F457350
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 511 | 237 | 511 | 509 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_154256_c1|nmdc:mga05p37_154256_c1_883_2238 |
| Length | 439 |
| Sequence | MDEQVVPGDGVVAGVGRVDGRPVYAFAQDFTVFGGSLSETNAAKIVKIMDLAVKMGAPVVGLNDSGGARIQEGVLSLGGYADIFLRNTLASGVIPQISAIMGPCAGGAVYSPAITDFIVMVKQSSYMFITGPDVIKTVTHEDVSMEDLGGAMTHNEKSGVAHFAVEDDAECIALIRELLSFMPDNNLDDPPRKATTLVPASPNQPYDMLDLIHTIADEGYFLEVHQHYAKNIVVGFARLGGRPVGVVANQPAHLAGTLDINASVKGARFVRFCDAFNIPLITFEDVPGFLPGTVQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYCVMASKHIRTDFNYAWPSAEIAVMGAEGAVNILYKREIEKSADPAAMRAQKIGEFRDRFASPYVAAERGYIDEVILPRMTRAKLVQALATLDHKRDKNPPKKHGNIPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 156 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 157 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 216 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 217 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 231 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 233 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 234 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 235 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.13 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 93.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10005675 | 3300002459 | Bacteria | 2543 |
| 2 | JGI25406J46586_10007699 | 3300003203 | Bacteria | 4899 |
| 3 | Ga0065712_10001865 | 3300005290 | Bacteria | 12263 |
| 4 | Ga0065712_10068417 | 3300005290 | Bacteria | 10780 |
| 5 | Ga0065712_10068680 | 3300005290 | Bacteria | 9413 |
| 6 | Ga0065712_10077523 | 3300005290 | Bacteria | 3482 |
| 7 | Ga0065712_10079275 | 3300005290 | Bacteria | 3238 |
| 8 | Ga0065712_10089783 | 3300005290 | Bacteria | 2453 |
| 9 | Ga0065712_10104388 | 3300005290 | Bacteria | 1953 |
| 10 | Ga0065715_10099172 | 3300005293 | Bacteria | 3448 |
| 11 | Ga0065715_10101548 | 3300005293 | Bacteria | 3193 |
| 12 | Ga0065715_10107958 | 3300005293 | Bacteria | 2743 |
| 13 | Ga0065707_10001522 | 3300005295 | Bacteria | 8991 |
| 14 | Ga0065707_10002910 | 3300005295 | Bacteria | 9923 |
| 15 | Ga0065707_10097767 | 3300005295 | Bacteria | 3144 |
| 16 | Ga0065707_10105067 | 3300005295 | Bacteria | 2660 |
| 17 | Ga0070676_10010750 | 3300005328 | Bacteria | 4966 |
| 18 | Ga0070670_100011093 | 3300005331 | Bacteria | 7698 |
| 19 | Ga0070670_100014785 | 3300005331 | Bacteria | 6698 |
| 20 | Ga0070670_100017601 | 3300005331 | Bacteria | 6133 |
| 21 | Ga0070670_100023960 | 3300005331 | Bacteria | 5250 |
| 22 | Ga0068869_100000256 | 3300005334 | Bacteria | 28007 |
| 23 | Ga0070666_10136307 | 3300005335 | Bacteria | 1708 |
| 24 | Ga0070660_100013139 | 3300005339 | Bacteria | 5932 |
| 25 | Ga0070689_100007394 | 3300005340 | Bacteria | 7675 |
| 26 | Ga0070689_100071424 | 3300005340 | Bacteria | 2712 |
| 27 | Ga0070689_100133210 | 3300005340 | Bacteria | 1994 |
| 28 | Ga0070691_10012035 | 3300005341 | Bacteria | 3962 |
| 29 | Ga0070687_100028003 | 3300005343 | Bacteria | 2728 |
| 30 | Ga0070669_100002881 | 3300005353 | Bacteria | 12405 |
| 31 | Ga0070669_100079022 | 3300005353 | Bacteria | 2446 |
| 32 | Ga0070675_100000311 | 3300005354 | Bacteria | 32685 |
| 33 | Ga0070675_100002200 | 3300005354 | Bacteria | 14456 |
| 34 | Ga0070675_100002452 | 3300005354 | Bacteria | 13868 |
| 35 | Ga0070675_100007377 | 3300005354 | Bacteria | 8493 |
| 36 | Ga0070674_100000735 | 3300005356 | Bacteria | 16733 |
| 37 | Ga0070674_100001848 | 3300005356 | Bacteria | 11486 |
| 38 | Ga0070674_100002130 | 3300005356 | Bacteria | 10872 |
| 39 | Ga0070674_100131485 | 3300005356 | Bacteria | 1866 |
| 40 | Ga0070673_100018890 | 3300005364 | Bacteria | 4940 |
| 41 | Ga0070673_100172743 | 3300005364 | Bacteria | 1845 |
| 42 | Ga0070688_100006975 | 3300005365 | Bacteria | 6071 |
| 43 | Ga0070659_100010629 | 3300005366 | Bacteria | 6778 |
| 44 | Ga0070667_100028989 | 3300005367 | Bacteria | 4609 |
| 45 | Ga0070667_100095032 | 3300005367 | Bacteria | 2569 |
| 46 | Ga0070714_100005034 | 3300005435 | Bacteria | 10049 |
| 47 | Ga0070701_10003990 | 3300005438 | Bacteria | 5910 |
| 48 | Ga0070705_100079626 | 3300005440 | Bacteria | 2007 |
| 49 | Ga0070708_100000002 | 3300005445 | Bacteria | 195857 |
| 50 | Ga0070678_100020951 | 3300005456 | Bacteria | 4300 |
| 51 | Ga0070678_100024033 | 3300005456 | Bacteria | 4072 |
| 52 | Ga0070678_100030823 | 3300005456 | Bacteria | 3691 |
| 53 | Ga0070662_100073925 | 3300005457 | Bacteria | 2520 |
| 54 | Ga0070681_10019926 | 3300005458 | Bacteria | 6720 |
| 55 | Ga0070681_10067199 | 3300005458 | Bacteria | 3553 |
| 56 | Ga0068867_100011691 | 3300005459 | Bacteria | 6198 |
| 57 | Ga0070706_100091154 | 3300005467 | Bacteria | 2827 |
| 58 | Ga0070698_100001813 | 3300005471 | Bacteria | 23753 |
| 59 | Ga0070698_100002188 | 3300005471 | Bacteria | 21703 |
| 60 | Ga0070698_100006892 | 3300005471 | Bacteria | 12313 |
| 61 | Ga0070698_100018706 | 3300005471 | Bacteria | 7293 |
| 62 | Ga0070698_100136158 | 3300005471 | Bacteria | 2410 |
| 63 | Ga0070698_100153230 | 3300005471 | Bacteria | 2251 |
| 64 | Ga0070699_100000980 | 3300005518 | Bacteria | 26618 |
| 65 | Ga0070699_100001754 | 3300005518 | Bacteria | 19774 |
| 66 | Ga0070699_100004768 | 3300005518 | Bacteria | 11989 |
| 67 | Ga0070684_100015248 | 3300005535 | Bacteria | 6252 |
| 68 | Ga0070684_100024056 | 3300005535 | Bacteria | 5106 |
| 69 | Ga0070684_100075794 | 3300005535 | Bacteria | 2968 |
| 70 | Ga0070697_100027184 | 3300005536 | Bacteria | 4575 |
| 71 | Ga0070697_100078283 | 3300005536 | Bacteria | 2720 |
| 72 | Ga0070672_100015797 | 3300005543 | Bacteria | 5390 |
| 73 | Ga0070672_100030420 | 3300005543 | Bacteria | 4056 |
| 74 | Ga0070686_100004936 | 3300005544 | Bacteria | 7355 |
| 75 | Ga0070686_100028383 | 3300005544 | Bacteria | 3394 |
| 76 | Ga0070686_100066538 | 3300005544 | Bacteria | 2344 |
| 77 | Ga0070686_100138756 | 3300005544 | Bacteria | 1690 |
| 78 | Ga0070695_100031758 | 3300005545 | Bacteria | 3297 |
| 79 | Ga0070696_100060492 | 3300005546 | Bacteria | 2648 |
| 80 | Ga0070693_100021406 | 3300005547 | Bacteria | 3425 |
| 81 | Ga0070665_100001061 | 3300005548 | Bacteria | 34294 |
| 82 | Ga0070665_100112265 | 3300005548 | Bacteria | 2728 |
| 83 | Ga0070704_100003231 | 3300005549 | Bacteria | 9316 |
| 84 | Ga0070704_100036021 | 3300005549 | Bacteria | 3367 |
| 85 | Ga0068855_100040709 | 3300005563 | Bacteria | 5513 |
| 86 | Ga0070664_100000832 | 3300005564 | Bacteria | 23806 |
| 87 | Ga0070664_100031404 | 3300005564 | Bacteria | 4438 |
| 88 | Ga0070664_100048400 | 3300005564 | Bacteria | 3593 |
| 89 | Ga0070664_100155113 | 3300005564 | Bacteria | 2023 |
| 90 | Ga0068857_100029433 | 3300005577 | Bacteria | 4847 |
| 91 | Ga0068854_100002437 | 3300005578 | Bacteria | 11500 |
| 92 | Ga0068854_100006157 | 3300005578 | Bacteria | 7616 |
| 93 | Ga0070702_100050355 | 3300005615 | Bacteria | 2379 |
| 94 | Ga0068859_100013874 | 3300005617 | Bacteria | 8081 |
| 95 | Ga0068859_100018112 | 3300005617 | Bacteria | 7079 |
| 96 | Ga0068859_100029054 | 3300005617 | Bacteria | 5547 |
| 97 | Ga0068864_100009517 | 3300005618 | Bacteria | 8019 |
| 98 | Ga0068864_100030550 | 3300005618 | Bacteria | 4567 |
| 99 | Ga0068866_10002372 | 3300005718 | Bacteria | 7813 |
| 100 | Ga0068861_100028062 | 3300005719 | Bacteria | 4105 |
| 101 | Ga0068861_100161312 | 3300005719 | Bacteria | 1850 |
| 102 | Ga0068851_10008332 | 3300005834 | Bacteria | 4793 |
| 103 | Ga0068863_100031041 | 3300005841 | Bacteria | 5102 |
| 104 | Ga0068863_100044292 | 3300005841 | Bacteria | 4225 |
| 105 | Ga0068863_100067747 | 3300005841 | Bacteria | 3377 |
| 106 | Ga0068858_100006773 | 3300005842 | Bacteria | 11149 |
| 107 | Ga0068858_100132773 | 3300005842 | Bacteria | 2335 |
| 108 | Ga0068860_100064216 | 3300005843 | Bacteria | 3487 |
| 109 | Ga0068862_100044485 | 3300005844 | Bacteria | 3787 |
| 110 | Ga0068862_100048217 | 3300005844 | Bacteria | 3636 |
| 111 | Ga0081539_10000110 | 3300005985 | Bacteria | 190555 |
| 112 | Ga0075365_10011620 | 3300006038 | Bacteria | 5187 |
| 113 | Ga0075365_10044558 | 3300006038 | Bacteria | 2908 |
| 114 | Ga0075368_10032959 | 3300006042 | Bacteria | 2014 |
| 115 | Ga0075362_10001435 | 3300006177 | Bacteria | 7610 |
| 116 | Ga0075367_10001698 | 3300006178 | Bacteria | 9630 |
| 117 | Ga0075366_10045956 | 3300006195 | Bacteria | 2587 |
| 118 | Ga0097621_100016903 | 3300006237 | Bacteria | 5530 |
| 119 | Ga0068871_100001984 | 3300006358 | Bacteria | 13869 |
| 120 | Ga0068871_100132725 | 3300006358 | Bacteria | 2112 |
| 121 | Ga0075428_100000030 | 3300006844 | Bacteria | 119551 |
| 122 | Ga0075428_100000673 | 3300006844 | Bacteria | 35072 |
| 123 | Ga0075428_100000931 | 3300006844 | Bacteria | 30952 |
| 124 | Ga0075428_100006014 | 3300006844 | Bacteria | 13480 |
| 125 | Ga0075428_100008375 | 3300006844 | Bacteria | 11464 |
| 126 | Ga0075428_100008632 | 3300006844 | Bacteria | 11301 |
| 127 | Ga0075428_100026750 | 3300006844 | Bacteria | 6388 |
