F457435

General Info

Members Datasets Scaffolds Average Seq Length
512 299 1024 418

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10233179|Ga0207683_102331792
Length 467
Sequence MAATVTPPRGMRDFLPAEKARREHALGVIRGVYAAHGFDEIETPVMEDSSRLHAGLGGDNEKLAFAVMKRGLTADDLADAAASGETLALADLGLRYDLTVPLARFYATHRAALPPVFRAIQIAPVWRAERPQKGRYRQFVQCDIDIIGEPGPLAELELLTATIATLDALGLGGCTIRLNDRRVLGGILTSWNVPDDLRERALITIDKLGAVDASTDVAAHLEALTSADWHLHDGVVPPPAWLDLDAYRDLLALRAALPDAAIEFDPTLVRGMGYYTGTIFEIAHPDFGYSLGGGGRYDHMIGRFLGQEVPACGFSIGFERIVDLLAIRDHSRPRAVVLVYDPDTSPAELLRLKDELVSGGTRVRLERRVKNLRALLDRVAADGFDAFAQVGPDTTDAASLAFRDLFAYTLGFGFVAYQPALALLGRTDPLGLPAWAGYAAPLVALPAVGVAALMWGNGVRHYRSTGS

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2582580736 Prauserella sp. Am3 Isolate Unclassified
236 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
237 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
238 2643221549 Agromyces sp. Root1464 Isolate Unclassified
239 2643221553 Microbacterium sp. Root553 Isolate Unclassified
240 2643221572 Leifsonia sp. Root60 Isolate Unclassified
241 2643221575 Microbacterium sp. Root61 Isolate Unclassified
242 2643221597 Microbacterium sp. Root180 Isolate Unclassified
243 2643221619 Agromyces sp. Root81 Isolate Unclassified
244 2643221630 Microbacterium sp. Root322 Isolate Unclassified
245 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
246 2643221649 Leifsonia sp. Root4 Isolate Unclassified
247 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
248 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
249 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
250 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
251 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
252 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
253 2773857759 Microbacterium sp. 1294 Isolate Unclassified
254 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
255 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
256 2808606372 Agromyces sp. 23-23 Isolate Unclassified
257 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
258 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
259 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
260 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
261 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
262 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
263 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
264 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
265 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
266 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
267 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
268 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
269 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
270 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
271 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
272 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
273 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
274 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
275 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
276 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
277 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
278 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
279 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
280 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
281 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
282 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
283 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
284 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
285 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
286 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
287 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
288 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
289 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
290 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
291 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
292 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
293 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
294 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
295 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
296 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
297 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
298 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
299 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.3
Metatranscriptomes 0
Isolates 12.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 6.64
Nodule 0
Rhizoplane 3.12
Rhizosphere 75.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10233179 3300026121 Bacteria 1679
2 Ga0065714_10065949 3300005288 Bacteria 7995
3 Ga0065714_10087820 3300005288 Bacteria 2042
4 Ga0070658_10000034 3300005327 Bacteria 146880
5 Ga0070658_10020948 3300005327 Bacteria 5237
6 Ga0070668_100227459 3300005347 Bacteria 1541
7 Ga0070659_100204072 3300005366 Bacteria 1628
8 Ga0070667_100013678 3300005367 Bacteria 6706
9 Ga0070714_100002647 3300005435 Bacteria 13197
10 Ga0070705_100071121 3300005440 Bacteria 2103
11 Ga0070708_100039351 3300005445 Bacteria 4136
12 Ga0070708_100069929 3300005445 Bacteria 3157
