 296
388 3300025949 Ga0207667_10435165 Ga0207667_104351652 296
389 3300025986 Ga0207658_10221714 Ga0207658_102217142 296
390 3300026041 Ga0207639_10033289 Ga0207639_100332894 296
391 3300028381 Ga0268264_10608654 Ga0268264_106086542 296
392 3300028381 Ga0268264_10612766 Ga0268264_106127661 296
393 3300028794 Ga0307515_10088125 Ga0307515_100881251 296
394 3300028794 Ga0307515_10120033 Ga0307515_101200333 296
395 3300028794 Ga0307515_10207633 Ga0307515_102076332 296
396 3300030745 Ga0316182_1008399 Ga0316182_10083991 296
397 3300031241 Ga0265325_10010668 Ga0265325_100106682 296
398 3300031247 Ga0265340_10006435 Ga0265340_100064353 296
399 3300031251 Ga0265327_10006362 Ga0265327_100063628 296
400 3300031456 Ga0307513_10006404 Ga0307513_100064049 296
401 3300031595 Ga0265313_10012675 Ga0265313_100126753 296
402 3300031731 Ga0307405_10109898 Ga0307405_101098982 296
403 3300032002 Ga0307416_100011432 Ga0307416_1000114326 296
404 3300033180 Ga0307510_10070419 Ga0307510_100704193 296
405 3300037312 Ga0395899_0012056 Ga0395899_0012056_2789_3730 296
406 3300037312 Ga0395899_0080533 Ga0395899_0080533_297_1238 296
407 3300037418 Ga0395900_0041760 Ga0395900_0041760_2781_3722 296
408 3300037466 Ga0395898_0202998 Ga0395898_0202998_407_1360 296
409 3300037471 Ga0395905_0018276 Ga0395905_0018276_1684_2625 296
410 3300037471 Ga0395905_0033541 Ga0395905_0033541_3665_4606 296
411 3300037471 Ga0395905_0271500 Ga0395905_0271500_524_1465 296
412 3300038443 Ga0395901_0081262 Ga0395901_0081262_1671_2612 296
413 3300041451 Ga0451791_1020741 Ga0451791_1020741_158_1099 296
414 3300042007 Ga0439449_0020201 Ga0439449_0020201_1306_2259 296
415 3300044683 Ga0466965_0005137 Ga0466965_0005137_4756_5697 296
416 3300044683 Ga0466965_0045602 Ga0466965_0045602_348_1313 296
417 3300044901 Ga0466960_0009903 Ga0466960_0009903_2065_3030 296
418 3300044901 Ga0466960_0055374 Ga0466960_0055374_276_1217 296
419 3300046453 Ga0495627_021365 Ga0495627_021365_973_1914 296
420 3300046454 Ga0495592_0002222 Ga0495592_0002222_6813_7775 296
421 3300046457 Ga0495590_0009693 Ga0495590_0009693_330_1292 296
422 3300046471 Ga0495650_0031922 Ga0495650_0031922_449_1684 296
423 3300046475 Ga0495639_0027894 Ga0495639_0027894_418_1377 296
424 3300046477 Ga0495664_0056850 Ga0495664_0056850_258_1196 296
425 3300046507 Ga0495606_0011615 Ga0495606_0011615_1054_2016 296
426 3300046522 Ga0495643_0114130 Ga0495643_0114130_158_1120 296
427 3300046528 Ga0495642_0028045 Ga0495642_0028045_1266_2225 296
428 3300046542 Ga0495597_0122745 Ga0495597_0122745_98_1060 296
429 3300046543 Ga0495645_0014618 Ga0495645_0014618_1721_2659 296
430 3300046615 Ga0495656_0077773 Ga0495656_0077773_486_1445 296
431 3300046684 Ga0495669_0119002 Ga0495669_0119002_260_1219 296
432 3300046694 Ga0495649_0000215 Ga0495649_0000215_6946_7908 296
433 3300047323 Ga0495683_0080014 Ga0495683_0080014_623_1561 296
434 3300047443 Ga0495687_030818 Ga0495687_030818_300_1238 296
435 3300047472 Ga0495686_0202899 Ga0495686_0202899_115_1056 296
436 3300048091 Ga0495626_0013588 Ga0495626_0013588_815_1777 296
437 3300048903 Ga0496100_0000078 Ga0496100_0000078_5469_6407 296
438 3300048903 Ga0496100_0002476 Ga0496100_0002476_6579_7538 296