| 128 | Ga0075428_100038724 | 3300006844 | Bacteria | 5246 |
| 129 | Ga0075428_100112270 | 3300006844 | Bacteria | 2968 |
| 130 | Ga0075430_100000398 | 3300006846 | Bacteria | 32154 |
| 131 | Ga0075430_100002425 | 3300006846 | Bacteria | 15524 |
| 132 | Ga0075430_100009976 | 3300006846 | Bacteria | 8035 |
| 133 | Ga0075431_100001977 | 3300006847 | Bacteria | 19558 |
| 134 | Ga0075431_100012354 | 3300006847 | Bacteria | 8618 |
| 135 | Ga0075431_100016547 | 3300006847 | Bacteria | 7485 |
| 136 | Ga0075431_100018355 | 3300006847 | Bacteria | 7123 |
| 137 | Ga0075431_100112615 | 3300006847 | Bacteria | 2808 |
| 138 | Ga0075433_10044987 | 3300006852 | Bacteria | 3836 |
| 139 | Ga0075434_100002491 | 3300006871 | Bacteria | 16225 |
| 140 | Ga0075434_100003288 | 3300006871 | Bacteria | 14448 |
| 141 | Ga0075434_100108317 | 3300006871 | Bacteria | 2789 |
| 142 | Ga0075429_100004255 | 3300006880 | Bacteria | 12272 |
| 143 | Ga0075429_100005123 | 3300006880 | Bacteria | 11271 |
| 144 | Ga0075429_100006190 | 3300006880 | Bacteria | 10349 |
| 145 | Ga0075429_100030035 | 3300006880 | Bacteria | 4721 |
| 146 | Ga0068865_100073067 | 3300006881 | Bacteria | 2438 |
| 147 | Ga0075436_100002164 | 3300006914 | Bacteria | 13538 |
| 148 | Ga0075436_100038228 | 3300006914 | Bacteria | 3312 |
| 149 | Ga0097620_100013874 | 3300006931 | Bacteria | 8081 |
| 150 | Ga0097620_100018112 | 3300006931 | Bacteria | 7079 |
| 151 | Ga0097620_100029055 | 3300006931 | Bacteria | 5547 |
| 152 | Ga0075435_100000034 | 3300007076 | Bacteria | 70048 |
| 153 | Ga0075435_100000542 | 3300007076 | Bacteria | 23134 |
| 154 | Ga0075435_100012725 | 3300007076 | Bacteria | 6234 |
| 155 | Ga0075435_100030226 | 3300007076 | Bacteria | 4257 |
| 156 | Ga0075435_100039586 | 3300007076 | Bacteria | 3762 |
| 157 | Ga0075435_100106714 | 3300007076 | Bacteria | 2326 |
| 158 | Ga0111539_10000015 | 3300009094 | Bacteria | 296576 |
| 159 | Ga0111539_10000174 | 3300009094 | Bacteria | 74442 |
| 160 | Ga0111539_10000657 | 3300009094 | Bacteria | 44621 |
| 161 | Ga0111539_10002052 | 3300009094 | Bacteria | 26949 |
| 162 | Ga0111539_10002159 | 3300009094 | Bacteria | 26325 |
| 163 | Ga0111539_10042646 | 3300009094 | Bacteria | 5446 |
| 164 | Ga0111539_10108842 | 3300009094 | Bacteria | 3252 |
| 165 | Ga0111539_10116685 | 3300009094 | Bacteria | 3130 |
| 166 | Ga0105245_10043479 | 3300009098 | Bacteria | 4007 |
| 167 | Ga0105245_10147065 | 3300009098 | Bacteria | 2224 |
| 168 | Ga0114129_10000288 | 3300009147 | Bacteria | 58119 |
| 169 | Ga0114129_10000581 | 3300009147 | Bacteria | 45128 |
| 170 | Ga0114129_10001174 | 3300009147 | Bacteria | 34722 |
| 171 | Ga0114129_10006497 | 3300009147 | Bacteria | 16580 |
| 172 | Ga0114129_10058684 | 3300009147 | Bacteria | 5382 |
| 173 | Ga0114129_10095275 | 3300009147 | Bacteria | 4122 |
| 174 | Ga0105243_10013558 | 3300009148 | Bacteria | 6166 |
| 175 | Ga0105243_10049415 | 3300009148 | Bacteria | 3318 |
| 176 | Ga0105242_10006802 | 3300009176 | Bacteria | 8818 |
| 177 | Ga0105242_10007503 | 3300009176 | Bacteria | 8391 |
| 178 | Ga0105248_10019397 | 3300009177 | Bacteria | 7523 |
| 179 | Ga0105248_10143370 | 3300009177 | Bacteria | 2695 |
| 180 | Ga0105237_10081662 | 3300009545 | Bacteria | 3223 |
| 181 | Ga0105238_10002716 | 3300009551 | Bacteria | 17617 |
| 182 | Ga0105249_10001257 | 3300009553 | Bacteria | 22240 |
| 183 | Ga0105249_10052897 | 3300009553 | Bacteria | 3710 |
| 184 | Ga0157374_10087859 | 3300013296 | Bacteria | 2960 |
| 185 | Ga0163162_10024574 | 3300013306 | Bacteria | 5950 |
| 186 | Ga0163163_10000005 | 3300014325 | Bacteria | 369548 |
| 187 | Ga0163163_10015247 | 3300014325 | Bacteria | 7100 |
| 188 | Ga0163163_10033344 | 3300014325 | Bacteria | 4981 |
| 189 | Ga0163163_10041293 | 3300014325 | Bacteria | 4510 |
| 190 | Ga0157380_10000415 | 3300014326 | Bacteria | 25998 |
| 191 | Ga0157380_10000549 | 3300014326 | Bacteria | 23122 |
| 192 | Ga0157380_10031476 | 3300014326 | Bacteria | 4073 |
| 193 | Ga0157380_10040295 | 3300014326 | Bacteria | 3637 |
| 194 | Ga0157380_10081845 | 3300014326 | Bacteria | 2642 |
| 195 | Ga0157377_10058027 | 3300014745 | Bacteria | 2203 |
| 196 | Ga0157376_10074275 | 3300014969 | Bacteria | 2898 |
| 197 | Ga0206356_11870653 | 3300020070 | Bacteria | 1974 |
| 198 | Ga0207697_10008950 | 3300025315 | Bacteria | 4349 |
| 199 | Ga0207656_10005665 | 3300025321 | Bacteria | 4435 |
| 200 | Ga0207682_10013055 | 3300025893 | Bacteria | 3239 |
| 201 | Ga0207682_10024964 | 3300025893 | Bacteria | 2369 |
| 202 | Ga0207642_10004075 | 3300025899 | Bacteria | 4681 |
| 203 | Ga0207688_10016857 | 3300025901 | Bacteria | 3967 |
| 204 | Ga0207680_10037340 | 3300025903 | Bacteria | 2804 |
| 205 | Ga0207645_10005378 | 3300025907 | Bacteria | 9299 |
| 206 | Ga0207684_10008593 | 3300025910 | Bacteria | 9079 |
| 207 | Ga0207684_10067468 | 3300025910 | Bacteria | 3040 |
| 208 | Ga0207707_10016097 | 3300025912 | Bacteria | 6521 |
| 209 | Ga0207707_10029951 | 3300025912 | Bacteria | 4759 |
| 210 | Ga0207707_10055167 | 3300025912 | Bacteria | 3457 |
| 211 | Ga0207695_10141094 | 3300025913 | Bacteria | 2358 |
| 212 | Ga0207671_10068672 | 3300025914 | Bacteria | 2641 |
| 213 | Ga0207662_10003753 | 3300025918 | Bacteria | 7875 |
| 214 | Ga0207657_10008592 | 3300025919 | Bacteria | 10343 |
| 215 | Ga0207652_10021929 | 3300025921 | Bacteria | 5277 |
| 216 | Ga0207646_10092831 | 3300025922 | Bacteria | 2702 |
| 217 | Ga0207681_10062183 | 3300025923 | Bacteria | 2569 |
| 218 | Ga0207681_10104325 | 3300025923 | Bacteria | 2050 |
| 219 | Ga0207694_10004377 | 3300025924 | Bacteria | 11026 |
| 220 | Ga0207694_10165195 | 3300025924 | Bacteria | 1790 |
| 221 | Ga0207650_10011044 | 3300025925 | Bacteria | 6210 |
| 222 | Ga0207650_10097992 | 3300025925 | Bacteria | 2252 |
| 223 | Ga0207659_10000975 | 3300025926 | Bacteria | 17069 |
| 224 | Ga0207659_10008248 | 3300025926 | Bacteria | 6456 |
| 225 | Ga0207659_10013544 | 3300025926 | Bacteria | 5228 |
| 226 | Ga0207659_10020371 | 3300025926 | Bacteria | 4383 |
| 227 | Ga0207659_10059162 | 3300025926 | Bacteria | 2753 |
| 228 | Ga0207687_10039424 | 3300025927 | Bacteria | 3234 |
| 229 | Ga0207687_10068596 | 3300025927 | Bacteria | 2526 |
| 230 | Ga0207644_10021961 | 3300025931 | Bacteria | 4354 |
| 231 | Ga0207644_10023772 | 3300025931 | Bacteria | 4201 |
| 232 | Ga0207690_10057404 | 3300025932 | Bacteria | 2630 |
| 233 | Ga0207686_10002593 | 3300025934 | Bacteria | 9810 |
| 234 | Ga0207686_10006503 | 3300025934 | Bacteria | 6292 |
| 235 | Ga0207686_10018478 | 3300025934 | Bacteria | 3948 |
| 236 | Ga0207709_10007528 | 3300025935 | Bacteria | 6052 |
| 237 | Ga0207709_10022240 | 3300025935 | Bacteria | 3595 |
| 238 | Ga0207670_10009719 | 3300025936 | Bacteria | 5505 |
| 239 | Ga0207670_10051061 | 3300025936 | Bacteria | 2775 |
| 240 | Ga0207669_10000576 | 3300025937 | Bacteria | 15967 |
| 241 | Ga0207669_10020315 | 3300025937 | Bacteria | 3480 |
| 242 | Ga0207704_10008141 | 3300025938 | Bacteria | 4993 |
| 243 | Ga0207704_10010027 | 3300025938 | Bacteria | 4599 |
| 244 | Ga0207704_10061764 | 3300025938 | Bacteria | 2326 |
| 245 | Ga0207691_10004280 | 3300025940 | Bacteria | 13865 |
| 246 | Ga0207691_10005737 | 3300025940 | Bacteria | 12008 |
| 247 | Ga0207691_10035559 | 3300025940 | Bacteria | 4622 |
| 248 | Ga0207691_10078308 | 3300025940 | Bacteria | 2976 |
| 249 | Ga0207711_10113018 | 3300025941 | Bacteria | 2418 |
| 250 | Ga0207689_10000674 | 3300025942 | Bacteria | 32586 |
| 251 | Ga0207689_10071885 | 3300025942 | Bacteria | 2842 |
| 252 | Ga0207689_10085545 | 3300025942 | Bacteria | 2592 |
| 253 | Ga0207689_10119829 | 3300025942 | Bacteria | 2165 |
| 254 | Ga0207661_10102254 | 3300025944 | Bacteria | 2409 |
| 255 | Ga0207679_10025199 | 3300025945 | Bacteria | 4088 |
| 256 | Ga0207679_10034123 | 3300025945 | Bacteria | 3587 |
| 257 | Ga0207667_10056520 | 3300025949 | Bacteria | 4122 |
| 258 | Ga0207651_10015926 | 3300025960 | Bacteria | 4387 |
| 259 | Ga0207651_10030871 | 3300025960 | Bacteria | 3418 |
| 260 | Ga0207712_10004150 | 3300025961 | Bacteria | 9149 |
| 261 | Ga0207640_10007641 | 3300025981 | Bacteria | 5971 |
| 262 | Ga0207658_10028480 | 3300025986 | Bacteria | 3934 |
| 263 | Ga0207703_10159847 | 3300026035 | Bacteria | 1972 |
| 264 | Ga0207678_10012995 | 3300026067 | Bacteria | 7306 |
| 265 | Ga0207678_10045519 | 3300026067 | Bacteria | 3794 |
| 266 | Ga0207708_10001495 | 3300026075 | Bacteria | 17422 |
| 267 | Ga0207708_10006720 | 3300026075 | Bacteria | 8509 |
| 268 | Ga0207708_10014468 | 3300026075 | Bacteria | 5906 |
| 269 | Ga0207708_10069070 | 3300026075 | Bacteria | 2705 |
| 270 | Ga0207641_10183273 | 3300026088 | Bacteria | 1919 |
| 271 | Ga0207648_10001691 | 3300026089 | Bacteria | 24165 |
| 272 | Ga0207676_10102496 | 3300026095 | Bacteria | 2376 |
| 273 | Ga0207675_100025629 | 3300026118 | Bacteria | 5488 |
| 274 | Ga0207675_100044351 | 3300026118 | Bacteria | 4155 |
| 275 | Ga0207675_100093292 | 3300026118 | Bacteria | 2831 |