13 Ga0070708_100119374 3300005445 Bacteria 2431
14 Ga0070663_100142751 3300005455 Bacteria 1829
15 Ga0070706_100078295 3300005467 Bacteria 3061
16 Ga0070707_100019128 3300005468 Bacteria 6449
17 Ga0070707_100105167 3300005468 Bacteria 2737
18 Ga0070698_100017754 3300005471 Bacteria 7493
19 Ga0070698_100036309 3300005471 Bacteria 5091
20 Ga0070699_100002561 3300005518 Bacteria 16315
21 Ga0068853_100083251 3300005539 Bacteria 2803
22 Ga0070695_100059221 3300005545 Bacteria 2479
23 Ga0070696_100126408 3300005546 Bacteria 1855
24 Ga0070704_100032946 3300005549 Bacteria 3500
25 Ga0068855_100161941 3300005563 Bacteria 2538
26 Ga0070664_100018724 3300005564 Bacteria 5695
27 Ga0068852_100009144 3300005616 Bacteria 7340
28 Ga0068852_100069440 3300005616 Bacteria 3088
29 Ga0068851_10000043 3300005834 Bacteria 87775
30 Ga0068863_100069262 3300005841 Bacteria 3336
31 Ga0068860_100131870 3300005843 Bacteria 2398
32 Ga0081540_1000923 3300005983 Bacteria 26427
33 Ga0081539_10000035 3300005985 Bacteria 302689
34 Ga0081539_10000197 3300005985 Bacteria 140516
35 Ga0075365_10000454 3300006038 Bacteria 15315
36 Ga0075365_10016678 3300006038 Bacteria 4474
37 Ga0075365_10020391 3300006038 Bacteria 4109
38 Ga0075365_10060665 3300006038 Bacteria 2524
39 Ga0075363_100009754 3300006048 Bacteria 4523
40 Ga0075364_10008851 3300006051 Bacteria 6027
41 Ga0075364_10030231 3300006051 Bacteria 3476
42 Ga0075364_10127514 3300006051 Bacteria 1707
43 Ga0070716_100053488 3300006173 Bacteria 2302
44 Ga0075369_10052294 3300006186 Bacteria 1771
45 Ga0097621_100117528 3300006237 Bacteria 2253
46 Ga0075428_100008929 3300006844 Bacteria 11122
47 Ga0075428_100078482 3300006844 Bacteria 3604
48 Ga0075428_100105257 3300006844 Bacteria 3077
49 Ga0075430_100000188 3300006846 Bacteria 41506
50 Ga0075430_100023183 3300006846 Bacteria 5279
51 Ga0075430_100026190 3300006846 Bacteria 4963
52 Ga0075431_100001027 3300006847 Bacteria 24883
53 Ga0075431_100004984 3300006847 Bacteria 13064
54 Ga0075431_100009995 3300006847 Bacteria 9532
55 Ga0075431_100015725 3300006847 Bacteria 7673
56 Ga0075433_10001588 3300006852 Bacteria 16831
57 Ga0075433_10039995 3300006852 Bacteria 4057
58 Ga0075433_10146299 3300006852 Bacteria 2101
59 Ga0075434_100002424 3300006871 Bacteria 16386
60 Ga0075429_100003331 3300006880 Bacteria 13689
61 Ga0075429_100003527 3300006880 Bacteria 13328
62 Ga0075429_100009623 3300006880 Bacteria 8385
63 Ga0075429_100012902 3300006880 Bacteria 7251
64 Ga0075429_100013330 3300006880 Bacteria 7127
65 Ga0114129_10001436 3300009147 Bacteria 32152
66 Ga0114129_10003403 3300009147 Bacteria 22352
67 Ga0114129_10003532 3300009147 Bacteria 21989
68 Ga0114129_10008300 3300009147 Bacteria 14816
69 Ga0114129_10011771 3300009147 Bacteria 12445
70 Ga0114129_10013576 3300009147 Bacteria 11605
71 Ga0114129_10047347 3300009147 Bacteria 6042
72 Ga0114129_10099087 3300009147 Bacteria 4034
73 Ga0114129_10110804 3300009147 Bacteria 3788
74 Ga0114129_10126087 3300009147 Bacteria 3519
75 Ga0105241_10114054 3300009174 Bacteria 2167
76 Ga0105248_10005013 3300009177 Bacteria 14627
77 Ga0105237_10000164 3300009545 Bacteria 93890
78 Ga0105238_10057186 3300009551 Bacteria 3911
79 Ga0105033_101157 3300009986 Bacteria 2135
80 Ga0105239_10221098 3300010375 Bacteria 2124
81 Ga0157371_10002292 3300013102 Bacteria 18439
82 Ga0157370_10104055 3300013104 Bacteria 2657
83 Ga0157369_10017265 3300013105 Bacteria 8112
84 Ga0171462_1004 3300013250 Bacteria 678877
85 Ga0157374_10241258 3300013296 Bacteria 1777
86 Ga0163162_10038951 3300013306 Bacteria 4746
87 Ga0163163_10021995 3300014325 Bacteria 6029
88 Ga0157380_10028306 3300014326 Bacteria 4271
89 Ga0213875_10000926 3300021388 Bacteria 21146
90 Ga0213875_10065250 3300021388 Bacteria 1701
91 Ga0209646_1000092 3300025246 Bacteria 185930
92 Ga0209148_1000962 3300025254 Bacteria 18770
93 Ga0207656_10000001 3300025321 Bacteria 1323684
94 Ga0207656_10000003 3300025321 Bacteria 771644
95 Ga0207656_10000004 3300025321 Bacteria 632320
96 Ga0207653_10021159 3300025885 Bacteria 2063
97 Ga0207705_10000001 3300025909 Bacteria 2061880
98 Ga0207684_10019898 3300025910 Bacteria 5737
99 Ga0207684_10251343 3300025910 Bacteria 1525
100 Ga0207671_10000001 3300025914 Bacteria 1318881
101 Ga0207663_10003760 3300025916 Bacteria 7484
102 Ga0207657_10075430 3300025919 Bacteria 2846
103 Ga0207652_10159217 3300025921 Bacteria 2023
104 Ga0207646_10009021 3300025922 Bacteria 9910
105 Ga0207646_10068912 3300025922 Bacteria 3159
106 Ga0207664_10005950 3300025929 Bacteria 8351
107 Ga0207690_10085275 3300025932 Bacteria 2217
108 Ga0207689_10066036 3300025942 Bacteria 2975
109 Ga0207712_10096886 3300025961 Bacteria 2184
110 Ga0207668_10167264 3300025972 Bacteria 1721
111 Ga0207658_10006749 3300025986 Bacteria 7814
112 Ga0207639_10086795 3300026041 Bacteria 2492
113 Ga0207702_10077950 3300026078 Bacteria 2867
114 Ga0207674_10016730 3300026116 Bacteria 8014
115 Ga0207675_100105901 3300026118 Bacteria 2651
116 Ga0207683_10004653 3300026121 Bacteria 11826
117 Ga0207698_10001313 3300026142 Bacteria 14490
118 Ga0207698_10006931 3300026142 Bacteria 7092
119 Ga0209974_10023451 3300027876 Bacteria 2042
120 Ga0268265_10289375 3300028380 Bacteria 1470
121 Ga0307511_10055824 3300030521 Bacteria 3095