439 3300048904 Ga0496101_0000519 Ga0496101_0000519_10690_11649 296
440 3300048904 Ga0496101_0000538 Ga0496101_0000538_5535_6473 296
441 3300048905 Ga0496102_0000165 Ga0496102_0000165_5387_6325 296
442 3300048905 Ga0496102_0001291 Ga0496102_0001291_16855_17796 296
443 3300048905 Ga0496102_0048671 Ga0496102_0048671_2758_3717 296
444 3300048905 Ga0496102_0381262 Ga0496102_0381262_142_1083 296
445 3300048906 Ga0496103_0000644 Ga0496103_0000644_18780_19718 296
446 3300048906 Ga0496103_0004323 Ga0496103_0004323_6552_7511 296
447 3300048907 Ga0496104_0003338 Ga0496104_0003338_47_1006 296
448 3300048907 Ga0496104_0066930 Ga0496104_0066930_730_1668 296
449 3300048908 Ga0496105_0000375 Ga0496105_0000375_12994_13953 296
450 3300048908 Ga0496105_0040921 Ga0496105_0040921_1253_2191 296
451 3300048909 Ga0496106_0002941 Ga0496106_0002941_4650_5591 296
452 3300048909 Ga0496106_0051310 Ga0496106_0051310_1900_2859 296
453 3300048910 Ga0496107_0103389 Ga0496107_0103389_1024_1983 296
454 3300048912 Ga0496109_0047712 Ga0496109_0047712_984_1943 296
455 3300048913 Ga0496110_0001501 Ga0496110_0001501_11844_12803 296
456 3300048914 Ga0496111_0013567 Ga0496111_0013567_3683_4642 296
457 3300048917 Ga0496114_0030386 Ga0496114_0030386_3218_4177 296
458 3300048919 Ga0496116_0076685 Ga0496116_0076685_800_1741 296
459 3300048920 Ga0496117_0000707 Ga0496117_0000707_5374_6312 296
460 3300048921 Ga0496118_0000283 Ga0496118_0000283_82895_83833 296
461 3300048921 Ga0496118_0068641 Ga0496118_0068641_523_1464 296
462 3300048924 Ga0496121_0004227 Ga0496121_0004227_391_1329 296
463 3300048924 Ga0496121_0008605 Ga0496121_0008605_1432_2370 296
464 3300048924 Ga0496121_0011190 Ga0496121_0011190_20_961 296
465 3300048924 Ga0496121_0121436 Ga0496121_0121436_138_1082 296
466 3300048925 Ga0496122_0000034 Ga0496122_0000034_210128_211069 296
467 3300048926 Ga0496123_0000141 Ga0496123_0000141_138585_139526 296
468 3300048926 Ga0496123_0014329 Ga0496123_0014329_2117_3058 296
469 3300048927 Ga0496124_0006512 Ga0496124_0006512_7646_8662 296
470 3300048927 Ga0496124_0023619 Ga0496124_0023619_2012_2953 296
471 3300048928 Ga0496125_0004960 Ga0496125_0004960_7645_8589 296
472 3300048929 Ga0496126_0143867 Ga0496126_0143867_331_1272 296
473 3300048929 Ga0496126_0167674 Ga0496126_0167674_53_991 296
474 3300049568 Ga0501031_0012665 Ga0501031_0012665_1211_2152 296
475 3300049568 Ga0501031_0050911 Ga0501031_0050911_1170_2171 296
476 3300049568 Ga0501031_0100690 Ga0501031_0100690_121_1062 296
477 3300049570 Ga0501033_0003584 Ga0501033_0003584_3090_4031 296
478 3300049571 Ga0501034_0006814 Ga0501034_0006814_8317_9258 296
479 3300049571 Ga0501034_0031655 Ga0501034_0031655_1380_2381 296
480 3300049572 Ga0501036_0001771 Ga0501036_0001771_3117_4058 296
481 3300049573 Ga0501037_0004252 Ga0501037_0004252_4582_5523 296
482 3300049574 Ga0501038_0000494 Ga0501038_0000494_28230_29171 296
483 3300049579 Ga0501043_0000038 Ga0501043_0000038_126368_127330 296
484 3300049579 Ga0501043_0001194 Ga0501043_0001194_12718_13659 296
485 3300049580 Ga0501046_0000049 Ga0501046_0000049_1350_2312 296
486 3300049580 Ga0501046_0002440 Ga0501046_0002440_10846_11787 296