| 276 | Ga0207683_10018524 | 3300026121 | Bacteria | 5942 |
| 277 | Ga0207683_10022945 | 3300026121 | Bacteria | 5364 |
| 278 | Ga0207683_10046565 | 3300026121 | Bacteria | 3796 |
| 279 | Ga0207683_10089956 | 3300026121 | Bacteria | 2733 |
| 280 | Ga0207683_10112448 | 3300026121 | Bacteria | 2439 |
| 281 | Ga0207683_10135021 | 3300026121 | Bacteria | 2221 |
| 282 | Ga0207428_10000048 | 3300027907 | Bacteria | 180760 |
| 283 | Ga0207428_10001403 | 3300027907 | Bacteria | 25443 |
| 284 | Ga0207428_10002183 | 3300027907 | Bacteria | 19663 |
| 285 | Ga0207428_10015984 | 3300027907 | Bacteria | 6470 |
| 286 | Ga0268266_10002445 | 3300028379 | Bacteria | 19927 |
| 287 | Ga0268266_10098920 | 3300028379 | Bacteria | 2567 |
| 288 | Ga0268266_10235430 | 3300028379 | Bacteria | 1688 |
| 289 | Ga0268264_10011433 | 3300028381 | Bacteria | 7331 |
| 290 | Ga0307513_10009939 | 3300031456 | Bacteria | 11999 |
| 291 | Ga0307408_100005017 | 3300031548 | Bacteria | 8878 |
| 292 | Ga0307408_100009904 | 3300031548 | Bacteria | 6279 |
| 293 | Ga0307408_100024339 | 3300031548 | Bacteria | 4133 |
| 294 | Ga0307408_100048717 | 3300031548 | Bacteria | 3040 |
| 295 | Ga0307405_10073182 | 3300031731 | Bacteria | 2211 |
| 296 | Ga0307413_10008047 | 3300031824 | Bacteria | 4947 |
| 297 | Ga0307413_10024351 | 3300031824 | Bacteria | 3299 |
| 298 | Ga0307410_10009285 | 3300031852 | Bacteria | 5509 |
| 299 | Ga0307410_10036675 | 3300031852 | Bacteria | 3195 |
| 300 | Ga0307410_10082640 | 3300031852 | Bacteria | 2260 |
| 301 | Ga0307407_10021381 | 3300031903 | Bacteria | 3335 |
| 302 | Ga0307407_10039358 | 3300031903 | Bacteria | 2629 |
| 303 | Ga0307412_10012962 | 3300031911 | Bacteria | 4874 |
| 304 | Ga0307412_10048355 | 3300031911 | Bacteria | 2797 |
| 305 | Ga0307409_100000402 | 3300031995 | Bacteria | 18423 |
| 306 | Ga0307409_100020749 | 3300031995 | Bacteria | 4486 |
| 307 | Ga0307409_100045657 | 3300031995 | Bacteria | 3309 |
| 308 | Ga0307409_100056397 | 3300031995 | Bacteria | 3038 |
| 309 | Ga0307409_100242837 | 3300031995 | Bacteria | 1641 |
| 310 | Ga0307416_100038785 | 3300032002 | Bacteria | 3679 |
| 311 | Ga0307416_100041405 | 3300032002 | Bacteria | 3587 |
| 312 | Ga0307416_100044313 | 3300032002 | Bacteria | 3492 |
| 313 | Ga0307416_100060127 | 3300032002 | Bacteria | 3092 |
| 314 | Ga0307416_100079312 | 3300032002 | Bacteria | 2766 |
| 315 | Ga0307416_100097160 | 3300032002 | Bacteria | 2550 |
| 316 | Ga0307416_100119525 | 3300032002 | Bacteria | 2344 |
| 317 | Ga0307411_10008127 | 3300032005 | Bacteria | 5411 |
| 318 | Ga0307411_10028199 | 3300032005 | Bacteria | 3410 |
| 319 | Ga0307411_10046951 | 3300032005 | Bacteria | 2788 |
| 320 | Ga0307415_100009010 | 3300032126 | Bacteria | 5566 |
| 321 | Ga0373934_0000606 | 3300035086 | Bacteria | 12643 |
| 322 | Ga0373941_0001687 | 3300035115 | Bacteria | 4729 |
| 323 | Ga0373956_0003542 | 3300035119 | Bacteria | 6293 |
| 324 | Ga0373955_0003243 | 3300035172 | Bacteria | 7126 |
| 325 | Ga0373935_0087192 | 3300035692 | Bacteria | 2038 |
| 326 | Ga0373937_0000387 | 3300036401 | Bacteria | 41007 |
| 327 | Ga0373925_0006974 | 3300037068 | Bacteria | 8262 |
| 328 | Ga0439446_0019092 | 3300042156 | Bacteria | 1926 |
| 329 | Ga0439434_0006671 | 3300042435 | Bacteria | 3373 |
| 330 | Ga0439464_0030765 | 3300042439 | Bacteria | 1504 |
| 331 | Ga0451576_0003740 | 3300045051 | Bacteria | 20566 |
| 332 | Ga0451576_0009851 | 3300045051 | Bacteria | 11041 |
| 333 | Ga0451576_0049993 | 3300045051 | Bacteria | 4386 |
| 334 | Ga0451576_0053012 | 3300045051 | Bacteria | 4250 |
| 335 | Ga0451576_0106536 | 3300045051 | Bacteria | 2917 |
| 336 | Ga0495603_0011818 | 3300046455 | Bacteria | 5284 |
| 337 | Ga0495629_0008227 | 3300046459 | Bacteria | 7668 |
| 338 | Ga0495584_0033012 | 3300046491 | Bacteria | 2618 |
| 339 | Ga0495594_0006783 | 3300046499 | Bacteria | 5888 |
| 340 | Ga0495628_0072683 | 3300046516 | Bacteria | 2680 |
| 341 | Ga0495643_0011558 | 3300046522 | Bacteria | 5370 |
| 342 | Ga0495621_0001796 | 3300046539 | Bacteria | 5638 |
| 343 | Ga0495621_0021083 | 3300046539 | Bacteria | 2145 |
| 344 | Ga0495634_0156804 | 3300046642 | Bacteria | 1437 |
| 345 | Ga0495588_0011078 | 3300046674 | Bacteria | 4221 |
| 346 | Ga0495599_0083031 | 3300046678 | Bacteria | 2001 |
| 347 | Ga0495658_0018058 | 3300046683 | Bacteria | 3660 |
| 348 | Ga0495613_0110108 | 3300046689 | Bacteria | 1985 |
| 349 | Ga0495604_0108915 | 3300047317 | Bacteria | 2023 |
| 350 | Ga0496102_0161896 | 3300048905 | Bacteria | 2105 |
| 351 | Ga0496104_0001099 | 3300048907 | Bacteria | 23136 |
| 352 | Ga0496104_0080281 | 3300048907 | Bacteria | 3110 |
| 353 | Ga0496106_0198942 | 3300048909 | Bacteria | 1594 |
| 354 | Ga0496108_0078403 | 3300048911 | Bacteria | 2796 |
| 355 | Ga0496108_0091880 | 3300048911 | Bacteria | 2580 |
| 356 | Ga0496109_0079324 | 3300048912 | Bacteria | 3024 |
| 357 | Ga0496109_0128755 | 3300048912 | Bacteria | 2362 |
| 358 | Ga0496110_0003707 | 3300048913 | Bacteria | 11764 |
| 359 | Ga0496110_0020594 | 3300048913 | Bacteria | 5571 |
| 360 | Ga0496111_0088149 | 3300048914 | Bacteria | 2272 |
| 361 | Ga0496112_0068255 | 3300048915 | Bacteria | 3510 |
| 362 | Ga0496112_0076860 | 3300048915 | Bacteria | 3302 |
| 363 | Ga0496112_0182968 | 3300048915 | Bacteria | 2059 |
| 364 | Ga0496113_0147357 | 3300048916 | Bacteria | 1855 |
| 365 | Ga0496114_0119760 | 3300048917 | Bacteria | 2263 |
| 366 | Ga0496114_0154663 | 3300048917 | Bacteria | 1991 |
| 367 | Ga0501031_0012441 | 3300049568 | Bacteria | 5552 |
| 368 | Ga0501031_0077778 | 3300049568 | Bacteria | 2161 |
| 369 | Ga0501032_0021792 | 3300049569 | Bacteria | 4450 |
| 370 | Ga0501034_0001388 | 3300049571 | Bacteria | 32580 |
| 371 | Ga0501034_0001525 | 3300049571 | Bacteria | 30418 |
| 372 | Ga0501034_0053414 | 3300049571 | Bacteria | 4068 |
| 373 | Ga0501036_0047532 | 3300049572 | Bacteria | 3634 |
| 374 | Ga0501036_0076137 | 3300049572 | Bacteria | 2839 |
| 375 | Ga0501038_0025399 | 3300049574 | Bacteria | 5281 |
| 376 | Ga0501038_0102636 | 3300049574 | Bacteria | 2379 |
| 377 | Ga0501039_0078018 | 3300049575 | Bacteria | 2576 |
| 378 | Ga0501040_0002796 | 3300049576 | Bacteria | 11246 |
| 379 | Ga0501040_0067942 | 3300049576 | Bacteria | 2457 |
| 380 | Ga0501041_0008737 | 3300049577 | Bacteria | 5964 |
| 381 | Ga0501041_0067277 | 3300049577 | Bacteria | 2196 |
| 382 | Ga0501042_0001976 | 3300049578 | Bacteria | 12358 |
| 383 | Ga0501043_0000899 | 3300049579 | Bacteria | 26386 |
| 384 | Ga0501043_0044925 | 3300049579 | Bacteria | 3475 |
| 385 | Ga0501043_0085432 | 3300049579 | Bacteria | 2480 |
| 386 | Ga0501046_0006626 | 3300049580 | Bacteria | 10226 |
| 387 | Ga0501046_0154569 | 3300049580 | Bacteria | 1729 |
| 388 | Ga0501047_0001422 | 3300049581 | Bacteria | 23491 |
| 389 | Ga0501047_0001540 | 3300049581 | Bacteria | 22545 |
| 390 | Ga0501047_0063885 | 3300049581 | Bacteria | 3551 |
| 391 | Ga0501048_0008042 | 3300049582 | Bacteria | 7988 |
| 392 | Ga0501048_0025998 | 3300049582 | Bacteria | 4264 |
| 393 | Ga0501067_0076716 | 3300049583 | Bacteria | 1852 |
| 394 | Ga0501069_0005956 | 3300049585 | Bacteria | 6361 |
| 395 | Ga0501069_0022519 | 3300049585 | Bacteria | 3428 |
| 396 | Ga0501070_0187038 | 3300049586 | Bacteria | 1703 |
| 397 | Ga0501071_0008680 | 3300049587 | Bacteria | 6723 |
| 398 | Ga0501071_0037904 | 3300049587 | Bacteria | 3444 |
| 399 | Ga0501072_0023678 | 3300049588 | Bacteria | 4771 |
| 400 | Ga0501072_0045285 | 3300049588 | Bacteria | 3459 |
| 401 | Ga0501072_0045289 | 3300049588 | Bacteria | 3458 |
| 402 | Ga0501073_0081209 | 3300049589 | Bacteria | 2255 |
| 403 | Ga0501074_0032845 | 3300049590 | Bacteria | 3760 |
| 404 | Ga0501074_0046671 | 3300049590 | Bacteria | 3132 |
| 405 | Ga0501074_0074202 | 3300049590 | Bacteria | 2443 |
| 406 | Ga0501074_0153747 | 3300049590 | Bacteria | 1644 |
| 407 | Ga0501075_0001452 | 3300049591 | Bacteria | 15416 |
| 408 | Ga0501076_0002028 | 3300049592 | Bacteria | 13861 |
| 409 | Ga0501076_0002929 | 3300049592 | Bacteria | 11836 |
| 410 | Ga0501076_0053990 | 3300049592 | Bacteria | 3185 |
| 411 | Ga0501076_0073132 | 3300049592 | Bacteria | 2744 |
| 412 | Ga0501076_0091562 | 3300049592 | Bacteria | 2446 |
| 413 | Ga0501076_0145623 | 3300049592 | Bacteria | 1926 |
| 414 | Ga0501077_0020923 | 3300049593 | Bacteria | 4141 |
| 415 | Ga0501077_0023625 | 3300049593 | Bacteria | 3898 |
| 416 | Ga0501077_0050840 | 3300049593 | Bacteria | 2634 |
| 417 | Ga0501077_0064615 | 3300049593 | Bacteria | 2321 |
| 418 | Ga0501077_0115013 | 3300049593 | Bacteria | 1705 |
| 419 | Ga0501079_0001840 | 3300049741 | Bacteria | 15189 |
| 420 | Ga0501079_0029581 | 3300049741 | Bacteria | 4206 |
| 421 | Ga0501079_0050125 | 3300049741 | Bacteria | 3223 |
| 422 | Ga0501079_0132836 | 3300049741 | Bacteria | 1937 |
| 423 | Ga0501079_0135330 | 3300049741 | Bacteria | 1918 |
| 424 | Ga0501080_0012848 | 3300049742 | Bacteria | 7682 |
| 425 | Ga0501081_0033058 | 3300049743 | Bacteria | 3512 |