122 Ga0307511_10077709 3300030521 Bacteria 2361
123 Ga0307413_10003332 3300031824 Bacteria 6751
124 Ga0307410_10065597 3300031852 Bacteria 2498
125 Ga0307406_10000065 3300031901 Bacteria 58903
126 Ga0307406_10000710 3300031901 Bacteria 18737
127 Ga0307406_10011403 3300031901 Bacteria 5044
128 Ga0307409_100051016 3300031995 Bacteria 3164
129 Ga0307414_10038218 3300032004 Bacteria 3221
130 Ga0307414_10208984 3300032004 Bacteria 1594
131 Ga0307411_10033219 3300032005 Bacteria 3198
132 Ga0373944_0001400 3300035089 Bacteria 6082
133 Ga0373936_0000325 3300035113 Bacteria 16126
134 Ga0373936_0006402 3300035113 Bacteria 4437
135 Ga0373945_0000021 3300035116 Bacteria 32047
136 Ga0373953_0028841 3300035117 Bacteria 2143
137 Ga0373957_0019059 3300035120 Bacteria 2410
138 Ga0373943_0000066 3300035170 Bacteria 36871
139 Ga0373946_0000019 3300035171 Bacteria 44508
140 Ga0373946_0002528 3300035171 Bacteria 6462
141 Ga0373955_0010072 3300035172 Bacteria 4450
142 Ga0373942_0014070 3300035207 Bacteria 1932
143 Ga0373924_0001872 3300035410 Bacteria 6968
144 Ga0373931_0107573 3300035691 Bacteria 1577
145 Ga0373935_0019601 3300035692 Bacteria 4124
146 Ga0373927_0000402 3300035695 Bacteria 33457
147 Ga0373933_0145094 3300035724 Bacteria 1500
148 Ga0373947_0000197 3300035725 Bacteria 33311
149 Ga0373925_0076337 3300037068 Bacteria 2540
150 Ga0395900_0015428 3300037418 Bacteria 7788
151 Ga0395900_0037868 3300037418 Bacteria 4972
152 Ga0395900_0042324 3300037418 Bacteria 4693
153 Ga0395898_0009429 3300037466 Bacteria 10253
154 Ga0395898_0368554 3300037466 Bacteria 1370
155 Ga0436364_0010465 3300037853 Bacteria 29518
156 Ga0436364_0434761 3300037853 Bacteria 77699
157 Ga0395901_0001485 3300038443 Bacteria 24394
158 Ga0400489_71485 3300039093 Bacteria 2423
159 Ga0436363_0453941 3300039450 Bacteria 3017
160 Ga0436362_0781133 3300039453 Bacteria 1442
161 Ga0451793_0385801 3300041452 Bacteria 1773
162 Ga0466969_0003914 3300044656 Bacteria 7908
163 Ga0466969_0007440 3300044656 Bacteria 5816
164 Ga0466972_0070262 3300044658 Bacteria 1671
165 Ga0466965_0000001 3300044683 Bacteria 317826
166 Ga0466966_0000471 3300044684 Bacteria 25873
167 Ga0466961_0001627 3300044693 Bacteria 13938
168 Ga0466963_0147091 3300044694 Bacteria 1635
169 Ga0466970_0000462 3300044765 Bacteria 20086
170 Ga0466970_0005631 3300044765 Bacteria 6219
171 Ga0466970_0016661 3300044765 Bacteria 3792
172 Ga0466970_0076040 3300044765 Bacteria 1808
173 Ga0466960_0033699 3300044901 Bacteria 2382
174 Ga0466959_0020094 3300045049 Bacteria 4917
175 Ga0466967_0011950 3300045976 Bacteria 6615
176 Ga0495592_0024647 3300046454 Bacteria 4573
177 Ga0495592_0212476 3300046454 Bacteria 1298
178 Ga0495603_0004676 3300046455 Bacteria 8177
179 Ga0495629_0024652 3300046459 Bacteria 4282
180 Ga0495641_0001922 3300046461 Bacteria 16966
181 Ga0495641_0009403 3300046461 Bacteria 5807
182 Ga0495653_0000497 3300046463 Bacteria 30342
183 Ga0495653_0049288 3300046463 Bacteria 3245
184 Ga0495580_0099627 3300046472 Bacteria 2021
185 Ga0495639_0005638 3300046475 Bacteria 5385
186 Ga0495662_0030540 3300046476 Bacteria 2601
187 Ga0495664_0000137 3300046477 Bacteria 36467
188 Ga0495664_0049047 3300046477 Bacteria 2506
189 Ga0495664_0132512 3300046477 Bacteria 1509
190 Ga0495618_0032308 3300046514 Bacteria 3278
191 Ga0495628_0079320 3300046516 Bacteria 2552
192 Ga0495628_0158399 3300046516 Bacteria 1721
193 Ga0495630_0000968 3300046517 Bacteria 20068
194 Ga0495630_0095184 3300046517 Bacteria 2251
195 Ga0495666_0003416 3300046526 Bacteria 8011
196 Ga0495652_0100102 3300046529 Bacteria 2352
197 Ga0495665_0000799 3300046531 Bacteria 16491
198 Ga0495665_0031651 3300046531 Bacteria 2831
199 Ga0495640_0010218 3300046533 Bacteria 7263
200 Ga0495587_0056002 3300046536 Bacteria 2320
201 Ga0495645_0024162 3300046543 Bacteria 4409
202 Ga0495667_0001672 3300046559 Bacteria 14712
203 Ga0495667_0005458 3300046559 Bacteria 8591
204 Ga0495667_0009517 3300046559 Bacteria 6584
205 Ga0495634_0011708 3300046642 Bacteria 6378
206 Ga0495625_0100097 3300046660 Bacteria 1993
207 Ga0495635_0000528 3300046663 Bacteria 24259
208 Ga0495635_0013930 3300046663 Bacteria 5626
209 Ga0495635_0109042 3300046663 Bacteria 1891
210 Ga0495588_0009870 3300046674 Bacteria 4426
211 Ga0495657_0014553 3300046675 Bacteria 5772
212 Ga0495599_0021203 3300046678 Bacteria 4053
213 Ga0495599_0108731 3300046678 Bacteria 1727
214 Ga0495623_0069895 3300046679 Bacteria 2187
215 Ga0495647_0057561 3300046681 Bacteria 1526
216 Ga0495613_0008444 3300046689 Bacteria 7643
217 Ga0495624_0001683 3300046690 Bacteria 16940
218 Ga0495624_0005789 3300046690 Bacteria 8852
219 Ga0495600_0134009 3300046809 Bacteria 1609
220 Ga0495581_0008826 3300047315 Bacteria 5834
221 Ga0495604_0038242 3300047317 Bacteria 3775
222 Ga0495604_0221815 3300047317 Bacteria 1301
223 Ga0495674_0000418 3300047319 Bacteria 38152
224 Ga0495672_0008618 3300047320 Bacteria 7503
225 Ga0495672_0012245 3300047320 Bacteria 5997
226 Ga0495676_0003221 3300047321 Bacteria 14746
227 Ga0495676_0050195 3300047321 Bacteria 3347
228 Ga0495680_0042342 3300047322 Bacteria 3614
229 Ga0495675_0010697 3300047444 Bacteria 5741
230 Ga0495684_0002229 3300047471 Bacteria 15526
231 Ga0495686_0116246 3300047472 Bacteria 1599