487 3300049581 Ga0501047_0000039 Ga0501047_0000039_185561_186523 296
488 3300049581 Ga0501047_0004711 Ga0501047_0004711_7802_8743 296
489 3300049582 Ga0501048_0025913 Ga0501048_0025913_3256_4218 296
490 3300049822 Ga0501035_0012428 Ga0501035_0012428_663_1601 296
491 3300049822 Ga0501035_0082472 Ga0501035_0082472_1840_2781 296
492 3300049823 Ga0501044_0000236 Ga0501044_0000236_52526_53464 296
493 3300049823 Ga0501044_0012609 Ga0501044_0012609_1429_2370 296
494 3300049823 Ga0501044_0120424 Ga0501044_0120424_759_1760 296
495 3300049824 Ga0501045_0001444 Ga0501045_0001444_1236_2198 296
496 3300050493 nmdc:mga0k408_57926_c1 nmdc:mga0k408_57926_c1_1040_1993 296
497 3300053086 Ga0500578_0000282 Ga0500578_0000282_26302_27243 296
498 3300053086 Ga0500578_0011827 Ga0500578_0011827_3623_4564 296
499 3300053088 Ga0500644_0007025 Ga0500644_0007025_62_1003 296
500 3300053088 Ga0500644_0010532 Ga0500644_0010532_455_1396 296
501 3300053093 Ga0500651_0037393 Ga0500651_0037393_206_1147 296
502 3300053108 Ga0500562_012690 Ga0500562_012690_1156_2097 296
503 3300053108 Ga0500562_052966 Ga0500562_052966_14_955 296
504 3300053125 Ga0500618_024064 Ga0500618_024064_23_979 296
505 3300053136 Ga0500559_0000193 Ga0500559_0000193_23876_24817 296
506 3300053139 Ga0500568_0033481 Ga0500568_0033481_321_1262 296
507 3300053145 Ga0500586_004111 Ga0500586_004111_2459_3415 296
508 3300053151 Ga0500604_0022552 Ga0500604_0022552_403_1344 296
509 3300053156 Ga0500622_0000413 Ga0500622_0000413_15891_16832 296
510 3300053156 Ga0500622_0126224 Ga0500622_0126224_129_1070 296
511 3300053730 Ga0500645_003922 Ga0500645_003922_3153_4094 296
512 3300053739 Ga0500587_003153 Ga0500587_003153_1161_2102 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05853

BKACE

beta-keto acid cleavage enzyme

9

307

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.9551 5 293
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.9519 5 296
3lot-assembly1.cif.gz_C crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution 0.9512 6 296
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.9363 5 296
3lot-assembly1.cif.gz_C crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution 0.9324 6 296
ID Description Score Start End Superfamily
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9321 5 296 3.20.20.70
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9167 5 296 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.876 6 289 3.20.20.70
3no5E00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8684 5 285 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8667 7 290 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A654ZM87-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9943 215 290 GO:0043720
GO:0046872
AF-A0A496WKL7-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9933 169 284 GO:0043720
GO:0046872
AF-A0A7Z9MTX4-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9907 221 296 GO:0043720
GO:0046872
AF-A0A1Z8V441-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9898 7 87 GO:0043720
GO:0046872
AF-A0A2E7NU08-F1-model_v4 deleted 0.9897 150 296

Feature Viewer

pLDDT pTM Quality
91.38 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map