| 426 | Ga0501083_0044099 | 3300049744 | Bacteria | 3019 |
| 427 | Ga0501035_0021878 | 3300049822 | Bacteria | 5875 |
| 428 | Ga0501044_0007926 | 3300049823 | Bacteria | 11673 |
| 429 | Ga0501044_0012726 | 3300049823 | Bacteria | 9112 |
| 430 | Ga0501044_0046001 | 3300049823 | Bacteria | 4520 |
| 431 | Ga0501045_0000979 | 3300049824 | Bacteria | 18694 |
| 432 | Ga0501045_0123847 | 3300049824 | Bacteria | 1920 |
| 433 | nmdc:mga03683_719_c1 | 3300050489 | Bacteria | 9504 |
| 434 | nmdc:mga00v17_27098_c1 | 3300050491 | Bacteria | 3343 |
| 435 | nmdc:mga0yw44_4529_c1 | 3300050492 | Bacteria | 6393 |
| 436 | nmdc:mga0k408_51708_c1 | 3300050493 | Bacteria | 2381 |
| 437 | nmdc:mga0k408_92373_c1 | 3300050493 | Bacteria | 1779 |
| 438 | nmdc:mga06z11_24730_c1 | 3300050494 | Bacteria | 2838 |
| 439 | nmdc:mga06z11_47833_c1 | 3300050494 | Bacteria | 2174 |
| 440 | nmdc:mga05p37_129088_c1 | 3300050507 | Bacteria | 3103 |
| 441 | nmdc:mga05p37_154256_c1 | 3300050507 | Bacteria | 2807 |
| 442 | nmdc:mga05p37_29662_c1 | 3300050507 | Bacteria | 6675 |
| 443 | nmdc:mga05p37_4830_c1 | 3300050507 | Bacteria | 15760 |
| 444 | nmdc:mga05p37_5552_c1 | 3300050507 | Bacteria | 14822 |
| 445 | nmdc:mga05p37_5913_c1 | 3300050507 | Bacteria | 14391 |
| 446 | nmdc:mga05p37_6192_c1 | 3300050507 | Bacteria | 14087 |
| 447 | nmdc:mga05p37_66131_c1 | 3300050507 | Bacteria | 4447 |
| 448 | nmdc:mga05p37_66250_c2 | 3300050507 | Bacteria | 4075 |
| 449 | nmdc:mga05p37_8223_c1 | 3300050507 | Bacteria | 11601 |
| 450 | nmdc:mga05p37_832_c1 | 3300050507 | Bacteria | 34564 |
| 451 | nmdc:mga05p37_85623_c1 | 3300050507 | Bacteria | 3884 |
| 452 | nmdc:mga05p37_92704_c1 | 3300050507 | Bacteria | 3722 |
| 453 | nmdc:mga09592_1002_c1 | 3300050508 | Bacteria | 22398 |
| 454 | nmdc:mga09592_11816_c1 | 3300050508 | Bacteria | 7101 |
| 455 | nmdc:mga09592_7154_c1 | 3300050508 | Bacteria | 9070 |
| 456 | nmdc:mga09592_8692_c1 | 3300050508 | Bacteria | 8261 |
| 457 | nmdc:mga0qj67_1417_c1 | 3300050509 | Bacteria | 16782 |
| 458 | nmdc:mga0qj67_16701_c1 | 3300050509 | Bacteria | 5572 |
| 459 | nmdc:mga06r32_116436_c1 | 3300050510 | Bacteria | 2633 |
| 460 | nmdc:mga06r32_13806_c1 | 3300050510 | Bacteria | 7327 |
| 461 | nmdc:mga06r32_22840_c1 | 3300050510 | Bacteria | 5786 |
| 462 | nmdc:mga06r32_4238_c1 | 3300050510 | Bacteria | 12849 |
| 463 | nmdc:mga06r32_6938_c1 | 3300050510 | Bacteria | 10186 |
| 464 | nmdc:mga08y16_18417_c1 | 3300050511 | Bacteria | 7360 |
| 465 | nmdc:mga08y16_226_c1 | 3300050511 | Bacteria | 50561 |
| 466 | nmdc:mga08y16_26216_c1 | 3300050511 | Bacteria | 6147 |
| 467 | nmdc:mga08y16_3818_c1 | 3300050511 | Bacteria | 15671 |
| 468 | nmdc:mga08y16_527_c1 | 3300050511 | Bacteria | 35360 |
| 469 | nmdc:mga08y16_69084_c1 | 3300050511 | Bacteria | 3683 |
| 470 | nmdc:mga08y16_8_c1 | 3300050511 | Bacteria | 571177 |
| 471 | nmdc:mga0n895_10512_c1 | 3300050512 | Bacteria | 8186 |
| 472 | nmdc:mga0n895_11_c1 | 3300050512 | Bacteria | 112540 |
| 473 | nmdc:mga0n895_68981_c1 | 3300050512 | Bacteria | 3502 |
| 474 | nmdc:mga0n895_71366_c1 | 3300050512 | Bacteria | 3443 |
| 475 | nmdc:mga0n895_7773_c1 | 3300050512 | Bacteria | 9236 |
| 476 | nmdc:mga0n895_93694_c1 | 3300050512 | Bacteria | 3007 |
| 477 | nmdc:mga0rr50_104213_c1 | 3300050513 | Bacteria | 2234 |
| 478 | nmdc:mga0rr50_11772_c1 | 3300050513 | Bacteria | 5615 |
| 479 | nmdc:mga0rr50_19_c1 | 3300050513 | Bacteria | 158236 |
| 480 | nmdc:mga0rr50_326_c1 | 3300050513 | Bacteria | 25897 |
| 481 | nmdc:mga0rr50_5246_c1 | 3300050513 | Bacteria | 7710 |
| 482 | nmdc:mga08x19_1476_c1 | 3300050514 | Bacteria | 14566 |
| 483 | nmdc:mga08x19_23388_c1 | 3300050514 | Bacteria | 3834 |
| 484 | nmdc:mga08x19_79423_c1 | 3300050514 | Bacteria | 2152 |
| 485 | nmdc:mga0a205_13380_c1 | 3300050515 | Bacteria | 7638 |
| 486 | nmdc:mga0a205_13986_c2 | 3300050515 | Bacteria | 5103 |
| 487 | Ga0495601_0136829 | 3300053077 | Bacteria | 1597 |
| 488 | Ga0495619_0076176 | 3300053085 | Bacteria | 2252 |
| 489 | Ga0495619_0102612 | 3300053085 | Bacteria | 1948 |
| 490 | Ga0500555_002706 | 3300053103 | Bacteria | 5099 |
| 491 | Ga0500616_0003153 | 3300053153 | Bacteria | 12863 |
| 492 | Ga0500645_000514 | 3300053730 | Bacteria | 25995 |
| 493 | Ga0501084_0006120 | 3300054114 | Bacteria | 9892 |
| 494 | Ga0501084_0010694 | 3300054114 | Bacteria | 7595 |
| 495 | Ga0501084_0033139 | 3300054114 | Bacteria | 4321 |
| 496 | Ga0501084_0093528 | 3300054114 | Bacteria | 2524 |
| 497 | Ga0590071_000152 | 3300059421 | Bacteria | 19812 |
| 498 | Ga0590071_001725 | 3300059421 | Bacteria | 5642 |
| 499 | Ga0590071_002572 | 3300059421 | Bacteria | 4564 |
| 500 | Ga0590071_003768 | 3300059421 | Bacteria | 3720 |
| 501 | Ga0590071_005352 | 3300059421 | Bacteria | 3089 |
| 502 | Ga0590074_000017 | 3300059423 | Bacteria | 20687 |
| 503 | Ga0590075_002020 | 3300059424 | Bacteria | 4890 |
| 504 | Ga0590075_003519 | 3300059424 | Bacteria | 3719 |
| 505 | Ga0590075_019609 | 3300059424 | Bacteria | 1679 |
| 506 | Ga0590077_000362 | 3300059426 | Bacteria | 12805 |
| 507 | Ga0501082_0001004 | 3300060353 | Bacteria | 24909 |
| 508 | Ga0501082_0056378 | 3300060353 | Bacteria | 3384 |
| 509 | Ga0530510_0000888 | 3300061734 | Bacteria | 19730 |
| 510 | Ga0530510_0019754 | 3300061734 | Bacteria | 4786 |
| 511 | Ga0530510_0063973 | 3300061734 | Bacteria | 2664 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_154256_c1 | nmdc:mga05p37_154256_c1_883_2238 | 418 |
| 2 | 3300046642 | Ga0495634_0156804 | Ga0495634_0156804_89_1372 | 427 |
| 3 | 3300005435 | Ga0070714_100005034 | Ga0070714_1000050345 | 430 |
| 4 | 3300009148 | Ga0105243_10013558 | Ga0105243_100135582 | 430 |
| 5 | 3300042439 | Ga0439464_0030765 | Ga0439464_0030765_135_1490 | 430 |
| 6 | 3300050507 | nmdc:mga05p37_92704_c1 | nmdc:mga05p37_92704_c1_2157_3512 | 430 |
| 7 | 3300050510 | nmdc:mga06r32_116436_c1 | nmdc:mga06r32_116436_c1_1246_2601 | 430 |
| 8 | 3300050513 | nmdc:mga0rr50_104213_c1 | nmdc:mga0rr50_104213_c1_839_2194 | 430 |
| 9 | 3300060353 | Ga0501082_0056378 | Ga0501082_0056378_2001_3356 | 430 |
| 10 | 3300005356 | Ga0070674_100000735 | Ga0070674_1000007353 | 439 |
| 11 | 3300005719 | Ga0068861_100028062 | Ga0068861_1000280622 | 439 |
| 12 | 3300025923 | Ga0207681_10062183 | Ga0207681_100621832 | 439 |
| 13 | 3300026118 | Ga0207675_100044351 | Ga0207675_1000443512 | 439 |
| 14 | 3300049581 | Ga0501047_0063885 | Ga0501047_0063885_1262_2650 | 441 |
| 15 | 3300005290 | Ga0065712_10068680 | Ga0065712_100686808 | 455 |
| 16 | 3300005295 | Ga0065707_10105067 | Ga0065707_101050671 | 455 |
| 17 | 3300005340 | Ga0070689_100071424 | Ga0070689_1000714242 | 455 |
| 18 | 3300025936 | Ga0207670_10051061 | Ga0207670_100510612 | 455 |
| 19 | 3300025945 | Ga0207679_10025199 | Ga0207679_100251993 | 455 |
| 20 | 3300025922 | Ga0207646_10092831 | Ga0207646_100928312 | 461 |
| 21 | 3300031548 | Ga0307408_100048717 | Ga0307408_1000487172 | 475 |
| 22 | 3300031456 | Ga0307513_10009939 | Ga0307513_100099393 | 476 |
| 23 | 3300035086 | Ga0373934_0000606 | Ga0373934_0000606_5663_7204 | 476 |
| 24 | 3300035119 | Ga0373956_0003542 | Ga0373956_0003542_512_2053 | 476 |
| 25 | 3300035172 | Ga0373955_0003243 | Ga0373955_0003243_4093_5634 | 476 |
| 26 | 3300036401 | Ga0373937_0000387 | Ga0373937_0000387_24589_26130 | 476 |
| 27 | 3300007076 | Ga0075435_100039586 | Ga0075435_1000395863 | 477 |
| 28 | 3300020070 | Ga0206356_11870653 | Ga0206356_118706532 | 477 |
| 29 | 3300005340 | Ga0070689_100133210 | Ga0070689_1001332102 | 479 |
| 30 | 3300005617 | Ga0068859_100018112 | Ga0068859_1000181125 | 479 |
| 31 | 3300006931 | Ga0097620_100018112 | Ga0097620_1000181122 | 479 |
| 32 | 3300049590 | Ga0501074_0074202 | Ga0501074_0074202_471_2012 | 480 |
| 33 | 3300006844 | Ga0075428_100000673 | Ga0075428_10000067313 | 481 |
| 34 | 3300006846 | Ga0075430_100000398 | Ga0075430_10000039812 | 481 |
| 35 | 3300006847 | Ga0075431_100001977 | Ga0075431_10000197712 | 481 |
| 36 | 3300006880 | Ga0075429_100004255 | Ga0075429_1000042556 | 481 |
| 37 | 3300009094 | Ga0111539_10000174 | Ga0111539_1000017412 | 481 |
| 38 | 3300009147 | Ga0114129_10000288 | Ga0114129_1000028839 | 481 |
| 39 | 3300027907 | Ga0207428_10001403 | Ga0207428_100014032 | 481 |
| 40 | 3300031548 | Ga0307408_100009904 | Ga0307408_1000099046 | 481 |
| 41 | 3300032002 | Ga0307416_100119525 | Ga0307416_1001195252 | 481 |
| 42 | 3300050507 | nmdc:mga05p37_832_c1 | nmdc:mga05p37_832_c1_20895_22436 | 481 |
| 43 | 3300050508 | nmdc:mga09592_1002_c1 | nmdc:mga09592_1002_c1_10119_11660 | 481 |
| 44 | 3300050509 | nmdc:mga0qj67_16701_c1 | nmdc:mga0qj67_16701_c1_3147_4688 | 481 |
| 45 | 3300050510 | nmdc:mga06r32_4238_c1 | nmdc:mga06r32_4238_c1_737_2278 | 481 |
| 46 | 3300050511 | nmdc:mga08y16_226_c1 | nmdc:mga08y16_226_c1_24993_26534 | 481 |
| 47 | 3300006844 | Ga0075428_100000931 | Ga0075428_10000093111 | 482 |
| 48 | 3300006880 | Ga0075429_100006190 | Ga0075429_1000061905 | 482 |
| 49 | 3300050508 | nmdc:mga09592_8692_c1 | nmdc:mga09592_8692_c1_2213_3754 | 482 |