232 Ga0495593_0049427 3300047673 Bacteria 2231
233 Ga0495614_0003807 3300048089 Bacteria 6780
234 Ga0496100_0110498 3300048903 Bacteria 1908
235 Ga0496101_0167097 3300048904 Bacteria 1689
236 Ga0496102_0057386 3300048905 Bacteria 3555
237 Ga0496102_0164062 3300048905 Bacteria 2090
238 Ga0496102_0350596 3300048905 Bacteria 1390
239 Ga0496103_0080420 3300048906 Bacteria 2049
240 Ga0496104_0040497 3300048907 Bacteria 4367
241 Ga0496107_0019378 3300048910 Bacteria 4800
242 Ga0496109_0053828 3300048912 Bacteria 3672
243 Ga0496111_0052122 3300048914 Bacteria 2954
244 Ga0496112_0218836 3300048915 Bacteria 1860
245 Ga0496113_0022152 3300048916 Bacteria 4489
246 Ga0496115_0003169 3300048918 Bacteria 11823
247 Ga0496115_0038063 3300048918 Bacteria 3815
248 Ga0496115_0157996 3300048918 Bacteria 1873
249 Ga0496116_0019524 3300048919 Bacteria 5188
250 Ga0496117_0000561 3300048920 Bacteria 61150
251 Ga0496117_0001610 3300048920 Bacteria 31902
252 Ga0496117_0003206 3300048920 Bacteria 19349
253 Ga0496117_0014406 3300048920 Bacteria 6812
254 Ga0496118_0000705 3300048921 Bacteria 54015
255 Ga0496118_0073763 3300048921 Bacteria 2443
256 Ga0496119_0000133 3300048922 Bacteria 104400
257 Ga0496119_0005004 3300048922 Bacteria 12924
258 Ga0496119_0020407 3300048922 Bacteria 4836
259 Ga0496119_0026334 3300048922 Bacteria 4034
260 Ga0496119_0086651 3300048922 Bacteria 1789
261 Ga0496121_0000098 3300048924 Bacteria 200516
262 Ga0496122_0000036 3300048925 Bacteria 312598
263 Ga0496122_0000059 3300048925 Bacteria 247170
264 Ga0496122_0000650 3300048925 Bacteria 70405
265 Ga0496122_0017069 3300048925 Bacteria 6812
266 Ga0496122_0024552 3300048925 Bacteria 5271
267 Ga0496122_0099106 3300048925 Bacteria 1955
268 Ga0496123_0000011 3300048926 Bacteria 493925
269 Ga0496123_0000157 3300048926 Bacteria 137212
270 Ga0496123_0009441 3300048926 Bacteria 8783
271 Ga0496123_0031901 3300048926 Bacteria 3825
272 Ga0496124_0000234 3300048927 Bacteria 108472
273 Ga0496124_0005221 3300048927 Bacteria 14739
274 Ga0496124_0077757 3300048927 Bacteria 2736
275 Ga0496124_0086656 3300048927 Bacteria 2562
276 Ga0496124_0103602 3300048927 Bacteria 2302
277 Ga0496125_0000167 3300048928 Bacteria 147134
278 Ga0496125_0003485 3300048928 Bacteria 19016
279 Ga0496125_0006360 3300048928 Bacteria 12809
280 Ga0496125_0076708 3300048928 Bacteria 2579
281 Ga0496126_0005698 3300048929 Bacteria 14111
282 Ga0496126_0026458 3300048929 Bacteria 5563
283 Ga0496126_0154290 3300048929 Bacteria 1966
284 Ga0496126_0240055 3300048929 Bacteria 1514
285 Ga0501031_0007993 3300049568 Bacteria 6886
286 Ga0501032_0012035 3300049569 Bacteria 6194
287 Ga0501032_0027002 3300049569 Bacteria 3947
288 Ga0501033_0003524 3300049570 Bacteria 12803
289 Ga0501033_0017202 3300049570 Bacteria 5464
290 Ga0501033_0029480 3300049570 Bacteria 4123
291 Ga0501033_0064923 3300049570 Bacteria 2685
292 Ga0501034_0001490 3300049571 Bacteria 30832
293 Ga0501034_0024862 3300049571 Bacteria 6093
294 Ga0501034_0034308 3300049571 Bacteria 5144
295 Ga0501034_0051939 3300049571 Bacteria 4132
296 Ga0501034_0052575 3300049571 Bacteria 4103
297 Ga0501034_0061080 3300049571 Bacteria 3785
298 Ga0501034_0063109 3300049571 Bacteria 3719
299 Ga0501034_0071752 3300049571 Bacteria 3472
300 Ga0501034_0101170 3300049571 Bacteria 2876
301 Ga0501034_0207997 3300049571 Bacteria 1912
302 Ga0501034_0302469 3300049571 Bacteria 1536
303 Ga0501034_0380597 3300049571 Bacteria 1336
304 Ga0501036_0004137 3300049572 Bacteria 11669
305 Ga0501036_0102193 3300049572 Bacteria 2425
306 Ga0501037_0006256 3300049573 Bacteria 8703
307 Ga0501037_0019066 3300049573 Bacteria 5057
308 Ga0501037_0037109 3300049573 Bacteria 3592
309 Ga0501037_0056838 3300049573 Bacteria 2857
310 Ga0501037_0127071 3300049573 Bacteria 1830
311 Ga0501038_0001945 3300049574 Bacteria 19054
312 Ga0501038_0024414 3300049574 Bacteria 5394
313 Ga0501038_0024913 3300049574 Bacteria 5332
314 Ga0501038_0084680 3300049574 Bacteria 2667
315 Ga0501038_0143383 3300049574 Bacteria 1952
316 Ga0501038_0232424 3300049574 Bacteria 1467
317 Ga0501039_0001361 3300049575 Bacteria 17929
318 Ga0501039_0009373 3300049575 Bacteria 7463
319 Ga0501041_0107214 3300049577 Bacteria 1732
320 Ga0501041_0143000 3300049577 Bacteria 1492
321 Ga0501042_0000417 3300049578 Bacteria 21557
322 Ga0501042_0005287 3300049578 Bacteria 8300
323 Ga0501043_0006580 3300049579 Bacteria 9313
324 Ga0501043_0025434 3300049579 Bacteria 4645
325 Ga0501043_0029704 3300049579 Bacteria 4295
326 Ga0501043_0068602 3300049579 Bacteria 2784
327 Ga0501043_0079071 3300049579 Bacteria 2584
328 Ga0501043_0084762 3300049579 Bacteria 2491
329 Ga0501046_0005765 3300049580 Bacteria 11056
330 Ga0501046_0007719 3300049580 Bacteria 9432
331 Ga0501046_0010652 3300049580 Bacteria 7886
332 Ga0501046_0015149 3300049580 Bacteria 6485
333 Ga0501046_0022195 3300049580 Bacteria 5231
334 Ga0501047_0003227 3300049581 Bacteria 15461
335 Ga0501047_0015150 3300049581 Bacteria 7341
336 Ga0501047_0043756 3300049581 Bacteria 4325
337 Ga0501047_0058378 3300049581 Bacteria 3728
338 Ga0501047_0094608 3300049581 Bacteria 2866
339 Ga0501047_0178993 3300049581 Bacteria 1987
340 Ga0501048_0007518 3300049582 Bacteria 8256
341 Ga0501048_0020337 3300049582 Bacteria 4865
342 Ga0501048_0020438 3300049582 Bacteria 4852
343 Ga0501048_0022264 3300049582 Bacteria 4638
344 Ga0501048_0176286 3300049582 Bacteria 1515
345 Ga0501067_0007738 3300049583 Bacteria 5977
346 Ga0501068_0055226 3300049584 Bacteria 2406
347 Ga0501070_0005515 3300049586 Bacteria 10794
348 Ga0501070_0011739 3300049586 Bacteria 7399
349 Ga0501071_0196170 3300049587 Bacteria 1515
350 Ga0501072_0006933 3300049588 Bacteria 8600
351 Ga0501073_0000038 3300049589 Bacteria 86286
352 Ga0501073_0040637 3300049589 Bacteria 3290
353 Ga0501074_0024171 3300049590 Bacteria 4416
354 Ga0501074_0108564 3300049590 Bacteria 1986
355 Ga0501075_0000047 3300049591 Bacteria 50323
356 Ga0501075_0019861 3300049591 Bacteria 4879
357 Ga0501075_0063881 3300049591 Bacteria 2776
358 Ga0501076_0001961 3300049592 Bacteria 14048
359 Ga0501076_0038331 3300049592 Bacteria 3762
360 Ga0501077_0006078 3300049593 Bacteria 7369
361 Ga0501077_0017120 3300049593 Bacteria 4571
362 Ga0501077_0033122 3300049593 Bacteria 3290
363 Ga0501077_0038584 3300049593 Bacteria 3042
364 Ga0501079_0018770 3300049741 Bacteria 5284
365 Ga0501079_0020202 3300049741 Bacteria 5091
366 Ga0501079_0034227 3300049741 Bacteria 3909
367 Ga0501079_0058772 3300049741 Bacteria 2967
368 Ga0501080_0000269 3300049742 Bacteria 39318
369 Ga0501080_0020614 3300049742 Bacteria 6105
370 Ga0501080_0024760 3300049742 Bacteria 5567
371 Ga0501080_0031678 3300049742 Bacteria 4927
372 Ga0501080_0043799 3300049742 Bacteria 4168
373 Ga0501080_0123750 3300049742 Bacteria 2396
374 Ga0501081_0000628 3300049743 Bacteria 20134
375 Ga0501081_0001365 3300049743 Bacteria 14918
376 Ga0501081_0026221 3300049743 Bacteria 3928
377 Ga0501083_0000253 3300049744 Bacteria 34060
378 Ga0501083_0005771 3300049744 Bacteria 8762
379 Ga0501083_0009178 3300049744 Bacteria 6987
380 Ga0501035_0018215 3300049822 Bacteria 6468
381 Ga0501035_0026623 3300049822 Bacteria 5289
382 Ga0501035_0052942 3300049822 Bacteria 3631
383 Ga0501035_0096300 3300049822 Bacteria 2600
384 Ga0501035_0125819 3300049822 Bacteria 2237
385 Ga0501044_0002221 3300049823 Bacteria 22261
386 Ga0501044_0011291 3300049823 Bacteria 9680
387 Ga0501044_0061351 3300049823 Bacteria 3846
388 Ga0501044_0073443 3300049823 Bacteria 3476
389 Ga0501044_0194034 3300049823 Bacteria 1992
390 Ga0501045_0002868 3300049824 Bacteria 11778
391 Ga0501045_0045725 3300049824 Bacteria 3187
392 Ga0501045_0058344 3300049824 Bacteria 2826
393 Ga0501045_0059638 3300049824 Bacteria 2796
394 nmdc:mga00v17_91495_c1 3300050491 Bacteria 1911
395 nmdc:mga00v17_9177_c1 3300050491 Bacteria 5340
396 nmdc:mga05p37_106386_c1 3300050507 Bacteria 3451
397 nmdc:mga05p37_194185_c1 3300050507 Bacteria 2463
398 nmdc:mga05p37_26398_c1 3300050507 Bacteria 7064
399 nmdc:mga05p37_3838_c1 3300050507 Bacteria 17583
400 nmdc:mga05p37_4050_c2 3300050507 Bacteria 6122
401 nmdc:mga05p37_437_c1 3300050507 Bacteria 45229
402 nmdc:mga05p37_49085_c1 3300050507 Bacteria 5191
403 nmdc:mga05p37_77408_c1 3300050507 Bacteria 4095
404 nmdc:mga09592_10756_c1 3300050508 Bacteria 5340
405 nmdc:mga09592_1358_c1 3300050508 Bacteria 19562
406 nmdc:mga09592_2110_c1 3300050508 Bacteria 16052
407 nmdc:mga09592_47093_c1 3300050508 Bacteria 3633
408 nmdc:mga0qj67_125501_c1 3300050509 Bacteria 2077
409 nmdc:mga0qj67_15897_c1 3300050509 Bacteria 5699
410 nmdc:mga0qj67_76040_c1 3300050509 Bacteria 2685
411 nmdc:mga06r32_15293_c1 3300050510 Bacteria 6971
412 nmdc:mga06r32_24903_c1 3300050510 Bacteria 5562
413 nmdc:mga0n895_1394_c1 3300050512 Bacteria 18007
414 nmdc:mga0n895_147701_c1 3300050512 Bacteria 2381
415 nmdc:mga0rr50_5727_c1 3300050513 Bacteria 7451
416 nmdc:mga0a205_14116_c1 3300050515 Bacteria 7455
417 nmdc:mga0a205_147312_c1 3300050515 Bacteria 2255
418 nmdc:mga0a205_147844_c1 3300050515 Bacteria 2250
419 nmdc:mga0a205_48182_c1 3300050515 Bacteria 4112
420 Ga0500643_000092 3300053087 Bacteria 93617
421 Ga0500651_0006699 3300053093 Bacteria 6667
422 Ga0500556_0000169 3300053104 Bacteria 53730
423 Ga0500556_0000564 3300053104 Bacteria 24717
424 Ga0500562_001234 3300053108 Bacteria 6296
425 Ga0500559_0000273 3300053136 Bacteria 40224
426 Ga0500559_0000742 3300053136 Bacteria 21406
427 Ga0500559_0003036 3300053136 Bacteria 8393
428 Ga0500559_0012760 3300053136 Bacteria 3567
429 Ga0500559_0027635 3300053136 Bacteria 2421
430 Ga0500568_0000009 3300053139 Bacteria 270298
431 Ga0500568_0000164 3300053139 Bacteria 57135
432 Ga0500568_0027853 3300053139 Bacteria 2360
433 Ga0500573_0000096 3300053140 Bacteria 39865
434 Ga0500573_0014566 3300053140 Bacteria 4449
435 Ga0500573_0020566 3300053140 Bacteria 3780
436 Ga0500577_0048225 3300053142 Bacteria 1587
437 Ga0500577_0060119 3300053142 Bacteria 1458
438 Ga0500588_0001066 3300053146 Bacteria 4984
439 Ga0500616_0000058 3300053153 Bacteria 266276
440 Ga0500616_0002577 3300053153 Bacteria 14913
441 Ga0500620_000122 3300053155 Bacteria 15500
442 Ga0501084_0028387 3300054114 Bacteria 4676
443 Ga0501084_0254158 3300054114 Bacteria 1483
444 Ga0501082_0028777 3300060353 Bacteria 4786
445 Ga0530510_0000001 3300061734 Bacteria 285623
446 Ga0530510_0052624 3300061734 Bacteria 2942
447 Ga0530510_0059697 3300061734 Bacteria 2759
448 2583152416 2582580736 Bacteria 5325865
449 2587864323 2585428094 Bacteria 3604039