| 50 | 3300005471 | Ga0070698_100002188 | Ga0070698_1000021882 | 483 |
| 51 | 3300049579 | Ga0501043_0085432 | Ga0501043_0085432_91_1632 | 483 |
| 52 | 3300005457 | Ga0070662_100073925 | Ga0070662_1000739252 | 484 |
| 53 | 3300026067 | Ga0207678_10045519 | Ga0207678_100455192 | 484 |
| 54 | 3300026121 | Ga0207683_10112448 | Ga0207683_101124481 | 484 |
| 55 | 3300048907 | Ga0496104_0080281 | Ga0496104_0080281_67_1608 | 484 |
| 56 | 3300005290 | Ga0065712_10079275 | Ga0065712_100792753 | 488 |
| 57 | 3300005293 | Ga0065715_10099172 | Ga0065715_100991722 | 488 |
| 58 | 3300005456 | Ga0070678_100020951 | Ga0070678_1000209513 | 488 |
| 59 | 3300025315 | Ga0207697_10008950 | Ga0207697_100089505 | 488 |
| 60 | 3300025901 | Ga0207688_10016857 | Ga0207688_100168573 | 488 |
| 61 | 3300025903 | Ga0207680_10037340 | Ga0207680_100373401 | 488 |
| 62 | 3300025937 | Ga0207669_10020315 | Ga0207669_100203153 | 488 |
| 63 | 3300025944 | Ga0207661_10102254 | Ga0207661_101022542 | 488 |
| 64 | 3300026121 | Ga0207683_10089956 | Ga0207683_100899563 | 488 |
| 65 | 3300026121 | Ga0207683_10135021 | Ga0207683_101350212 | 488 |
| 66 | 3300028379 | Ga0268266_10235430 | Ga0268266_102354301 | 488 |
| 67 | 3300048911 | Ga0496108_0078403 | Ga0496108_0078403_1250_2779 | 488 |
| 68 | 3300048913 | Ga0496110_0020594 | Ga0496110_0020594_1076_2605 | 488 |
| 69 | 3300048915 | Ga0496112_0076860 | Ga0496112_0076860_961_2490 | 488 |
| 70 | 3300048917 | Ga0496114_0154663 | Ga0496114_0154663_273_1802 | 488 |
| 71 | 3300005295 | Ga0065707_10001522 | Ga0065707_100015224 | 489 |
| 72 | 3300005564 | Ga0070664_100048400 | Ga0070664_1000484003 | 489 |
| 73 | 3300005844 | Ga0068862_100048217 | Ga0068862_1000482172 | 489 |
| 74 | 3300009094 | Ga0111539_10002159 | Ga0111539_100021596 | 489 |
| 75 | 3300009094 | Ga0111539_10116685 | Ga0111539_101166853 | 489 |
| 76 | 3300009147 | Ga0114129_10000581 | Ga0114129_1000058112 | 489 |
| 77 | 3300014326 | Ga0157380_10040295 | Ga0157380_100402952 | 489 |
| 78 | 3300014745 | Ga0157377_10058027 | Ga0157377_100580272 | 489 |
| 79 | 3300025925 | Ga0207650_10097992 | Ga0207650_100979921 | 489 |
| 80 | 3300025940 | Ga0207691_10035559 | Ga0207691_100355592 | 489 |
| 81 | 3300025960 | Ga0207651_10030871 | Ga0207651_100308711 | 489 |
| 82 | 3300049572 | Ga0501036_0047532 | Ga0501036_0047532_526_2058 | 489 |
| 83 | 3300049576 | Ga0501040_0067942 | Ga0501040_0067942_106_1638 | 489 |
| 84 | 3300049578 | Ga0501042_0001976 | Ga0501042_0001976_9325_10857 | 489 |
| 85 | 3300049590 | Ga0501074_0032845 | Ga0501074_0032845_1249_2781 | 489 |
| 86 | 3300049592 | Ga0501076_0145623 | Ga0501076_0145623_350_1882 | 489 |
| 87 | 3300049741 | Ga0501079_0029581 | Ga0501079_0029581_143_1675 | 489 |
| 88 | 3300050507 | nmdc:mga05p37_29662_c1 | nmdc:mga05p37_29662_c1_3079_4611 | 489 |
| 89 | 3300050507 | nmdc:mga05p37_5552_c1 | nmdc:mga05p37_5552_c1_6344_7876 | 489 |
| 90 | 3300050508 | nmdc:mga09592_11816_c1 | nmdc:mga09592_11816_c1_4211_5743 | 489 |
| 91 | 3300050511 | nmdc:mga08y16_3818_c1 | nmdc:mga08y16_3818_c1_8502_10034 | 489 |
| 92 | 3300050512 | nmdc:mga0n895_7773_c1 | nmdc:mga0n895_7773_c1_7296_8828 | 489 |
| 93 | 3300005293 | Ga0065715_10101548 | Ga0065715_101015482 | 490 |
| 94 | 3300005295 | Ga0065707_10002910 | Ga0065707_100029104 | 490 |
| 95 | 3300005331 | Ga0070670_100017601 | Ga0070670_1000176013 | 490 |
| 96 | 3300005340 | Ga0070689_100007394 | Ga0070689_1000073944 | 490 |
| 97 | 3300005341 | Ga0070691_10012035 | Ga0070691_100120353 | 490 |
| 98 | 3300005354 | Ga0070675_100000311 | Ga0070675_10000031116 | 490 |
| 99 | 3300005354 | Ga0070675_100007377 | Ga0070675_1000073775 | 490 |
| 100 | 3300005365 | Ga0070688_100006975 | Ga0070688_1000069754 | 490 |
| 101 | 3300005440 | Ga0070705_100079626 | Ga0070705_1000796262 | 490 |
| 102 | 3300005467 | Ga0070706_100091154 | Ga0070706_1000911542 | 490 |
| 103 | 3300005471 | Ga0070698_100001813 | Ga0070698_10000181317 | 490 |
| 104 | 3300005471 | Ga0070698_100006892 | Ga0070698_1000068925 | 490 |
| 105 | 3300005518 | Ga0070699_100001754 | Ga0070699_1000017543 | 490 |
| 106 | 3300005535 | Ga0070684_100075794 | Ga0070684_1000757943 | 490 |
| 107 | 3300005536 | Ga0070697_100078283 | Ga0070697_1000782832 | 490 |
| 108 | 3300005543 | Ga0070672_100030420 | Ga0070672_1000304202 | 490 |
| 109 | 3300005544 | Ga0070686_100138756 | Ga0070686_1001387561 | 490 |
| 110 | 3300005545 | Ga0070695_100031758 | Ga0070695_1000317582 | 490 |
| 111 | 3300005546 | Ga0070696_100060492 | Ga0070696_1000604922 | 490 |
| 112 | 3300005549 | Ga0070704_100003231 | Ga0070704_1000032316 | 490 |
| 113 | 3300005549 | Ga0070704_100036021 | Ga0070704_1000360212 | 490 |
| 114 | 3300005577 | Ga0068857_100029433 | Ga0068857_1000294332 | 490 |
| 115 | 3300005615 | Ga0070702_100050355 | Ga0070702_1000503552 | 490 |
| 116 | 3300005617 | Ga0068859_100029054 | Ga0068859_1000290543 | 490 |
| 117 | 3300005618 | Ga0068864_100009517 | Ga0068864_1000095173 | 490 |
| 118 | 3300005841 | Ga0068863_100031041 | Ga0068863_1000310413 | 490 |
| 119 | 3300005842 | Ga0068858_100006773 | Ga0068858_1000067734 | 490 |
| 120 | 3300006042 | Ga0075368_10032959 | Ga0075368_100329592 | 490 |
| 121 | 3300006178 | Ga0075367_10001698 | Ga0075367_100016986 | 490 |
| 122 | 3300006358 | Ga0068871_100132725 | Ga0068871_1001327252 | 490 |
| 123 | 3300006844 | Ga0075428_100008375 | Ga0075428_1000083757 | 490 |
| 124 | 3300006847 | Ga0075431_100018355 | Ga0075431_1000183553 | 490 |
| 125 | 3300006871 | Ga0075434_100002491 | Ga0075434_1000024919 | 490 |
| 126 | 3300006931 | Ga0097620_100029055 | Ga0097620_1000290553 | 490 |
| 127 | 3300007076 | Ga0075435_100030226 | Ga0075435_1000302263 | 490 |
| 128 | 3300009147 | Ga0114129_10058684 | Ga0114129_100586843 | 490 |
| 129 | 3300025910 | Ga0207684_10067468 | Ga0207684_100674683 | 490 |
| 130 | 3300025912 | Ga0207707_10055167 | Ga0207707_100551673 | 490 |
| 131 | 3300025925 | Ga0207650_10011044 | Ga0207650_100110443 | 490 |
| 132 | 3300025926 | Ga0207659_10000975 | Ga0207659_100009758 | 490 |
| 133 | 3300025926 | Ga0207659_10059162 | Ga0207659_100591622 | 490 |
| 134 | 3300025931 | Ga0207644_10023772 | Ga0207644_100237723 | 490 |
| 135 | 3300025935 | Ga0207709_10022240 | Ga0207709_100222403 | 490 |
| 136 | 3300025940 | Ga0207691_10078308 | Ga0207691_100783082 | 490 |
| 137 | 3300025945 | Ga0207679_10034123 | Ga0207679_100341233 | 490 |
| 138 | 3300026075 | Ga0207708_10069070 | Ga0207708_100690702 | 490 |
| 139 | 3300028381 | Ga0268264_10011433 | Ga0268264_100114334 | 490 |
| 140 | 3300031824 | Ga0307413_10024351 | Ga0307413_100243512 | 490 |
| 141 | 3300031852 | Ga0307410_10036675 | Ga0307410_100366752 | 490 |
| 142 | 3300031903 | Ga0307407_10021381 | Ga0307407_100213812 | 490 |
| 143 | 3300031911 | Ga0307412_10048355 | Ga0307412_100483553 | 490 |
| 144 | 3300032002 | Ga0307416_100060127 | Ga0307416_1000601272 | 490 |
| 145 | 3300032005 | Ga0307411_10046951 | Ga0307411_100469512 | 490 |
| 146 | 3300032126 | Ga0307415_100009010 | Ga0307415_1000090104 | 490 |
| 147 | 3300045051 | Ga0451576_0009851 | Ga0451576_0009851_4041_5576 | 490 |
| 148 | 3300045051 | Ga0451576_0049993 | Ga0451576_0049993_1463_2998 | 490 |
| 149 | 3300045051 | Ga0451576_0053012 | Ga0451576_0053012_1019_2554 | 490 |
| 150 | 3300045051 | Ga0451576_0106536 | Ga0451576_0106536_460_1995 | 490 |
| 151 | 3300046455 | Ga0495603_0011818 | Ga0495603_0011818_2298_3833 | 490 |
| 152 | 3300046491 | Ga0495584_0033012 | Ga0495584_0033012_383_1930 | 490 |
| 153 | 3300046499 | Ga0495594_0006783 | Ga0495594_0006783_816_2351 | 490 |
| 154 | 3300046539 | Ga0495621_0001796 | Ga0495621_0001796_3398_4933 | 490 |
| 155 | 3300046539 | Ga0495621_0021083 | Ga0495621_0021083_520_2055 | 490 |
| 156 | 3300046674 | Ga0495588_0011078 | Ga0495588_0011078_193_1728 | 490 |
| 157 | 3300049590 | Ga0501074_0153747 | Ga0501074_0153747_30_1565 | 490 |
| 158 | 3300049592 | Ga0501076_0053990 | Ga0501076_0053990_854_2389 | 490 |
| 159 | 3300049593 | Ga0501077_0115013 | Ga0501077_0115013_147_1682 | 490 |
| 160 | 3300050507 | nmdc:mga05p37_129088_c1 | nmdc:mga05p37_129088_c1_1088_2629 | 490 |
| 161 | 3300050507 | nmdc:mga05p37_5913_c1 | nmdc:mga05p37_5913_c1_5055_6590 | 490 |
| 162 | 3300050512 | nmdc:mga0n895_10512_c1 | nmdc:mga0n895_10512_c1_4391_5926 | 490 |
| 163 | 3300050512 | nmdc:mga0n895_71366_c1 | nmdc:mga0n895_71366_c1_370_1905 | 490 |
| 164 | 3300050512 | nmdc:mga0n895_93694_c1 | nmdc:mga0n895_93694_c1_1010_2545 | 490 |
| 165 | 3300050513 | nmdc:mga0rr50_11772_c1 | nmdc:mga0rr50_11772_c1_2204_3739 | 490 |
| 166 | 3300054114 | Ga0501084_0093528 | Ga0501084_0093528_928_2463 | 490 |
| 167 | 3300059421 | Ga0590071_002572 | Ga0590071_002572_1813_3348 | 490 |
| 168 | 3300059424 | Ga0590075_002020 | Ga0590075_002020_1544_3079 | 490 |
| 169 | 3300059426 | Ga0590077_000362 | Ga0590077_000362_1146_2681 | 490 |
| 170 | 3300061734 | Ga0530510_0063973 | Ga0530510_0063973_131_1666 | 490 |
| 171 | 3300005295 | Ga0065707_10097767 | Ga0065707_100977673 | 491 |