450 2643732159 2643221542 Bacteria 3563959
451 2643769790 2643221549 Bacteria 4042819
452 2643785077 2643221553 Bacteria 3544260
453 2643875907 2643221572 Bacteria 3614809
454 2643886041 2643221575 Bacteria 4022601
455 2643995418 2643221597 Bacteria 3347721
456 2644114445 2643221619 Bacteria 4158469
457 2644170966 2643221630 Bacteria 3601215
458 2644198174 2643221635 Bacteria 2632343
459 2644280302 2643221649 Bacteria 3867359
460 2644382962 2643221669 Bacteria 3611286
461 2644679415 2643221724 Bacteria 3593515
462 2723641453 2721755702 Bacteria 4373124
463 2730228924 2728369380 Bacteria 3620317
464 2747955598 2747842429 Bacteria 3914386
465 2753301043 2751185788 Bacteria 4541048
466 2774384032 2773857759 Bacteria 2963774
467 2774398944 2773857763 Bacteria 4180068
468 2791910686 2791354901 Bacteria 8322202
469 2808901398 2808606372 Bacteria 4649509
470 2809227841 2808606447 Bacteria 3572005
471 2812323787 2811994872 Bacteria 4121241
472 2821270483 2821268502 Bacteria 3750023
473 2833711469 2833709550 Bacteria 4008291
474 2844855988 2844852863 Bacteria 3849151
475 2852644792 2852643534 Bacteria 3013378
476 2852646655 2852646457 Bacteria 3408613
477 2852664495 2852663356 Bacteria 4090475
478 2852678894 2852677369 Bacteria 3768884
479 2857734076 2857733635 Bacteria 3532004
480 2857738371 2857737099 Bacteria 3104305
481 2862995135 2862993130 Bacteria 3860849
482 2870622638 2870622029 Bacteria 3643329
483 2870630822 2870628048 Bacteria 3696012
484 2891327652 2891326441 Bacteria 6439512
485 2895663578 2895660088 Bacteria 3782833
486 2897562811 2897561785 Bacteria 3256946
487 2904431055 2904430863 Bacteria 3486923
488 2904503433 2904501621 Bacteria 3401437
489 2908675071 2908674828 Bacteria 3382763
490 2909075603 2909074476 Bacteria 3436050
491 2919039760 2919039151 Bacteria 3391018
492 2919044912 2919042368 Bacteria 3905917
493 2919446911 2919443155 Bacteria 4072969
494 2928106403 2928104781 Bacteria 3877447
495 2928503068 2928500415 Bacteria 3384541
496 2935410874 2935409751 Bacteria 4179611
497 2939658966 2939657138 Bacteria 3740283
498 2939663035 2939660829 Bacteria 3784848
499 2945971069 2945968032 Bacteria 4111363
500 2964328853 2964326757 Bacteria 3290868
501 2966924109 2966921586 Bacteria 3092803
502 2966925675 2966924647 Bacteria 3268643
503 2984553214 2984551494 Bacteria 3877562
504 2995727420 2995726249 Bacteria 3470435
505 8002813777 8002811521 Bacteria 2942897
506 8004183757 8004182704 Bacteria 3391155
507 8004213660 8004212874 Bacteria 2861420
508 8046353464 8046352972 Bacteria 3613806
509 8055035425 8055034563 Bacteria 3562128
510 8055040992 8055037949 Bacteria 3337834
511 8056039866 8056037122 Bacteria 3854319
512 8057348223 8057345674 Bacteria 4160394
513 Ga0207683_10233179
514 Ga0065714_10065949
515 Ga0065714_10087820
516 Ga0070658_10000034
517 Ga0070658_10020948
518 Ga0070668_100227459
519 Ga0070659_100204072
520 Ga0070667_100013678
521 Ga0070714_100002647
522 Ga0070705_100071121
523 Ga0070708_100039351
524 Ga0070708_100069929
525 Ga0070708_100119374
526 Ga0070663_100142751
527 Ga0070706_100078295
528 Ga0070707_100019128
529 Ga0070707_100105167
530 Ga0070698_100017754
531 Ga0070698_100036309
532 Ga0070699_100002561
533 Ga0068853_100083251
534 Ga0070695_100059221
535 Ga0070696_100126408
536 Ga0070704_100032946
537 Ga0068855_100161941
538 Ga0070664_100018724
539 Ga0068852_100009144
540 Ga0068852_100069440
541 Ga0068851_10000043
542 Ga0068863_100069262
543 Ga0068860_100131870
544 Ga0081540_1000923
545 Ga0081539_10000035
546 Ga0081539_10000197
547 Ga0075365_10000454
548 Ga0075365_10016678
549 Ga0075365_10020391
550 Ga0075365_10060665
551 Ga0075363_100009754
552 Ga0075364_10008851
553 Ga0075364_10030231
554 Ga0075364_10127514
555 Ga0070716_100053488
556 Ga0075369_10052294
557 Ga0097621_100117528
558 Ga0075428_100008929
559 Ga0075428_100078482
560 Ga0075428_100105257
561 Ga0075430_100000188
562 Ga0075430_100023183
563 Ga0075430_100026190
564 Ga0075431_100001027
565 Ga0075431_100004984
566 Ga0075431_100009995
567 Ga0075431_100015725
568 Ga0075433_10001588
569 Ga0075433_10039995
570 Ga0075433_10146299
571 Ga0075434_100002424
572 Ga0075429_100003331
573 Ga0075429_100003527
574 Ga0075429_100009623
575 Ga0075429_100012902
576 Ga0075429_100013330
577 Ga0114129_10001436
578 Ga0114129_10003403
579 Ga0114129_10003532
580 Ga0114129_10008300
581 Ga0114129_10011771
582 Ga0114129_10013576
583 Ga0114129_10047347
584 Ga0114129_10099087
585 Ga0114129_10110804
586 Ga0114129_10126087
587 Ga0105241_10114054
588 Ga0105248_10005013
589 Ga0105237_10000164
590 Ga0105238_10057186
591 Ga0105033_101157
592 Ga0105239_10221098
593 Ga0157371_10002292
594 Ga0157370_10104055
595 Ga0157369_10017265
596 Ga0171462_1004
597 Ga0157374_10241258
598 Ga0163162_10038951
599 Ga0163163_10021995
600 Ga0157380_10028306
601 Ga0213875_10000926
602 Ga0213875_10065250
603 Ga0209646_1000092
604 Ga0209148_1000962
605 Ga0207656_10000001
606 Ga0207656_10000003
607 Ga0207656_10000004
608 Ga0207653_10021159
609 Ga0207705_10000001
610 Ga0207684_10019898
611 Ga0207684_10251343
612 Ga0207671_10000001
613 Ga0207663_10003760
614 Ga0207657_10075430
615 Ga0207652_10159217
616 Ga0207646_10009021
617 Ga0207646_10068912
618 Ga0207664_10005950
619 Ga0207690_10085275
620 Ga0207689_10066036
621 Ga0207712_10096886
622 Ga0207668_10167264
623 Ga0207658_10006749
624 Ga0207639_10086795
625 Ga0207702_10077950
626 Ga0207674_10016730
627 Ga0207675_100105901
628 Ga0207683_10004653
629 Ga0207698_10001313
630 Ga0207698_10006931
631 Ga0209974_10023451
632 Ga0268265_10289375
633 Ga0307511_10055824
634 Ga0307511_10077709
635 Ga0307413_10003332
636 Ga0307410_10065597
637 Ga0307406_10000065
638 Ga0307406_10000710
639 Ga0307406_10011403
640 Ga0307409_100051016
641 Ga0307414_10038218
642 Ga0307414_10208984
643 Ga0307411_10033219
644 Ga0373944_0001400
645 Ga0373936_0000325
646 Ga0373936_0006402
647 Ga0373945_0000021
648 Ga0373953_0028841
649 Ga0373957_0019059
650 Ga0373943_0000066
651 Ga0373946_0000019
652 Ga0373946_0002528
653 Ga0373955_0010072
654 Ga0373942_0014070
655 Ga0373924_0001872
656 Ga0373931_0107573
657 Ga0373935_0019601
658 Ga0373927_0000402
659 Ga0373933_0145094
660 Ga0373947_0000197
661 Ga0373925_0076337
662 Ga0395900_0015428
663 Ga0395900_0037868
664 Ga0395900_0042324
665 Ga0395898_0009429
666 Ga0395898_0368554
667 Ga0436364_0010465
668 Ga0436364_0434761
669 Ga0395901_0001485
670 Ga0400489_71485
671 Ga0436363_0453941
672 Ga0436362_0781133
673 Ga0451793_0385801
674 Ga0466969_0003914
675 Ga0466969_0007440
676 Ga0466972_0070262
677 Ga0466965_0000001
678 Ga0466966_0000471
679 Ga0466961_0001627
680 Ga0466963_0147091
681 Ga0466970_0000462
682 Ga0466970_0005631
683 Ga0466970_0016661
684 Ga0466970_0076040
685 Ga0466960_0033699
686 Ga0466959_0020094
687 Ga0466967_0011950
688 Ga0495592_0024647
689 Ga0495592_0212476
690 Ga0495603_0004676
691 Ga0495629_0024652
692 Ga0495641_0001922
693 Ga0495641_0009403
694 Ga0495653_0000497
695 Ga0495653_0049288
696 Ga0495580_0099627
697 Ga0495639_0005638
698 Ga0495662_0030540
699 Ga0495664_0000137
700 Ga0495664_0049047
701 Ga0495664_0132512
702 Ga0495618_0032308
703 Ga0495628_0079320
704 Ga0495628_0158399
705 Ga0495630_0000968
706 Ga0495630_0095184
707 Ga0495666_0003416
708 Ga0495652_0100102
709 Ga0495665_0000799
710 Ga0495665_0031651
711 Ga0495640_0010218
712 Ga0495587_0056002
713 Ga0495645_0024162
714 Ga0495667_0001672
715 Ga0495667_0005458
716 Ga0495667_0009517
717 Ga0495634_0011708
718 Ga0495625_0100097
719 Ga0495635_0000528
720 Ga0495635_0013930
721 Ga0495635_0109042
722 Ga0495588_0009870
723 Ga0495657_0014553
724 Ga0495599_0021203
725 Ga0495599_0108731
726 Ga0495623_0069895
727 Ga0495647_0057561
728 Ga0495613_0008444
729 Ga0495624_0001683
730 Ga0495624_0005789
731 Ga0495600_0134009
732 Ga0495581_0008826
733 Ga0495604_0038242
734 Ga0495604_0221815
735 Ga0495674_0000418
736 Ga0495672_0008618
737 Ga0495672_0012245
738 Ga0495676_0003221
739 Ga0495676_0050195
740 Ga0495680_0042342
741 Ga0495675_0010697
742 Ga0495684_0002229
743 Ga0495686_0116246
744 Ga0495593_0049427
745 Ga0495614_0003807
746 Ga0496100_0110498
747 Ga0496101_0167097
748 Ga0496102_0057386
749 Ga0496102_0164062
750 Ga0496102_0350596
751 Ga0496103_0080420
752 Ga0496104_0040497
753 Ga0496107_0019378
754 Ga0496109_0053828
755 Ga0496111_0052122
756 Ga0496112_0218836
757 Ga0496113_0022152
758 Ga0496115_0003169
759 Ga0496115_0038063
760 Ga0496115_0157996
761 Ga0496116_0019524
762 Ga0496117_0000561
763 Ga0496117_0001610
764 Ga0496117_0003206
765 Ga0496117_0014406
766 Ga0496118_0000705
767 Ga0496118_0073763
768 Ga0496119_0000133
769 Ga0496119_0005004
770 Ga0496119_0020407
771 Ga0496119_0026334
772 Ga0496119_0086651
773 Ga0496121_0000098
774 Ga0496122_0000036
775 Ga0496122_0000059
776 Ga0496122_0000650
777 Ga0496122_0017069
778 Ga0496122_0024552
779 Ga0496122_0099106
780 Ga0496123_0000011
781 Ga0496123_0000157
782 Ga0496123_0009441
783 Ga0496123_0031901
784 Ga0496124_0000234
785 Ga0496124_0005221
786 Ga0496124_0077757
787 Ga0496124_0086656
788 Ga0496124_0103602
789 Ga0496125_0000167
790 Ga0496125_0003485
791 Ga0496125_0006360
792 Ga0496125_0076708
793 Ga0496126_0005698
794 Ga0496126_0026458
795 Ga0496126_0154290
796 Ga0496126_0240055
797 Ga0501031_0007993
798 Ga0501032_0012035
799 Ga0501032_0027002
800 Ga0501033_0003524
801 Ga0501033_0017202
802 Ga0501033_0029480
803 Ga0501033_0064923
804 Ga0501034_0001490
805 Ga0501034_0024862
806 Ga0501034_0034308
807 Ga0501034_0051939
808 Ga0501034_0052575
809 Ga0501034_0061080
810 Ga0501034_0063109
811 Ga0501034_0071752
812 Ga0501034_0101170
813 Ga0501034_0207997
814 Ga0501034_0302469
815 Ga0501034_0380597
816 Ga0501036_0004137
817 Ga0501036_0102193
818 Ga0501037_0006256
819 Ga0501037_0019066
820 Ga0501037_0037109
821 Ga0501037_0056838
822 Ga0501037_0127071
823 Ga0501038_0001945
824 Ga0501038_0024414
825 Ga0501038_0024913
826 Ga0501038_0084680
827 Ga0501038_0143383
828 Ga0501038_0232424
829 Ga0501039_0001361
830 Ga0501039_0009373
831 Ga0501041_0107214
832 Ga0501041_0143000
833 Ga0501042_0000417
834 Ga0501042_0005287
835 Ga0501043_0006580
836 Ga0501043_0025434
837 Ga0501043_0029704
838 Ga0501043_0068602
839 Ga0501043_0079071
840 Ga0501043_0084762
841 Ga0501046_0005765
842 Ga0501046_0007719
843 Ga0501046_0010652
844 Ga0501046_0015149
845 Ga0501046_0022195
846 Ga0501047_0003227
847 Ga0501047_0015150
848 Ga0501047_0043756
849 Ga0501047_0058378
850 Ga0501047_0094608
851 Ga0501047_0178993
852 Ga0501048_0007518
853 Ga0501048_0020337
854 Ga0501048_0020438
855 Ga0501048_0022264