| 172 | 3300006844 | Ga0075428_100038724 | Ga0075428_1000387243 | 491 |
| 173 | 3300006846 | Ga0075430_100002425 | Ga0075430_1000024259 | 491 |
| 174 | 3300006847 | Ga0075431_100016547 | Ga0075431_1000165475 | 491 |
| 175 | 3300006880 | Ga0075429_100030035 | Ga0075429_1000300353 | 491 |
| 176 | 3300031548 | Ga0307408_100024339 | Ga0307408_1000243392 | 491 |
| 177 | 3300031731 | Ga0307405_10073182 | Ga0307405_100731821 | 491 |
| 178 | 3300046459 | Ga0495629_0008227 | Ga0495629_0008227_1461_3005 | 491 |
| 179 | 3300047317 | Ga0495604_0108915 | Ga0495604_0108915_186_1727 | 491 |
| 180 | 3300049571 | Ga0501034_0053414 | Ga0501034_0053414_656_2197 | 491 |
| 181 | 3300049572 | Ga0501036_0076137 | Ga0501036_0076137_402_1940 | 491 |
| 182 | 3300049577 | Ga0501041_0008737 | Ga0501041_0008737_642_2180 | 491 |
| 183 | 3300049588 | Ga0501072_0023678 | Ga0501072_0023678_914_2452 | 491 |
| 184 | 3300049592 | Ga0501076_0091562 | Ga0501076_0091562_748_2286 | 491 |
| 185 | 3300049741 | Ga0501079_0050125 | Ga0501079_0050125_686_2224 | 491 |
| 186 | 3300049824 | Ga0501045_0123847 | Ga0501045_0123847_73_1611 | 491 |
| 187 | 3300050507 | nmdc:mga05p37_66250_c2 | nmdc:mga05p37_66250_c2_2527_4065 | 491 |
| 188 | 3300050508 | nmdc:mga09592_7154_c1 | nmdc:mga09592_7154_c1_995_2533 | 491 |
| 189 | 3300050509 | nmdc:mga0qj67_1417_c1 | nmdc:mga0qj67_1417_c1_14360_15898 | 491 |
| 190 | 3300050510 | nmdc:mga06r32_6938_c1 | nmdc:mga06r32_6938_c1_1749_3287 | 491 |
| 191 | 3300061734 | Ga0530510_0019754 | Ga0530510_0019754_330_1868 | 491 |
| 192 | 3300002459 | JGI24751J29686_10005675 | JGI24751J29686_100056753 | 492 |
| 193 | 3300003203 | JGI25406J46586_10007699 | JGI25406J46586_100076992 | 492 |
| 194 | 3300005290 | Ga0065712_10001865 | Ga0065712_1000186510 | 492 |
| 195 | 3300005290 | Ga0065712_10068417 | Ga0065712_100684172 | 492 |
| 196 | 3300005290 | Ga0065712_10077523 | Ga0065712_100775235 | 492 |
| 197 | 3300005290 | Ga0065712_10089783 | Ga0065712_100897832 | 492 |
| 198 | 3300005290 | Ga0065712_10104388 | Ga0065712_101043882 | 492 |
| 199 | 3300005293 | Ga0065715_10107958 | Ga0065715_101079581 | 492 |
| 200 | 3300005328 | Ga0070676_10010750 | Ga0070676_100107502 | 492 |
| 201 | 3300005331 | Ga0070670_100011093 | Ga0070670_1000110934 | 492 |
| 202 | 3300005331 | Ga0070670_100014785 | Ga0070670_1000147853 | 492 |
| 203 | 3300005331 | Ga0070670_100023960 | Ga0070670_1000239605 | 492 |
| 204 | 3300005334 | Ga0068869_100000256 | Ga0068869_1000002563 | 492 |
| 205 | 3300005335 | Ga0070666_10136307 | Ga0070666_101363071 | 492 |
| 206 | 3300005339 | Ga0070660_100013139 | Ga0070660_1000131392 | 492 |
| 207 | 3300005343 | Ga0070687_100028003 | Ga0070687_1000280032 | 492 |
| 208 | 3300005353 | Ga0070669_100002881 | Ga0070669_1000028817 | 492 |
| 209 | 3300005353 | Ga0070669_100079022 | Ga0070669_1000790222 | 492 |
| 210 | 3300005354 | Ga0070675_100002200 | Ga0070675_1000022004 | 492 |
| 211 | 3300005354 | Ga0070675_100002452 | Ga0070675_1000024524 | 492 |
| 212 | 3300005356 | Ga0070674_100001848 | Ga0070674_1000018489 | 492 |
| 213 | 3300005356 | Ga0070674_100002130 | Ga0070674_1000021304 | 492 |
| 214 | 3300005356 | Ga0070674_100131485 | Ga0070674_1001314851 | 492 |
| 215 | 3300005364 | Ga0070673_100018890 | Ga0070673_1000188902 | 492 |
| 216 | 3300005364 | Ga0070673_100172743 | Ga0070673_1001727432 | 492 |
| 217 | 3300005366 | Ga0070659_100010629 | Ga0070659_1000106293 | 492 |
| 218 | 3300005367 | Ga0070667_100028989 | Ga0070667_1000289894 | 492 |
| 219 | 3300005367 | Ga0070667_100095032 | Ga0070667_1000950321 | 492 |
| 220 | 3300005438 | Ga0070701_10003990 | Ga0070701_100039902 | 492 |
| 221 | 3300005445 | Ga0070708_100000002 | Ga0070708_100000002143 | 492 |
| 222 | 3300005456 | Ga0070678_100024033 | Ga0070678_1000240331 | 492 |
| 223 | 3300005456 | Ga0070678_100030823 | Ga0070678_1000308233 | 492 |
| 224 | 3300005458 | Ga0070681_10019926 | Ga0070681_100199264 | 492 |
| 225 | 3300005458 | Ga0070681_10067199 | Ga0070681_100671991 | 492 |
| 226 | 3300005459 | Ga0068867_100011691 | Ga0068867_1000116915 | 492 |
| 227 | 3300005471 | Ga0070698_100018706 | Ga0070698_1000187066 | 492 |
| 228 | 3300005471 | Ga0070698_100136158 | Ga0070698_1001361582 | 492 |
| 229 | 3300005471 | Ga0070698_100153230 | Ga0070698_1001532302 | 492 |
| 230 | 3300005518 | Ga0070699_100000980 | Ga0070699_1000009806 | 492 |
| 231 | 3300005518 | Ga0070699_100004768 | Ga0070699_1000047689 | 492 |
| 232 | 3300005535 | Ga0070684_100015248 | Ga0070684_1000152482 | 492 |
| 233 | 3300005535 | Ga0070684_100024056 | Ga0070684_1000240564 | 492 |
| 234 | 3300005536 | Ga0070697_100027184 | Ga0070697_1000271843 | 492 |
| 235 | 3300005543 | Ga0070672_100015797 | Ga0070672_1000157972 | 492 |
| 236 | 3300005544 | Ga0070686_100004936 | Ga0070686_1000049367 | 492 |
| 237 | 3300005544 | Ga0070686_100028383 | Ga0070686_1000283832 | 492 |
| 238 | 3300005544 | Ga0070686_100066538 | Ga0070686_1000665382 | 492 |
| 239 | 3300005547 | Ga0070693_100021406 | Ga0070693_1000214063 | 492 |
| 240 | 3300005548 | Ga0070665_100001061 | Ga0070665_1000010617 | 492 |
| 241 | 3300005548 | Ga0070665_100112265 | Ga0070665_1001122652 | 492 |
| 242 | 3300005563 | Ga0068855_100040709 | Ga0068855_1000407094 | 492 |
| 243 | 3300005564 | Ga0070664_100000832 | Ga0070664_10000083213 | 492 |
| 244 | 3300005564 | Ga0070664_100031404 | Ga0070664_1000314042 | 492 |
| 245 | 3300005564 | Ga0070664_100155113 | Ga0070664_1001551132 | 492 |
| 246 | 3300005578 | Ga0068854_100002437 | Ga0068854_1000024375 | 492 |
| 247 | 3300005578 | Ga0068854_100006157 | Ga0068854_1000061572 | 492 |
| 248 | 3300005617 | Ga0068859_100013874 | Ga0068859_1000138742 | 492 |
| 249 | 3300005618 | Ga0068864_100030550 | Ga0068864_1000305502 | 492 |
| 250 | 3300005718 | Ga0068866_10002372 | Ga0068866_100023722 | 492 |
| 251 | 3300005719 | Ga0068861_100161312 | Ga0068861_1001613121 | 492 |
| 252 | 3300005834 | Ga0068851_10008332 | Ga0068851_100083324 | 492 |
| 253 | 3300005841 | Ga0068863_100044292 | Ga0068863_1000442921 | 492 |
| 254 | 3300005841 | Ga0068863_100067747 | Ga0068863_1000677472 | 492 |
| 255 | 3300005842 | Ga0068858_100132773 | Ga0068858_1001327732 | 492 |
| 256 | 3300005843 | Ga0068860_100064216 | Ga0068860_1000642162 | 492 |
| 257 | 3300005844 | Ga0068862_100044485 | Ga0068862_1000444853 | 492 |
| 258 | 3300005985 | Ga0081539_10000110 | Ga0081539_10000110130 | 492 |
| 259 | 3300006038 | Ga0075365_10011620 | Ga0075365_100116203 | 492 |
| 260 | 3300006038 | Ga0075365_10044558 | Ga0075365_100445583 | 492 |
| 261 | 3300006177 | Ga0075362_10001435 | Ga0075362_100014354 | 492 |
| 262 | 3300006195 | Ga0075366_10045956 | Ga0075366_100459561 | 492 |
| 263 | 3300006237 | Ga0097621_100016903 | Ga0097621_1000169032 | 492 |
| 264 | 3300006358 | Ga0068871_100001984 | Ga0068871_1000019846 | 492 |
| 265 | 3300006844 | Ga0075428_100000030 | Ga0075428_10000003041 | 492 |
| 266 | 3300006844 | Ga0075428_100006014 | Ga0075428_1000060141 | 492 |
| 267 | 3300006844 | Ga0075428_100008632 | Ga0075428_1000086324 | 492 |
| 268 | 3300006844 | Ga0075428_100026750 | Ga0075428_1000267502 | 492 |
| 269 | 3300006844 | Ga0075428_100112270 | Ga0075428_1001122702 | 492 |
| 270 | 3300006846 | Ga0075430_100009976 | Ga0075430_1000099762 | 492 |
| 271 | 3300006847 | Ga0075431_100012354 | Ga0075431_1000123544 | 492 |
| 272 | 3300006847 | Ga0075431_100112615 | Ga0075431_1001126152 | 492 |
| 273 | 3300006852 | Ga0075433_10044987 | Ga0075433_100449874 | 492 |
| 274 | 3300006871 | Ga0075434_100003288 | Ga0075434_1000032882 | 492 |
| 275 | 3300006871 | Ga0075434_100108317 | Ga0075434_1001083173 | 492 |
| 276 | 3300006880 | Ga0075429_100005123 | Ga0075429_1000051232 | 492 |
| 277 | 3300006881 | Ga0068865_100073067 | Ga0068865_1000730671 | 492 |
| 278 | 3300006914 | Ga0075436_100002164 | Ga0075436_10000216412 | 492 |
| 279 | 3300006914 | Ga0075436_100038228 | Ga0075436_1000382283 | 492 |
| 280 | 3300006931 | Ga0097620_100013874 | Ga0097620_1000138744 | 492 |
| 281 | 3300007076 | Ga0075435_100000034 | Ga0075435_10000003445 | 492 |
| 282 | 3300007076 | Ga0075435_100000542 | Ga0075435_10000054216 | 492 |
| 283 | 3300007076 | Ga0075435_100012725 | Ga0075435_1000127252 | 492 |
| 284 | 3300007076 | Ga0075435_100106714 | Ga0075435_1001067142 | 492 |
| 285 | 3300009094 | Ga0111539_10000015 | Ga0111539_10000015100 | 492 |
| 286 | 3300009094 | Ga0111539_10000657 | Ga0111539_1000065719 | 492 |
| 287 | 3300009094 | Ga0111539_10002052 | Ga0111539_100020523 | 492 |
| 288 | 3300009094 | Ga0111539_10042646 | Ga0111539_100426465 | 492 |
| 289 | 3300009094 | Ga0111539_10108842 | Ga0111539_101088422 | 492 |
| 290 | 3300009098 | Ga0105245_10043479 | Ga0105245_100434792 | 492 |
| 291 | 3300009098 | Ga0105245_10147065 | Ga0105245_101470652 | 492 |
| 292 | 3300009147 | Ga0114129_10001174 | Ga0114129_1000117410 | 492 |
| 293 | 3300009147 | Ga0114129_10006497 | Ga0114129_100064974 | 492 |
| 294 | 3300009147 | Ga0114129_10095275 | Ga0114129_100952752 | 492 |
| 295 | 3300009148 | Ga0105243_10049415 | Ga0105243_100494152 | 492 |
| 296 | 3300009176 | Ga0105242_10006802 | Ga0105242_100068026 | 492 |
| 297 | 3300009176 | Ga0105242_10007503 | Ga0105242_100075032 | 492 |
| 298 | 3300009177 | Ga0105248_10019397 | Ga0105248_100193976 | 492 |
| 299 | 3300009177 | Ga0105248_10143370 | Ga0105248_101433701 | 492 |
| 300 | 3300009545 | Ga0105237_10081662 | Ga0105237_100816623 | 492 |
| 301 | 3300009551 | Ga0105238_10002716 | Ga0105238_1000271611 | 492 |
| 302 | 3300009553 | Ga0105249_10001257 | Ga0105249_100012579 | 492 |
| 303 | 3300009553 | Ga0105249_10052897 | Ga0105249_100528973 | 492 |
| 304 | 3300013296 | Ga0157374_10087859 | Ga0157374_100878592 | 492 |
| 305 | 3300013306 | Ga0163162_10024574 | Ga0163162_100245744 | 492 |
| 306 | 3300014325 | Ga0163163_10000005 | Ga0163163_1000000556 | 492 |
| 307 | 3300014325 | Ga0163163_10015247 | Ga0163163_100152474 | 492 |
| 308 | 3300014325 | Ga0163163_10033344 | Ga0163163_100333442 | 492 |
| 309 | 3300014325 | Ga0163163_10041293 | Ga0163163_100412934 | 492 |
| 310 | 3300014326 | Ga0157380_10000415 | Ga0157380_100004158 | 492 |
| 311 | 3300014326 | Ga0157380_10000549 | Ga0157380_100005498 | 492 |
| 312 | 3300014326 | Ga0157380_10031476 | Ga0157380_100314763 | 492 |
| 313 | 3300014326 | Ga0157380_10081845 | Ga0157380_100818453 | 492 |
| 314 | 3300014969 | Ga0157376_10074275 | Ga0157376_100742752 | 492 |
| 315 | 3300025321 | Ga0207656_10005665 | Ga0207656_100056654 | 492 |
| 316 | 3300025893 | Ga0207682_10013055 | Ga0207682_100130552 | 492 |
| 317 | 3300025893 | Ga0207682_10024964 | Ga0207682_100249642 | 492 |
| 318 | 3300025899 | Ga0207642_10004075 | Ga0207642_100040753 | 492 |
| 319 | 3300025907 | Ga0207645_10005378 | Ga0207645_100053782 | 492 |
| 320 | 3300025910 | Ga0207684_10008593 | Ga0207684_100085933 | 492 |
| 321 | 3300025912 | Ga0207707_10016097 | Ga0207707_100160972 | 492 |
| 322 | 3300025912 | Ga0207707_10029951 | Ga0207707_100299512 | 492 |
| 323 | 3300025913 | Ga0207695_10141094 | Ga0207695_101410942 | 492 |
| 324 | 3300025914 | Ga0207671_10068672 | Ga0207671_100686722 | 492 |
| 325 | 3300025918 | Ga0207662_10003753 | Ga0207662_100037533 | 492 |
| 326 | 3300025919 | Ga0207657_10008592 | Ga0207657_100085924 | 492 |
| 327 | 3300025921 | Ga0207652_10021929 | Ga0207652_100219294 | 492 |
| 328 | 3300025923 | Ga0207681_10104325 | Ga0207681_101043251 | 492 |
| 329 | 3300025924 | Ga0207694_10004377 | Ga0207694_100043774 | 492 |
| 330 | 3300025924 | Ga0207694_10165195 | Ga0207694_101651951 | 492 |
| 331 | 3300025926 | Ga0207659_10008248 | Ga0207659_100082482 | 492 |
| 332 | 3300025926 | Ga0207659_10013544 | Ga0207659_100135443 | 492 |
| 333 | 3300025926 | Ga0207659_10020371 | Ga0207659_100203711 | 492 |
| 334 | 3300025927 | Ga0207687_10039424 | Ga0207687_100394242 | 492 |
| 335 | 3300025927 | Ga0207687_10068596 | Ga0207687_100685962 | 492 |
| 336 | 3300025931 | Ga0207644_10021961 | Ga0207644_100219612 | 492 |
| 337 | 3300025932 | Ga0207690_10057404 | Ga0207690_100574043 | 492 |
| 338 | 3300025934 | Ga0207686_10002593 | Ga0207686_100025936 | 492 |
| 339 | 3300025934 | Ga0207686_10006503 | Ga0207686_100065033 | 492 |
| 340 | 3300025934 | Ga0207686_10018478 | Ga0207686_100184782 | 492 |
| 341 | 3300025935 | Ga0207709_10007528 | Ga0207709_100075284 | 492 |
| 342 | 3300025936 | Ga0207670_10009719 | Ga0207670_100097193 | 492 |
| 343 | 3300025937 | Ga0207669_10000576 | Ga0207669_1000057614 | 492 |
| 344 | 3300025938 | Ga0207704_10008141 | Ga0207704_100081412 | 492 |
| 345 | 3300025938 | Ga0207704_10010027 | Ga0207704_100100271 | 492 |
| 346 | 3300025938 | Ga0207704_10061764 | Ga0207704_100617641 | 492 |
| 347 | 3300025940 | Ga0207691_10004280 | Ga0207691_1000428013 | 492 |
| 348 | 3300025940 | Ga0207691_10005737 | Ga0207691_100057376 | 492 |
| 349 | 3300025941 | Ga0207711_10113018 | Ga0207711_101130182 | 492 |
| 350 | 3300025942 | Ga0207689_10000674 | Ga0207689_1000067419 | 492 |
| 351 | 3300025942 | Ga0207689_10071885 | Ga0207689_100718853 | 492 |
| 352 | 3300025942 | Ga0207689_10085545 | Ga0207689_100855452 | 492 |
| 353 | 3300025942 | Ga0207689_10119829 | Ga0207689_101198292 | 492 |
| 354 | 3300025949 | Ga0207667_10056520 | Ga0207667_100565202 | 492 |
| 355 | 3300025960 | Ga0207651_10015926 | Ga0207651_100159263 | 492 |
| 356 | 3300025961 | Ga0207712_10004150 | Ga0207712_100041508 | 492 |
| 357 | 3300025981 | Ga0207640_10007641 | Ga0207640_100076412 | 492 |
| 358 | 3300025986 | Ga0207658_10028480 | Ga0207658_100284801 | 492 |
| 359 | 3300026035 | Ga0207703_10159847 | Ga0207703_101598472 | 492 |
| 360 | 3300026067 | Ga0207678_10012995 | Ga0207678_100129952 | 492 |
| 361 | 3300026075 | Ga0207708_10001495 | Ga0207708_100014956 | 492 |
| 362 | 3300026075 | Ga0207708_10006720 | Ga0207708_100067203 | 492 |
| 363 | 3300026075 | Ga0207708_10014468 | Ga0207708_100144685 | 492 |
| 364 | 3300026088 | Ga0207641_10183273 | Ga0207641_101832732 | 492 |
| 365 | 3300026089 | Ga0207648_10001691 | Ga0207648_100016918 | 492 |
| 366 | 3300026095 | Ga0207676_10102496 | Ga0207676_101024962 | 492 |
| 367 | 3300026118 | Ga0207675_100025629 | Ga0207675_1000256293 | 492 |
| 368 | 3300026118 | Ga0207675_100093292 | Ga0207675_1000932923 | 492 |
| 369 | 3300026121 | Ga0207683_10018524 | Ga0207683_100185241 | 492 |
| 370 | 3300026121 | Ga0207683_10022945 | Ga0207683_100229455 | 492 |
| 371 | 3300026121 | Ga0207683_10046565 | Ga0207683_100465652 | 492 |
| 372 | 3300027907 | Ga0207428_10000048 | Ga0207428_10000048100 | 492 |
| 373 | 3300027907 | Ga0207428_10002183 | Ga0207428_1000218313 | 492 |
| 374 | 3300027907 | Ga0207428_10015984 | Ga0207428_100159842 | 492 |
| 375 | 3300028379 | Ga0268266_10002445 | Ga0268266_100024453 | 492 |
| 376 | 3300028379 | Ga0268266_10098920 | Ga0268266_100989201 | 492 |
| 377 | 3300031548 | Ga0307408_100005017 | Ga0307408_1000050176 | 492 |
| 378 | 3300031824 | Ga0307413_10008047 | Ga0307413_100080472 | 492 |
| 379 | 3300031852 | Ga0307410_10009285 | Ga0307410_100092855 | 492 |
| 380 | 3300031852 | Ga0307410_10082640 | Ga0307410_100826402 | 492 |
| 381 | 3300031903 | Ga0307407_10039358 | Ga0307407_100393583 | 492 |
| 382 | 3300031911 | Ga0307412_10012962 | Ga0307412_100129623 | 492 |
| 383 | 3300031995 | Ga0307409_100000402 | Ga0307409_1000004024 | 492 |
| 384 | 3300031995 | Ga0307409_100020749 | Ga0307409_1000207492 | 492 |
| 385 | 3300031995 | Ga0307409_100045657 | Ga0307409_1000456572 | 492 |
| 386 | 3300031995 | Ga0307409_100056397 | Ga0307409_1000563973 | 492 |
| 387 | 3300031995 | Ga0307409_100242837 | Ga0307409_1002428371 | 492 |
| 388 | 3300032002 | Ga0307416_100038785 | Ga0307416_1000387854 | 492 |
| 389 | 3300032002 | Ga0307416_100041405 | Ga0307416_1000414053 | 492 |
| 390 | 3300032002 | Ga0307416_100044313 | Ga0307416_1000443132 | 492 |
| 391 | 3300032002 | Ga0307416_100079312 | Ga0307416_1000793122 | 492 |
| 392 | 3300032002 | Ga0307416_100097160 | Ga0307416_1000971602 | 492 |
| 393 | 3300032005 | Ga0307411_10008127 | Ga0307411_100081272 | 492 |
| 394 | 3300032005 | Ga0307411_10028199 | Ga0307411_100281992 | 492 |
| 395 | 3300035115 | Ga0373941_0001687 | Ga0373941_0001687_1744_3285 | 492 |
| 396 | 3300035692 | Ga0373935_0087192 | Ga0373935_0087192_471_2018 | 492 |
| 397 | 3300037068 | Ga0373925_0006974 | Ga0373925_0006974_16_1557 | 492 |
| 398 | 3300042156 | Ga0439446_0019092 | Ga0439446_0019092_195_1736 | 492 |
| 399 | 3300042435 | Ga0439434_0006671 | Ga0439434_0006671_1121_2662 | 492 |
| 400 | 3300045051 | Ga0451576_0003740 | Ga0451576_0003740_1071_2615 | 492 |
| 401 | 3300046516 | Ga0495628_0072683 | Ga0495628_0072683_502_2070 | 492 |
| 402 | 3300046522 | Ga0495643_0011558 | Ga0495643_0011558_2834_4384 | 492 |
| 403 | 3300046678 | Ga0495599_0083031 | Ga0495599_0083031_119_1687 | 492 |
| 404 | 3300046683 | Ga0495658_0018058 | Ga0495658_0018058_530_2071 | 492 |
| 405 | 3300046689 | Ga0495613_0110108 | Ga0495613_0110108_27_1568 | 492 |
| 406 | 3300048905 | Ga0496102_0161896 | Ga0496102_0161896_398_1939 | 492 |
| 407 | 3300048907 | Ga0496104_0001099 | Ga0496104_0001099_20930_22471 | 492 |
| 408 | 3300048909 | Ga0496106_0198942 | Ga0496106_0198942_12_1553 | 492 |
| 409 | 3300048911 | Ga0496108_0091880 | Ga0496108_0091880_470_2011 | 492 |
| 410 | 3300048912 | Ga0496109_0079324 | Ga0496109_0079324_765_2306 | 492 |
| 411 | 3300048912 | Ga0496109_0128755 | Ga0496109_0128755_759_2303 | 492 |
| 412 | 3300048913 | Ga0496110_0003707 | Ga0496110_0003707_9545_11086 | 492 |
| 413 | 3300048914 | Ga0496111_0088149 | Ga0496111_0088149_27_1568 | 492 |
| 414 | 3300048915 | Ga0496112_0068255 | Ga0496112_0068255_501_2042 | 492 |
| 415 | 3300048915 | Ga0496112_0182968 | Ga0496112_0182968_143_1711 | 492 |
| 416 | 3300048916 | Ga0496113_0147357 | Ga0496113_0147357_230_1774 | 492 |
| 417 | 3300048917 | Ga0496114_0119760 | Ga0496114_0119760_629_2173 | 492 |
| 418 | 3300049568 | Ga0501031_0012441 | Ga0501031_0012441_1376_2917 | 492 |
| 419 | 3300049568 | Ga0501031_0077778 | Ga0501031_0077778_77_1618 | 492 |