856 Ga0501048_0176286
857 Ga0501067_0007738
858 Ga0501068_0055226
859 Ga0501070_0005515
860 Ga0501070_0011739
861 Ga0501071_0196170
862 Ga0501072_0006933
863 Ga0501073_0000038
864 Ga0501073_0040637
865 Ga0501074_0024171
866 Ga0501074_0108564
867 Ga0501075_0000047
868 Ga0501075_0019861
869 Ga0501075_0063881
870 Ga0501076_0001961
871 Ga0501076_0038331
872 Ga0501077_0006078
873 Ga0501077_0017120
874 Ga0501077_0033122
875 Ga0501077_0038584
876 Ga0501079_0018770
877 Ga0501079_0020202
878 Ga0501079_0034227
879 Ga0501079_0058772
880 Ga0501080_0000269
881 Ga0501080_0020614
882 Ga0501080_0024760
883 Ga0501080_0031678
884 Ga0501080_0043799
885 Ga0501080_0123750
886 Ga0501081_0000628
887 Ga0501081_0001365
888 Ga0501081_0026221
889 Ga0501083_0000253
890 Ga0501083_0005771
891 Ga0501083_0009178
892 Ga0501035_0018215
893 Ga0501035_0026623
894 Ga0501035_0052942
895 Ga0501035_0096300
896 Ga0501035_0125819
897 Ga0501044_0002221
898 Ga0501044_0011291
899 Ga0501044_0061351
900 Ga0501044_0073443
901 Ga0501044_0194034
902 Ga0501045_0002868
903 Ga0501045_0045725
904 Ga0501045_0058344
905 Ga0501045_0059638
906 nmdc:mga00v17_91495_c1
907 nmdc:mga00v17_9177_c1
908 nmdc:mga05p37_106386_c1
909 nmdc:mga05p37_194185_c1
910 nmdc:mga05p37_26398_c1
911 nmdc:mga05p37_3838_c1
912 nmdc:mga05p37_4050_c2
913 nmdc:mga05p37_437_c1
914 nmdc:mga05p37_49085_c1
915 nmdc:mga05p37_77408_c1
916 nmdc:mga09592_10756_c1
917 nmdc:mga09592_1358_c1
918 nmdc:mga09592_2110_c1
919 nmdc:mga09592_47093_c1
920 nmdc:mga0qj67_125501_c1
921 nmdc:mga0qj67_15897_c1
922 nmdc:mga0qj67_76040_c1
923 nmdc:mga06r32_15293_c1
924 nmdc:mga06r32_24903_c1
925 nmdc:mga0n895_1394_c1
926 nmdc:mga0n895_147701_c1
927 nmdc:mga0rr50_5727_c1
928 nmdc:mga0a205_14116_c1
929 nmdc:mga0a205_147312_c1
930 nmdc:mga0a205_147844_c1
931 nmdc:mga0a205_48182_c1
932 Ga0500643_000092
933 Ga0500651_0006699
934 Ga0500556_0000169
935 Ga0500556_0000564
936 Ga0500562_001234
937 Ga0500559_0000273
938 Ga0500559_0000742
939 Ga0500559_0003036
940 Ga0500559_0012760
941 Ga0500559_0027635
942 Ga0500568_0000009
943 Ga0500568_0000164
944 Ga0500568_0027853
945 Ga0500573_0000096
946 Ga0500573_0014566
947 Ga0500573_0020566
948 Ga0500577_0048225
949 Ga0500577_0060119
950 Ga0500588_0001066
951 Ga0500616_0000058
952 Ga0500616_0002577
953 Ga0500620_000122
954 Ga0501084_0028387
955 Ga0501084_0254158
956 Ga0501082_0028777
957 Ga0530510_0000001
958 Ga0530510_0052624
959 Ga0530510_0059697
960 2583152416
961 2587864323
962 2643732159
963 2643769790
964 2643785077
965 2643875907
966 2643886041
967 2643995418
968 2644114445
969 2644170966
970 2644198174
971 2644280302
972 2644382962
973 2644679415
974 2723641453
975 2730228924
976 2747955598
977 2753301043
978 2774384032
979 2774398944
980 2791910686
981 2808901398
982 2809227841
983 2812323787
984 2821270483
985 2833711469
986 2844855988
987 2852644792
988 2852646655
989 2852664495
990 2852678894
991 2857734076
992 2857738371
993 2862995135
994 2870622638
995 2870630822
996 2891327652
997 2895663578
998 2897562811
999 2904431055
1000 2904503433
1001 2908675071
1002 2909075603
1003 2919039760
1004 2919044912
1005 2919446911
1006 2928106403
1007 2928503068
1008 2935410874
1009 2939658966
1010 2939663035
1011 2945971069
1012 2964328853
1013 2966924109
1014 2966925675
1015 2984553214
1016 2995727420
1017 8002813777
1018 8004183757
1019 8004213660
1020 8046353464
1021 8055035425
1022 8055040992
1023 8056039866
1024 8057348223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

384

466

0.94

PF13393

tRNA-synt_His

Histidyl-tRNA synthetase

10

321

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4imp-assembly2.cif.gz_D the missing linker: a dimerization motif located within polyketide synthase modules 0.8335 332 388
3vqx-assembly1.cif.gz_A crystal structure of the catalytic domain of pyrrolysyl-trna synthetase in triclinic crystal form 0.8284 12 319
8dqj-assembly1.cif.gz_A crystal structure of pyrrolysyl-trna synthetase from methanomethylophilus alvus engineered for acridone amino acid (ast) bound to atp and acridone 0.8245 12 322
1z7n-assembly1.cif.gz_C atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate 0.8221 1 324
1z7n-assembly1.cif.gz_D atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate 0.8213 1 324
ID Description Score Start End Superfamily
af_Q58406_2_319_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.85 1 319 3.30.930.10
1httD01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8384 1 323 3.30.930.10
3od1B01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8361 2 324 3.30.930.10
af_Q57729_6_171_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8358 334 366 3.40.390.10
1qe0B01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8335 1 324 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A519GC80-F1-model_v4 Histidine--tRNA ligase 0.9418 327 404 GO:0016874
AF-A0A3B8UI62-F1-model_v4 Histidine--tRNA ligase 0.8912 1 198 GO:0005737
GO:0016740
GO:0016874
AF-A0A519GC80-F1-model_v4 Histidine--tRNA ligase 0.8852 327 404 GO:0016874
AF-A0A251XK34-F1-model_v4 Histidyl-tRNA synthetase 0.8828 1 142 GO:0016874
AF-A0A6C1BTH9-F1-model_v4 Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain-containing protein 0.8739 1 321 GO:0004821
GO:0005737
GO:0006427

Map