| 420 | 3300049569 | Ga0501032_0021792 | Ga0501032_0021792_228_1769 | 492 |
| 421 | 3300049571 | Ga0501034_0001388 | Ga0501034_0001388_19542_21083 | 492 |
| 422 | 3300049571 | Ga0501034_0001525 | Ga0501034_0001525_4678_6225 | 492 |
| 423 | 3300049574 | Ga0501038_0025399 | Ga0501038_0025399_3609_5150 | 492 |
| 424 | 3300049574 | Ga0501038_0102636 | Ga0501038_0102636_171_1712 | 492 |
| 425 | 3300049575 | Ga0501039_0078018 | Ga0501039_0078018_511_2052 | 492 |
| 426 | 3300049576 | Ga0501040_0002796 | Ga0501040_0002796_8405_10000 | 492 |
| 427 | 3300049577 | Ga0501041_0067277 | Ga0501041_0067277_282_1823 | 492 |
| 428 | 3300049579 | Ga0501043_0000899 | Ga0501043_0000899_21534_23075 | 492 |
| 429 | 3300049579 | Ga0501043_0044925 | Ga0501043_0044925_1212_2753 | 492 |
| 430 | 3300049580 | Ga0501046_0006626 | Ga0501046_0006626_7314_8909 | 492 |
| 431 | 3300049580 | Ga0501046_0154569 | Ga0501046_0154569_40_1581 | 492 |
| 432 | 3300049581 | Ga0501047_0001422 | Ga0501047_0001422_4886_6427 | 492 |
| 433 | 3300049581 | Ga0501047_0001540 | Ga0501047_0001540_1689_3230 | 492 |
| 434 | 3300049582 | Ga0501048_0008042 | Ga0501048_0008042_5544_7139 | 492 |
| 435 | 3300049582 | Ga0501048_0025998 | Ga0501048_0025998_2086_3636 | 492 |
| 436 | 3300049583 | Ga0501067_0076716 | Ga0501067_0076716_224_1771 | 492 |
| 437 | 3300049585 | Ga0501069_0005956 | Ga0501069_0005956_3931_5472 | 492 |
| 438 | 3300049585 | Ga0501069_0022519 | Ga0501069_0022519_1689_3230 | 492 |
| 439 | 3300049586 | Ga0501070_0187038 | Ga0501070_0187038_110_1651 | 492 |
| 440 | 3300049587 | Ga0501071_0008680 | Ga0501071_0008680_4931_6526 | 492 |
| 441 | 3300049587 | Ga0501071_0037904 | Ga0501071_0037904_1511_3091 | 492 |
| 442 | 3300049588 | Ga0501072_0045285 | Ga0501072_0045285_508_2049 | 492 |
| 443 | 3300049588 | Ga0501072_0045289 | Ga0501072_0045289_1204_2754 | 492 |
| 444 | 3300049589 | Ga0501073_0081209 | Ga0501073_0081209_213_1754 | 492 |
| 445 | 3300049590 | Ga0501074_0046671 | Ga0501074_0046671_694_2289 | 492 |
| 446 | 3300049591 | Ga0501075_0001452 | Ga0501075_0001452_20_1615 | 492 |
| 447 | 3300049592 | Ga0501076_0002028 | Ga0501076_0002028_607_2202 | 492 |
| 448 | 3300049592 | Ga0501076_0002929 | Ga0501076_0002929_590_2140 | 492 |
| 449 | 3300049592 | Ga0501076_0073132 | Ga0501076_0073132_934_2514 | 492 |
| 450 | 3300049593 | Ga0501077_0020923 | Ga0501077_0020923_1322_2863 | 492 |
| 451 | 3300049593 | Ga0501077_0023625 | Ga0501077_0023625_902_2497 | 492 |
| 452 | 3300049593 | Ga0501077_0050840 | Ga0501077_0050840_435_1976 | 492 |
| 453 | 3300049593 | Ga0501077_0064615 | Ga0501077_0064615_617_2158 | 492 |
| 454 | 3300049741 | Ga0501079_0001840 | Ga0501079_0001840_7308_8903 | 492 |
| 455 | 3300049741 | Ga0501079_0132836 | Ga0501079_0132836_232_1812 | 492 |
| 456 | 3300049741 | Ga0501079_0135330 | Ga0501079_0135330_60_1601 | 492 |
| 457 | 3300049742 | Ga0501080_0012848 | Ga0501080_0012848_3897_5438 | 492 |
| 458 | 3300049743 | Ga0501081_0033058 | Ga0501081_0033058_1867_3417 | 492 |
| 459 | 3300049744 | Ga0501083_0044099 | Ga0501083_0044099_1181_2722 | 492 |
| 460 | 3300049822 | Ga0501035_0021878 | Ga0501035_0021878_3488_5083 | 492 |
| 461 | 3300049823 | Ga0501044_0007926 | Ga0501044_0007926_7285_8826 | 492 |
| 462 | 3300049823 | Ga0501044_0012726 | Ga0501044_0012726_7320_8861 | 492 |
| 463 | 3300049823 | Ga0501044_0046001 | Ga0501044_0046001_1757_3298 | 492 |
| 464 | 3300049824 | Ga0501045_0000979 | Ga0501045_0000979_3639_5234 | 492 |
| 465 | 3300050489 | nmdc:mga03683_719_c1 | nmdc:mga03683_719_c1_3874_5421 | 492 |
| 466 | 3300050491 | nmdc:mga00v17_27098_c1 | nmdc:mga00v17_27098_c1_1268_2812 | 492 |
| 467 | 3300050492 | nmdc:mga0yw44_4529_c1 | nmdc:mga0yw44_4529_c1_1631_3178 | 492 |
| 468 | 3300050493 | nmdc:mga0k408_51708_c1 | nmdc:mga0k408_51708_c1_600_2150 | 492 |
| 469 | 3300050493 | nmdc:mga0k408_92373_c1 | nmdc:mga0k408_92373_c1_104_1645 | 492 |
| 470 | 3300050494 | nmdc:mga06z11_24730_c1 | nmdc:mga06z11_24730_c1_1243_2790 | 492 |
| 471 | 3300050494 | nmdc:mga06z11_47833_c1 | nmdc:mga06z11_47833_c1_335_1882 | 492 |
| 472 | 3300050507 | nmdc:mga05p37_4830_c1 | nmdc:mga05p37_4830_c1_4802_6343 | 492 |
| 473 | 3300050507 | nmdc:mga05p37_6192_c1 | nmdc:mga05p37_6192_c1_10520_12061 | 492 |
| 474 | 3300050507 | nmdc:mga05p37_66131_c1 | nmdc:mga05p37_66131_c1_456_1997 | 492 |
| 475 | 3300050507 | nmdc:mga05p37_8223_c1 | nmdc:mga05p37_8223_c1_4852_6393 | 492 |
| 476 | 3300050507 | nmdc:mga05p37_85623_c1 | nmdc:mga05p37_85623_c1_72_1613 | 492 |
| 477 | 3300050510 | nmdc:mga06r32_13806_c1 | nmdc:mga06r32_13806_c1_1123_2664 | 492 |
| 478 | 3300050510 | nmdc:mga06r32_22840_c1 | nmdc:mga06r32_22840_c1_1006_2547 | 492 |
| 479 | 3300050511 | nmdc:mga08y16_18417_c1 | nmdc:mga08y16_18417_c1_1200_2741 | 492 |
| 480 | 3300050511 | nmdc:mga08y16_26216_c1 | nmdc:mga08y16_26216_c1_3029_4570 | 492 |
| 481 | 3300050511 | nmdc:mga08y16_527_c1 | nmdc:mga08y16_527_c1_20208_21755 | 492 |
| 482 | 3300050511 | nmdc:mga08y16_69084_c1 | nmdc:mga08y16_69084_c1_847_2388 | 492 |
| 483 | 3300050511 | nmdc:mga08y16_8_c1 | nmdc:mga08y16_8_c1_438175_439722 | 492 |
| 484 | 3300050512 | nmdc:mga0n895_11_c1 | nmdc:mga0n895_11_c1_85262_86803 | 492 |
| 485 | 3300050512 | nmdc:mga0n895_68981_c1 | nmdc:mga0n895_68981_c1_1133_2674 | 492 |
| 486 | 3300050513 | nmdc:mga0rr50_19_c1 | nmdc:mga0rr50_19_c1_97468_99009 | 492 |
| 487 | 3300050513 | nmdc:mga0rr50_326_c1 | nmdc:mga0rr50_326_c1_9449_10990 | 492 |
| 488 | 3300050513 | nmdc:mga0rr50_5246_c1 | nmdc:mga0rr50_5246_c1_2258_3799 | 492 |
| 489 | 3300050514 | nmdc:mga08x19_1476_c1 | nmdc:mga08x19_1476_c1_7131_8672 | 492 |
| 490 | 3300050514 | nmdc:mga08x19_23388_c1 | nmdc:mga08x19_23388_c1_19_1560 | 492 |
| 491 | 3300050514 | nmdc:mga08x19_79423_c1 | nmdc:mga08x19_79423_c1_360_1901 | 492 |
| 492 | 3300050515 | nmdc:mga0a205_13380_c1 | nmdc:mga0a205_13380_c1_5396_6937 | 492 |
| 493 | 3300050515 | nmdc:mga0a205_13986_c2 | nmdc:mga0a205_13986_c2_2495_4036 | 492 |
| 494 | 3300053077 | Ga0495601_0136829 | Ga0495601_0136829_42_1583 | 492 |
| 495 | 3300053085 | Ga0495619_0076176 | Ga0495619_0076176_640_2181 | 492 |
| 496 | 3300053085 | Ga0495619_0102612 | Ga0495619_0102612_335_1882 | 492 |
| 497 | 3300053103 | Ga0500555_002706 | Ga0500555_002706_1581_3125 | 492 |
| 498 | 3300053153 | Ga0500616_0003153 | Ga0500616_0003153_6419_7963 | 492 |
| 499 | 3300053730 | Ga0500645_000514 | Ga0500645_000514_21414_22958 | 492 |
| 500 | 3300054114 | Ga0501084_0006120 | Ga0501084_0006120_3098_4639 | 492 |
| 501 | 3300054114 | Ga0501084_0010694 | Ga0501084_0010694_5079_6674 | 492 |
| 502 | 3300054114 | Ga0501084_0033139 | Ga0501084_0033139_533_2074 | 492 |
| 503 | 3300059421 | Ga0590071_000152 | Ga0590071_000152_17940_19481 | 492 |
| 504 | 3300059421 | Ga0590071_001725 | Ga0590071_001725_2375_3916 | 492 |
| 505 | 3300059421 | Ga0590071_003768 | Ga0590071_003768_2057_3598 | 492 |
| 506 | 3300059421 | Ga0590071_005352 | Ga0590071_005352_547_2088 | 492 |
| 507 | 3300059423 | Ga0590074_000017 | Ga0590074_000017_13618_15159 | 492 |
| 508 | 3300059424 | Ga0590075_003519 | Ga0590075_003519_2001_3542 | 492 |
| 509 | 3300059424 | Ga0590075_019609 | Ga0590075_019609_107_1648 | 492 |
| 510 | 3300060353 | Ga0501082_0001004 | Ga0501082_0001004_15544_17139 | 492 |
| 511 | 3300061734 | Ga0530510_0000888 | Ga0530510_0000888_11976_13571 | 492 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8pn8-assembly1.cif.gz_F | engineered glycolyl-coa carboxylase (l100n variant) with bound coa | 0.9027 | 5 | 492 |
| 3n6r-assembly1.cif.gz_L | crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) | 0.9024 | 6 | 492 |
| 8pn7-assembly1.cif.gz_E | engineered glycolyl-coa carboxylase (g20r variant) with bound coa | 0.9015 | 5 | 492 |
| 1vrg-assembly1.cif.gz_F | crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution | 0.8995 | 1 | 492 |
| 1on3-assembly1.cif.gz_E | transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) | 0.8985 | 5 | 492 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20676_22_285_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8982 | 4 | 234 | 3.90.226.10 |
| 4l6wA02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8892 | 240 | 473 | 3.90.226.10 |
| 4fb8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8888 | 75 | 219 | 3.90.226.10 |
| 5fifB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8882 | 247 | 473 | 3.90.226.10 |
| 3h0sB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8776 | 75 | 226 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1VRZ5-F1-model_v4 | CoA carboxyltransferase C-terminal domain-containing protein | 0.9981 | 245 | 339 |
GO:0004658
|
| AF-H1QFV4-F1-model_v4 | deleted | 0.9938 | 254 | 341 |
|
| AF-M9TIK7-F1-model_v4 | Acetyl-CoA carboxylase alpha subunit | 0.9936 | 155 | 304 |
GO:0004658
|
| AF-A0A4Q0IVL7-F1-model_v4 | deleted | 0.9907 | 187 | 316 |
|
| AF-A8YPL3-F1-model_v4 | Acetyl-CoA carboxylase alpha subunit (EC 6.4.1.2) | 0.9856 | 155 | 274 |
GO:0003989
GO:0004658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar