F457350

General Info

Members Datasets Scaffolds Average Seq Length
511 237 511 509

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_154256_c1|nmdc:mga05p37_154256_c1_883_2238
Length 439
Sequence MDEQVVPGDGVVAGVGRVDGRPVYAFAQDFTVFGGSLSETNAAKIVKIMDLAVKMGAPVVGLNDSGGARIQEGVLSLGGYADIFLRNTLASGVIPQISAIMGPCAGGAVYSPAITDFIVMVKQSSYMFITGPDVIKTVTHEDVSMEDLGGAMTHNEKSGVAHFAVEDDAECIALIRELLSFMPDNNLDDPPRKATTLVPASPNQPYDMLDLIHTIADEGYFLEVHQHYAKNIVVGFARLGGRPVGVVANQPAHLAGTLDINASVKGARFVRFCDAFNIPLITFEDVPGFLPGTVQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYCVMASKHIRTDFNYAWPSAEIAVMGAEGAVNILYKREIEKSADPAAMRAQKIGEFRDRFASPYVAAERGYIDEVILPRMTRAKLVQALATLDHKRDKNPPKKHGNIPL

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.13
Nodule 0
Rhizoplane 3.33
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10005675 3300002459 Bacteria 2543
2 JGI25406J46586_10007699 3300003203 Bacteria 4899
3 Ga0065712_10001865 3300005290 Bacteria 12263
4 Ga0065712_10068417 3300005290 Bacteria 10780
5 Ga0065712_10068680 3300005290 Bacteria 9413
6 Ga0065712_10077523 3300005290 Bacteria 3482
7 Ga0065712_10079275 3300005290 Bacteria 3238
8 Ga0065712_10089783 3300005290 Bacteria 2453
9 Ga0065712_10104388 3300005290 Bacteria 1953
10 Ga0065715_10099172 3300005293 Bacteria 3448
11 Ga0065715_10101548 3300005293 Bacteria 3193
12 Ga0065715_10107958 3300005293 Bacteria 2743
13 Ga0065707_10001522 3300005295 Bacteria 8991
14 Ga0065707_10002910 3300005295 Bacteria 9923
15 Ga0065707_10097767 3300005295 Bacteria 3144
16 Ga0065707_10105067 3300005295 Bacteria 2660
17 Ga0070676_10010750 3300005328 Bacteria 4966
18 Ga0070670_100011093 3300005331 Bacteria 7698
19 Ga0070670_100014785 3300005331 Bacteria 6698
20 Ga0070670_100017601 3300005331 Bacteria 6133
21 Ga0070670_100023960 3300005331 Bacteria 5250
22 Ga0068869_100000256 3300005334 Bacteria 28007
23 Ga0070666_10136307 3300005335 Bacteria 1708
24 Ga0070660_100013139 3300005339 Bacteria 5932
25 Ga0070689_100007394 3300005340 Bacteria 7675
26 Ga0070689_100071424 3300005340 Bacteria 2712
27 Ga0070689_100133210 3300005340 Bacteria 1994
28 Ga0070691_10012035 3300005341 Bacteria 3962
29 Ga0070687_100028003 3300005343 Bacteria 2728
30 Ga0070669_100002881 3300005353 Bacteria 12405
31 Ga0070669_100079022 3300005353 Bacteria 2446
32 Ga0070675_100000311 3300005354 Bacteria 32685
33 Ga0070675_100002200 3300005354 Bacteria 14456
34 Ga0070675_100002452 3300005354 Bacteria 13868
35 Ga0070675_100007377 3300005354 Bacteria 8493
36 Ga0070674_100000735 3300005356 Bacteria 16733
37 Ga0070674_100001848 3300005356 Bacteria 11486
38 Ga0070674_100002130 3300005356 Bacteria 10872
39 Ga0070674_100131485 3300005356 Bacteria 1866
40 Ga0070673_100018890 3300005364 Bacteria 4940
41 Ga0070673_100172743 3300005364 Bacteria 1845
42 Ga0070688_100006975 3300005365 Bacteria 6071
43 Ga0070659_100010629 3300005366 Bacteria 6778
44 Ga0070667_100028989 3300005367 Bacteria 4609
45 Ga0070667_100095032 3300005367 Bacteria 2569
46 Ga0070714_100005034 3300005435 Bacteria 10049
47 Ga0070701_10003990 3300005438 Bacteria 5910
48 Ga0070705_100079626 3300005440 Bacteria 2007
49 Ga0070708_100000002 3300005445 Bacteria 195857
50 Ga0070678_100020951 3300005456 Bacteria 4300
51 Ga0070678_100024033 3300005456 Bacteria 4072
52 Ga0070678_100030823 3300005456 Bacteria 3691
53 Ga0070662_100073925 3300005457 Bacteria 2520
54 Ga0070681_10019926 3300005458 Bacteria 6720
55 Ga0070681_10067199 3300005458 Bacteria 3553
56 Ga0068867_100011691 3300005459 Bacteria 6198
57 Ga0070706_100091154 3300005467 Bacteria 2827
58 Ga0070698_100001813 3300005471 Bacteria 23753
59 Ga0070698_100002188 3300005471 Bacteria 21703
60 Ga0070698_100006892 3300005471 Bacteria 12313
61 Ga0070698_100018706 3300005471 Bacteria 7293
62 Ga0070698_100136158 3300005471 Bacteria 2410
63 Ga0070698_100153230 3300005471 Bacteria 2251
64 Ga0070699_100000980 3300005518 Bacteria 26618
65 Ga0070699_100001754 3300005518 Bacteria 19774
66 Ga0070699_100004768 3300005518 Bacteria 11989
67 Ga0070684_100015248 3300005535 Bacteria 6252
68 Ga0070684_100024056 3300005535 Bacteria 5106
69 Ga0070684_100075794 3300005535 Bacteria 2968
70 Ga0070697_100027184 3300005536 Bacteria 4575
71 Ga0070697_100078283 3300005536 Bacteria 2720
72 Ga0070672_100015797 3300005543 Bacteria 5390
73 Ga0070672_100030420 3300005543 Bacteria 4056
74 Ga0070686_100004936 3300005544 Bacteria 7355
75 Ga0070686_100028383 3300005544 Bacteria 3394
76 Ga0070686_100066538 3300005544 Bacteria 2344
77 Ga0070686_100138756 3300005544 Bacteria 1690
78 Ga0070695_100031758 3300005545 Bacteria 3297
79 Ga0070696_100060492 3300005546 Bacteria 2648
80 Ga0070693_100021406 3300005547 Bacteria 3425
81 Ga0070665_100001061 3300005548 Bacteria 34294
82 Ga0070665_100112265 3300005548 Bacteria 2728
83 Ga0070704_100003231 3300005549 Bacteria 9316
84 Ga0070704_100036021 3300005549 Bacteria 3367
85 Ga0068855_100040709 3300005563 Bacteria 5513
86 Ga0070664_100000832 3300005564 Bacteria 23806
87 Ga0070664_100031404 3300005564 Bacteria 4438
88 Ga0070664_100048400 3300005564 Bacteria 3593
89 Ga0070664_100155113 3300005564 Bacteria 2023
90 Ga0068857_100029433 3300005577 Bacteria 4847
91 Ga0068854_100002437 3300005578 Bacteria 11500
92 Ga0068854_100006157 3300005578 Bacteria 7616
93 Ga0070702_100050355 3300005615 Bacteria 2379
94 Ga0068859_100013874 3300005617 Bacteria 8081
95 Ga0068859_100018112 3300005617 Bacteria 7079
96 Ga0068859_100029054 3300005617 Bacteria 5547
97 Ga0068864_100009517 3300005618 Bacteria 8019
98 Ga0068864_100030550 3300005618 Bacteria 4567
99 Ga0068866_10002372 3300005718 Bacteria 7813
100 Ga0068861_100028062 3300005719 Bacteria 4105
101 Ga0068861_100161312 3300005719 Bacteria 1850
102 Ga0068851_10008332 3300005834 Bacteria 4793
103 Ga0068863_100031041 3300005841 Bacteria 5102
104 Ga0068863_100044292 3300005841 Bacteria 4225
105 Ga0068863_100067747 3300005841 Bacteria 3377
106 Ga0068858_100006773 3300005842 Bacteria 11149
107 Ga0068858_100132773 3300005842 Bacteria 2335
108 Ga0068860_100064216 3300005843 Bacteria 3487
109 Ga0068862_100044485 3300005844 Bacteria 3787
110 Ga0068862_100048217 3300005844 Bacteria 3636
111 Ga0081539_10000110 3300005985 Bacteria 190555
112 Ga0075365_10011620 3300006038 Bacteria 5187
113 Ga0075365_10044558 3300006038 Bacteria 2908
114 Ga0075368_10032959 3300006042 Bacteria 2014
115 Ga0075362_10001435 3300006177 Bacteria 7610
116 Ga0075367_10001698 3300006178 Bacteria 9630
117 Ga0075366_10045956 3300006195 Bacteria 2587
118 Ga0097621_100016903 3300006237 Bacteria 5530
119 Ga0068871_100001984 3300006358 Bacteria 13869
120 Ga0068871_100132725 3300006358 Bacteria 2112
121 Ga0075428_100000030 3300006844 Bacteria 119551
122 Ga0075428_100000673 3300006844 Bacteria 35072
123 Ga0075428_100000931 3300006844 Bacteria 30952
124 Ga0075428_100006014 3300006844 Bacteria 13480
125 Ga0075428_100008375 3300006844 Bacteria 11464
126 Ga0075428_100008632 3300006844 Bacteria 11301
127 Ga0075428_100026750 3300006844 Bacteria 6388
128 Ga0075428_100038724 3300006844 Bacteria 5246
129 Ga0075428_100112270 3300006844 Bacteria 2968
130 Ga0075430_100000398 3300006846 Bacteria 32154
131 Ga0075430_100002425 3300006846 Bacteria 15524
132 Ga0075430_100009976 3300006846 Bacteria 8035
133 Ga0075431_100001977 3300006847 Bacteria 19558
134 Ga0075431_100012354 3300006847 Bacteria 8618
135 Ga0075431_100016547 3300006847 Bacteria 7485
136 Ga0075431_100018355 3300006847 Bacteria 7123
137 Ga0075431_100112615 3300006847 Bacteria 2808
138 Ga0075433_10044987 3300006852 Bacteria 3836
139 Ga0075434_100002491 3300006871 Bacteria 16225
140 Ga0075434_100003288 3300006871 Bacteria 14448
141 Ga0075434_100108317 3300006871 Bacteria 2789
142 Ga0075429_100004255 3300006880 Bacteria 12272
143 Ga0075429_100005123 3300006880 Bacteria 11271
144 Ga0075429_100006190 3300006880 Bacteria 10349
145 Ga0075429_100030035 3300006880 Bacteria 4721
146 Ga0068865_100073067 3300006881 Bacteria 2438
147 Ga0075436_100002164 3300006914 Bacteria 13538
148 Ga0075436_100038228 3300006914 Bacteria 3312
149 Ga0097620_100013874 3300006931 Bacteria 8081
150 Ga0097620_100018112 3300006931 Bacteria 7079
151 Ga0097620_100029055 3300006931 Bacteria 5547
152 Ga0075435_100000034 3300007076 Bacteria 70048
153 Ga0075435_100000542 3300007076 Bacteria 23134
154 Ga0075435_100012725 3300007076 Bacteria 6234
155 Ga0075435_100030226 3300007076 Bacteria 4257
156 Ga0075435_100039586 3300007076 Bacteria 3762
157 Ga0075435_100106714 3300007076 Bacteria 2326
158 Ga0111539_10000015 3300009094 Bacteria 296576
159 Ga0111539_10000174 3300009094 Bacteria 74442
160 Ga0111539_10000657 3300009094 Bacteria 44621
161 Ga0111539_10002052 3300009094 Bacteria 26949
162 Ga0111539_10002159 3300009094 Bacteria 26325
163 Ga0111539_10042646 3300009094 Bacteria 5446
164 Ga0111539_10108842 3300009094 Bacteria 3252
165 Ga0111539_10116685 3300009094 Bacteria 3130
166 Ga0105245_10043479 3300009098 Bacteria 4007
167 Ga0105245_10147065 3300009098 Bacteria 2224
168 Ga0114129_10000288 3300009147 Bacteria 58119
169 Ga0114129_10000581 3300009147 Bacteria 45128
170 Ga0114129_10001174 3300009147 Bacteria 34722
171 Ga0114129_10006497 3300009147 Bacteria 16580
172 Ga0114129_10058684 3300009147 Bacteria 5382
173 Ga0114129_10095275 3300009147 Bacteria 4122
174 Ga0105243_10013558 3300009148 Bacteria 6166
175 Ga0105243_10049415 3300009148 Bacteria 3318
176 Ga0105242_10006802 3300009176 Bacteria 8818
177 Ga0105242_10007503 3300009176 Bacteria 8391
178 Ga0105248_10019397 3300009177 Bacteria 7523
179 Ga0105248_10143370 3300009177 Bacteria 2695
180 Ga0105237_10081662 3300009545 Bacteria 3223
181 Ga0105238_10002716 3300009551 Bacteria 17617
182 Ga0105249_10001257 3300009553 Bacteria 22240
183 Ga0105249_10052897 3300009553 Bacteria 3710
184 Ga0157374_10087859 3300013296 Bacteria 2960
185 Ga0163162_10024574 3300013306 Bacteria 5950
186 Ga0163163_10000005 3300014325 Bacteria 369548
187 Ga0163163_10015247 3300014325 Bacteria 7100
188 Ga0163163_10033344 3300014325 Bacteria 4981
189 Ga0163163_10041293 3300014325 Bacteria 4510
190 Ga0157380_10000415 3300014326 Bacteria 25998
191 Ga0157380_10000549 3300014326 Bacteria 23122
192 Ga0157380_10031476 3300014326 Bacteria 4073
193 Ga0157380_10040295 3300014326 Bacteria 3637
194 Ga0157380_10081845 3300014326 Bacteria 2642
195 Ga0157377_10058027 3300014745 Bacteria 2203
196 Ga0157376_10074275 3300014969 Bacteria 2898
197 Ga0206356_11870653 3300020070 Bacteria 1974
198 Ga0207697_10008950 3300025315 Bacteria 4349
199 Ga0207656_10005665 3300025321 Bacteria 4435
200 Ga0207682_10013055 3300025893 Bacteria 3239
201 Ga0207682_10024964 3300025893 Bacteria 2369
202 Ga0207642_10004075 3300025899 Bacteria 4681
203 Ga0207688_10016857 3300025901 Bacteria 3967
204 Ga0207680_10037340 3300025903 Bacteria 2804
205 Ga0207645_10005378 3300025907 Bacteria 9299
206 Ga0207684_10008593 3300025910 Bacteria 9079
207 Ga0207684_10067468 3300025910 Bacteria 3040
208 Ga0207707_10016097 3300025912 Bacteria 6521
209 Ga0207707_10029951 3300025912 Bacteria 4759
210 Ga0207707_10055167 3300025912 Bacteria 3457
211 Ga0207695_10141094 3300025913 Bacteria 2358
212 Ga0207671_10068672 3300025914 Bacteria 2641
213 Ga0207662_10003753 3300025918 Bacteria 7875
214 Ga0207657_10008592 3300025919 Bacteria 10343
215 Ga0207652_10021929 3300025921 Bacteria 5277
216 Ga0207646_10092831 3300025922 Bacteria 2702
217 Ga0207681_10062183 3300025923 Bacteria 2569
218 Ga0207681_10104325 3300025923 Bacteria 2050
219 Ga0207694_10004377 3300025924 Bacteria 11026
220 Ga0207694_10165195 3300025924 Bacteria 1790
221 Ga0207650_10011044 3300025925 Bacteria 6210
222 Ga0207650_10097992 3300025925 Bacteria 2252
223 Ga0207659_10000975 3300025926 Bacteria 17069
224 Ga0207659_10008248 3300025926 Bacteria 6456
225 Ga0207659_10013544 3300025926 Bacteria 5228
226 Ga0207659_10020371 3300025926 Bacteria 4383
227 Ga0207659_10059162 3300025926 Bacteria 2753
228 Ga0207687_10039424 3300025927 Bacteria 3234
229 Ga0207687_10068596 3300025927 Bacteria 2526
230 Ga0207644_10021961 3300025931 Bacteria 4354
231 Ga0207644_10023772 3300025931 Bacteria 4201
232 Ga0207690_10057404 3300025932 Bacteria 2630
233 Ga0207686_10002593 3300025934 Bacteria 9810
234 Ga0207686_10006503 3300025934 Bacteria 6292
235 Ga0207686_10018478 3300025934 Bacteria 3948
236 Ga0207709_10007528 3300025935 Bacteria 6052
237 Ga0207709_10022240 3300025935 Bacteria 3595
238 Ga0207670_10009719 3300025936 Bacteria 5505
239 Ga0207670_10051061 3300025936 Bacteria 2775
240 Ga0207669_10000576 3300025937 Bacteria 15967
241 Ga0207669_10020315 3300025937 Bacteria 3480
242 Ga0207704_10008141 3300025938 Bacteria 4993
243 Ga0207704_10010027 3300025938 Bacteria 4599
244 Ga0207704_10061764 3300025938 Bacteria 2326
245 Ga0207691_10004280 3300025940 Bacteria 13865
246 Ga0207691_10005737 3300025940 Bacteria 12008
247 Ga0207691_10035559 3300025940 Bacteria 4622
248 Ga0207691_10078308 3300025940 Bacteria 2976
249 Ga0207711_10113018 3300025941 Bacteria 2418
250 Ga0207689_10000674 3300025942 Bacteria 32586
251 Ga0207689_10071885 3300025942 Bacteria 2842
252 Ga0207689_10085545 3300025942 Bacteria 2592
253 Ga0207689_10119829 3300025942 Bacteria 2165
254 Ga0207661_10102254 3300025944 Bacteria 2409
255 Ga0207679_10025199 3300025945 Bacteria 4088
256 Ga0207679_10034123 3300025945 Bacteria 3587
257 Ga0207667_10056520 3300025949 Bacteria 4122
258 Ga0207651_10015926 3300025960 Bacteria 4387
259 Ga0207651_10030871 3300025960 Bacteria 3418
260 Ga0207712_10004150 3300025961 Bacteria 9149
261 Ga0207640_10007641 3300025981 Bacteria 5971
262 Ga0207658_10028480 3300025986 Bacteria 3934
263 Ga0207703_10159847 3300026035 Bacteria 1972
264 Ga0207678_10012995 3300026067 Bacteria 7306
265 Ga0207678_10045519 3300026067 Bacteria 3794
266 Ga0207708_10001495 3300026075 Bacteria 17422
267 Ga0207708_10006720 3300026075 Bacteria 8509
268 Ga0207708_10014468 3300026075 Bacteria 5906
269 Ga0207708_10069070 3300026075 Bacteria 2705
270 Ga0207641_10183273 3300026088 Bacteria 1919
271 Ga0207648_10001691 3300026089 Bacteria 24165
272 Ga0207676_10102496 3300026095 Bacteria 2376
273 Ga0207675_100025629 3300026118 Bacteria 5488
274 Ga0207675_100044351 3300026118 Bacteria 4155
275 Ga0207675_100093292 3300026118 Bacteria 2831
276 Ga0207683_10018524 3300026121 Bacteria 5942
277 Ga0207683_10022945 3300026121 Bacteria 5364
278 Ga0207683_10046565 3300026121 Bacteria 3796
279 Ga0207683_10089956 3300026121 Bacteria 2733
280 Ga0207683_10112448 3300026121 Bacteria 2439
281 Ga0207683_10135021 3300026121 Bacteria 2221
282 Ga0207428_10000048 3300027907 Bacteria 180760
283 Ga0207428_10001403 3300027907 Bacteria 25443
284 Ga0207428_10002183 3300027907 Bacteria 19663
285 Ga0207428_10015984 3300027907 Bacteria 6470
286 Ga0268266_10002445 3300028379 Bacteria 19927
287 Ga0268266_10098920 3300028379 Bacteria 2567
288 Ga0268266_10235430 3300028379 Bacteria 1688
289 Ga0268264_10011433 3300028381 Bacteria 7331
290 Ga0307513_10009939 3300031456 Bacteria 11999
291 Ga0307408_100005017 3300031548 Bacteria 8878
292 Ga0307408_100009904 3300031548 Bacteria 6279
293 Ga0307408_100024339 3300031548 Bacteria 4133
294 Ga0307408_100048717 3300031548 Bacteria 3040
295 Ga0307405_10073182 3300031731 Bacteria 2211
296 Ga0307413_10008047 3300031824 Bacteria 4947
297 Ga0307413_10024351 3300031824 Bacteria 3299
298 Ga0307410_10009285 3300031852 Bacteria 5509
299 Ga0307410_10036675 3300031852 Bacteria 3195
300 Ga0307410_10082640 3300031852 Bacteria 2260
301 Ga0307407_10021381 3300031903 Bacteria 3335
302 Ga0307407_10039358 3300031903 Bacteria 2629
303 Ga0307412_10012962 3300031911 Bacteria 4874
304 Ga0307412_10048355 3300031911 Bacteria 2797
305 Ga0307409_100000402 3300031995 Bacteria 18423
306 Ga0307409_100020749 3300031995 Bacteria 4486
307 Ga0307409_100045657 3300031995 Bacteria 3309
308 Ga0307409_100056397 3300031995 Bacteria 3038
309 Ga0307409_100242837 3300031995 Bacteria 1641
310 Ga0307416_100038785 3300032002 Bacteria 3679
311 Ga0307416_100041405 3300032002 Bacteria 3587
312 Ga0307416_100044313 3300032002 Bacteria 3492
313 Ga0307416_100060127 3300032002 Bacteria 3092
314 Ga0307416_100079312 3300032002 Bacteria 2766
315 Ga0307416_100097160 3300032002 Bacteria 2550
316 Ga0307416_100119525 3300032002 Bacteria 2344
317 Ga0307411_10008127 3300032005 Bacteria 5411
318 Ga0307411_10028199 3300032005 Bacteria 3410
319 Ga0307411_10046951 3300032005 Bacteria 2788
320 Ga0307415_100009010 3300032126 Bacteria 5566
321 Ga0373934_0000606 3300035086 Bacteria 12643
322 Ga0373941_0001687 3300035115 Bacteria 4729
323 Ga0373956_0003542 3300035119 Bacteria 6293
324 Ga0373955_0003243 3300035172 Bacteria 7126
325 Ga0373935_0087192 3300035692 Bacteria 2038
326 Ga0373937_0000387 3300036401 Bacteria 41007
327 Ga0373925_0006974 3300037068 Bacteria 8262
328 Ga0439446_0019092 3300042156 Bacteria 1926
329 Ga0439434_0006671 3300042435 Bacteria 3373
330 Ga0439464_0030765 3300042439 Bacteria 1504
331 Ga0451576_0003740 3300045051 Bacteria 20566
332 Ga0451576_0009851 3300045051 Bacteria 11041
333 Ga0451576_0049993 3300045051 Bacteria 4386
334 Ga0451576_0053012 3300045051 Bacteria 4250
335 Ga0451576_0106536 3300045051 Bacteria 2917
336 Ga0495603_0011818 3300046455 Bacteria 5284
337 Ga0495629_0008227 3300046459 Bacteria 7668
338 Ga0495584_0033012 3300046491 Bacteria 2618
339 Ga0495594_0006783 3300046499 Bacteria 5888
340 Ga0495628_0072683 3300046516 Bacteria 2680
341 Ga0495643_0011558 3300046522 Bacteria 5370
342 Ga0495621_0001796 3300046539 Bacteria 5638
343 Ga0495621_0021083 3300046539 Bacteria 2145
344 Ga0495634_0156804 3300046642 Bacteria 1437
345 Ga0495588_0011078 3300046674 Bacteria 4221
346 Ga0495599_0083031 3300046678 Bacteria 2001
347 Ga0495658_0018058 3300046683 Bacteria 3660
348 Ga0495613_0110108 3300046689 Bacteria 1985
349 Ga0495604_0108915 3300047317 Bacteria 2023
350 Ga0496102_0161896 3300048905 Bacteria 2105
351 Ga0496104_0001099 3300048907 Bacteria 23136
352 Ga0496104_0080281 3300048907 Bacteria 3110
353 Ga0496106_0198942 3300048909 Bacteria 1594
354 Ga0496108_0078403 3300048911 Bacteria 2796
355 Ga0496108_0091880 3300048911 Bacteria 2580
356 Ga0496109_0079324 3300048912 Bacteria 3024
357 Ga0496109_0128755 3300048912 Bacteria 2362
358 Ga0496110_0003707 3300048913 Bacteria 11764
359 Ga0496110_0020594 3300048913 Bacteria 5571
360 Ga0496111_0088149 3300048914 Bacteria 2272
361 Ga0496112_0068255 3300048915 Bacteria 3510
362 Ga0496112_0076860 3300048915 Bacteria 3302
363 Ga0496112_0182968 3300048915 Bacteria 2059
364 Ga0496113_0147357 3300048916 Bacteria 1855
365 Ga0496114_0119760 3300048917 Bacteria 2263
366 Ga0496114_0154663 3300048917 Bacteria 1991
367 Ga0501031_0012441 3300049568 Bacteria 5552
368 Ga0501031_0077778 3300049568 Bacteria 2161
369 Ga0501032_0021792 3300049569 Bacteria 4450
370 Ga0501034_0001388 3300049571 Bacteria 32580
371 Ga0501034_0001525 3300049571 Bacteria 30418
372 Ga0501034_0053414 3300049571 Bacteria 4068
373 Ga0501036_0047532 3300049572 Bacteria 3634
374 Ga0501036_0076137 3300049572 Bacteria 2839
375 Ga0501038_0025399 3300049574 Bacteria 5281
376 Ga0501038_0102636 3300049574 Bacteria 2379
377 Ga0501039_0078018 3300049575 Bacteria 2576
378 Ga0501040_0002796 3300049576 Bacteria 11246
379 Ga0501040_0067942 3300049576 Bacteria 2457
380 Ga0501041_0008737 3300049577 Bacteria 5964
381 Ga0501041_0067277 3300049577 Bacteria 2196
382 Ga0501042_0001976 3300049578 Bacteria 12358
383 Ga0501043_0000899 3300049579 Bacteria 26386
384 Ga0501043_0044925 3300049579 Bacteria 3475
385 Ga0501043_0085432 3300049579 Bacteria 2480
386 Ga0501046_0006626 3300049580 Bacteria 10226
387 Ga0501046_0154569 3300049580 Bacteria 1729
388 Ga0501047_0001422 3300049581 Bacteria 23491
389 Ga0501047_0001540 3300049581 Bacteria 22545
390 Ga0501047_0063885 3300049581 Bacteria 3551
391 Ga0501048_0008042 3300049582 Bacteria 7988
392 Ga0501048_0025998 3300049582 Bacteria 4264
393 Ga0501067_0076716 3300049583 Bacteria 1852
394 Ga0501069_0005956 3300049585 Bacteria 6361
395 Ga0501069_0022519 3300049585 Bacteria 3428
396 Ga0501070_0187038 3300049586 Bacteria 1703
397 Ga0501071_0008680 3300049587 Bacteria 6723
398 Ga0501071_0037904 3300049587 Bacteria 3444
399 Ga0501072_0023678 3300049588 Bacteria 4771
400 Ga0501072_0045285 3300049588 Bacteria 3459
401 Ga0501072_0045289 3300049588 Bacteria 3458
402 Ga0501073_0081209 3300049589 Bacteria 2255
403 Ga0501074_0032845 3300049590 Bacteria 3760
404 Ga0501074_0046671 3300049590 Bacteria 3132
405 Ga0501074_0074202 3300049590 Bacteria 2443
406 Ga0501074_0153747 3300049590 Bacteria 1644
407 Ga0501075_0001452 3300049591 Bacteria 15416
408 Ga0501076_0002028 3300049592 Bacteria 13861
409 Ga0501076_0002929 3300049592 Bacteria 11836
410 Ga0501076_0053990 3300049592 Bacteria 3185
411 Ga0501076_0073132 3300049592 Bacteria 2744
412 Ga0501076_0091562 3300049592 Bacteria 2446
413 Ga0501076_0145623 3300049592 Bacteria 1926
414 Ga0501077_0020923 3300049593 Bacteria 4141
415 Ga0501077_0023625 3300049593 Bacteria 3898
416 Ga0501077_0050840 3300049593 Bacteria 2634
417 Ga0501077_0064615 3300049593 Bacteria 2321
418 Ga0501077_0115013 3300049593 Bacteria 1705
419 Ga0501079_0001840 3300049741 Bacteria 15189
420 Ga0501079_0029581 3300049741 Bacteria 4206
421 Ga0501079_0050125 3300049741 Bacteria 3223
422 Ga0501079_0132836 3300049741 Bacteria 1937
423 Ga0501079_0135330 3300049741 Bacteria 1918
424 Ga0501080_0012848 3300049742 Bacteria 7682
425 Ga0501081_0033058 3300049743 Bacteria 3512
426 Ga0501083_0044099 3300049744 Bacteria 3019
427 Ga0501035_0021878 3300049822 Bacteria 5875
428 Ga0501044_0007926 3300049823 Bacteria 11673
429 Ga0501044_0012726 3300049823 Bacteria 9112
430 Ga0501044_0046001 3300049823 Bacteria 4520
431 Ga0501045_0000979 3300049824 Bacteria 18694
432 Ga0501045_0123847 3300049824 Bacteria 1920
433 nmdc:mga03683_719_c1 3300050489 Bacteria 9504
434 nmdc:mga00v17_27098_c1 3300050491 Bacteria 3343
435 nmdc:mga0yw44_4529_c1 3300050492 Bacteria 6393
436 nmdc:mga0k408_51708_c1 3300050493 Bacteria 2381
437 nmdc:mga0k408_92373_c1 3300050493 Bacteria 1779
438 nmdc:mga06z11_24730_c1 3300050494 Bacteria 2838
439 nmdc:mga06z11_47833_c1 3300050494 Bacteria 2174
440 nmdc:mga05p37_129088_c1 3300050507 Bacteria 3103
441 nmdc:mga05p37_154256_c1 3300050507 Bacteria 2807
442 nmdc:mga05p37_29662_c1 3300050507 Bacteria 6675
443 nmdc:mga05p37_4830_c1 3300050507 Bacteria 15760
444 nmdc:mga05p37_5552_c1 3300050507 Bacteria 14822
445 nmdc:mga05p37_5913_c1 3300050507 Bacteria 14391
446 nmdc:mga05p37_6192_c1 3300050507 Bacteria 14087
447 nmdc:mga05p37_66131_c1 3300050507 Bacteria 4447
448 nmdc:mga05p37_66250_c2 3300050507 Bacteria 4075
449 nmdc:mga05p37_8223_c1 3300050507 Bacteria 11601
450 nmdc:mga05p37_832_c1 3300050507 Bacteria 34564
451 nmdc:mga05p37_85623_c1 3300050507 Bacteria 3884
452 nmdc:mga05p37_92704_c1 3300050507 Bacteria 3722
453 nmdc:mga09592_1002_c1 3300050508 Bacteria 22398
454 nmdc:mga09592_11816_c1 3300050508 Bacteria 7101
455 nmdc:mga09592_7154_c1 3300050508 Bacteria 9070
456 nmdc:mga09592_8692_c1 3300050508 Bacteria 8261
457 nmdc:mga0qj67_1417_c1 3300050509 Bacteria 16782
458 nmdc:mga0qj67_16701_c1 3300050509 Bacteria 5572
459 nmdc:mga06r32_116436_c1 3300050510 Bacteria 2633
460 nmdc:mga06r32_13806_c1 3300050510 Bacteria 7327
461 nmdc:mga06r32_22840_c1 3300050510 Bacteria 5786
462 nmdc:mga06r32_4238_c1 3300050510 Bacteria 12849
463 nmdc:mga06r32_6938_c1 3300050510 Bacteria 10186
464 nmdc:mga08y16_18417_c1 3300050511 Bacteria 7360
465 nmdc:mga08y16_226_c1 3300050511 Bacteria 50561
466 nmdc:mga08y16_26216_c1 3300050511 Bacteria 6147
467 nmdc:mga08y16_3818_c1 3300050511 Bacteria 15671
468 nmdc:mga08y16_527_c1 3300050511 Bacteria 35360
469 nmdc:mga08y16_69084_c1 3300050511 Bacteria 3683
470 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
471 nmdc:mga0n895_10512_c1 3300050512 Bacteria 8186
472 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
473 nmdc:mga0n895_68981_c1 3300050512 Bacteria 3502
474 nmdc:mga0n895_71366_c1 3300050512 Bacteria 3443
475 nmdc:mga0n895_7773_c1 3300050512 Bacteria 9236
476 nmdc:mga0n895_93694_c1 3300050512 Bacteria 3007
477 nmdc:mga0rr50_104213_c1 3300050513 Bacteria 2234
478 nmdc:mga0rr50_11772_c1 3300050513 Bacteria 5615
479 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
480 nmdc:mga0rr50_326_c1 3300050513 Bacteria 25897
481 nmdc:mga0rr50_5246_c1 3300050513 Bacteria 7710
482 nmdc:mga08x19_1476_c1 3300050514 Bacteria 14566
483 nmdc:mga08x19_23388_c1 3300050514 Bacteria 3834
484 nmdc:mga08x19_79423_c1 3300050514 Bacteria 2152
485 nmdc:mga0a205_13380_c1 3300050515 Bacteria 7638
486 nmdc:mga0a205_13986_c2 3300050515 Bacteria 5103
487 Ga0495601_0136829 3300053077 Bacteria 1597
488 Ga0495619_0076176 3300053085 Bacteria 2252
489 Ga0495619_0102612 3300053085 Bacteria 1948
490 Ga0500555_002706 3300053103 Bacteria 5099
491 Ga0500616_0003153 3300053153 Bacteria 12863
492 Ga0500645_000514 3300053730 Bacteria 25995
493 Ga0501084_0006120 3300054114 Bacteria 9892
494 Ga0501084_0010694 3300054114 Bacteria 7595
495 Ga0501084_0033139 3300054114 Bacteria 4321
496 Ga0501084_0093528 3300054114 Bacteria 2524
497 Ga0590071_000152 3300059421 Bacteria 19812
498 Ga0590071_001725 3300059421 Bacteria 5642
499 Ga0590071_002572 3300059421 Bacteria 4564
500 Ga0590071_003768 3300059421 Bacteria 3720
501 Ga0590071_005352 3300059421 Bacteria 3089
502 Ga0590074_000017 3300059423 Bacteria 20687
503 Ga0590075_002020 3300059424 Bacteria 4890
504 Ga0590075_003519 3300059424 Bacteria 3719
505 Ga0590075_019609 3300059424 Bacteria 1679
506 Ga0590077_000362 3300059426 Bacteria 12805
507 Ga0501082_0001004 3300060353 Bacteria 24909
508 Ga0501082_0056378 3300060353 Bacteria 3384
509 Ga0530510_0000888 3300061734 Bacteria 19730
510 Ga0530510_0019754 3300061734 Bacteria 4786
511 Ga0530510_0063973 3300061734 Bacteria 2664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_154256_c1 nmdc:mga05p37_154256_c1_883_2238 418
2 3300046642 Ga0495634_0156804 Ga0495634_0156804_89_1372 427
3 3300005435 Ga0070714_100005034 Ga0070714_1000050345 430
4 3300009148 Ga0105243_10013558 Ga0105243_100135582 430
5 3300042439 Ga0439464_0030765 Ga0439464_0030765_135_1490 430
6 3300050507 nmdc:mga05p37_92704_c1 nmdc:mga05p37_92704_c1_2157_3512 430
7 3300050510 nmdc:mga06r32_116436_c1 nmdc:mga06r32_116436_c1_1246_2601 430
8 3300050513 nmdc:mga0rr50_104213_c1 nmdc:mga0rr50_104213_c1_839_2194 430
9 3300060353 Ga0501082_0056378 Ga0501082_0056378_2001_3356 430
10 3300005356 Ga0070674_100000735 Ga0070674_1000007353 439
11 3300005719 Ga0068861_100028062 Ga0068861_1000280622 439
12 3300025923 Ga0207681_10062183 Ga0207681_100621832 439
13 3300026118 Ga0207675_100044351 Ga0207675_1000443512 439
14 3300049581 Ga0501047_0063885 Ga0501047_0063885_1262_2650 441
15 3300005290 Ga0065712_10068680 Ga0065712_100686808 455
16 3300005295 Ga0065707_10105067 Ga0065707_101050671 455
17 3300005340 Ga0070689_100071424 Ga0070689_1000714242 455
18 3300025936 Ga0207670_10051061 Ga0207670_100510612 455
19 3300025945 Ga0207679_10025199 Ga0207679_100251993 455
20 3300025922 Ga0207646_10092831 Ga0207646_100928312 461
21 3300031548 Ga0307408_100048717 Ga0307408_1000487172 475
22 3300031456 Ga0307513_10009939 Ga0307513_100099393 476
23 3300035086 Ga0373934_0000606 Ga0373934_0000606_5663_7204 476
24 3300035119 Ga0373956_0003542 Ga0373956_0003542_512_2053 476
25 3300035172 Ga0373955_0003243 Ga0373955_0003243_4093_5634 476
26 3300036401 Ga0373937_0000387 Ga0373937_0000387_24589_26130 476
27 3300007076 Ga0075435_100039586 Ga0075435_1000395863 477
28 3300020070 Ga0206356_11870653 Ga0206356_118706532 477
29 3300005340 Ga0070689_100133210 Ga0070689_1001332102 479
30 3300005617 Ga0068859_100018112 Ga0068859_1000181125 479
31 3300006931 Ga0097620_100018112 Ga0097620_1000181122 479
32 3300049590 Ga0501074_0074202 Ga0501074_0074202_471_2012 480
33 3300006844 Ga0075428_100000673 Ga0075428_10000067313 481
34 3300006846 Ga0075430_100000398 Ga0075430_10000039812 481
35 3300006847 Ga0075431_100001977 Ga0075431_10000197712 481
36 3300006880 Ga0075429_100004255 Ga0075429_1000042556 481
37 3300009094 Ga0111539_10000174 Ga0111539_1000017412 481
38 3300009147 Ga0114129_10000288 Ga0114129_1000028839 481
39 3300027907 Ga0207428_10001403 Ga0207428_100014032 481
40 3300031548 Ga0307408_100009904 Ga0307408_1000099046 481
41 3300032002 Ga0307416_100119525 Ga0307416_1001195252 481
42 3300050507 nmdc:mga05p37_832_c1 nmdc:mga05p37_832_c1_20895_22436 481
43 3300050508 nmdc:mga09592_1002_c1 nmdc:mga09592_1002_c1_10119_11660 481
44 3300050509 nmdc:mga0qj67_16701_c1 nmdc:mga0qj67_16701_c1_3147_4688 481
45 3300050510 nmdc:mga06r32_4238_c1 nmdc:mga06r32_4238_c1_737_2278 481
46 3300050511 nmdc:mga08y16_226_c1 nmdc:mga08y16_226_c1_24993_26534 481
47 3300006844 Ga0075428_100000931 Ga0075428_10000093111 482
48 3300006880 Ga0075429_100006190 Ga0075429_1000061905 482
49 3300050508 nmdc:mga09592_8692_c1 nmdc:mga09592_8692_c1_2213_3754 482
50 3300005471 Ga0070698_100002188 Ga0070698_1000021882 483
51 3300049579 Ga0501043_0085432 Ga0501043_0085432_91_1632 483
52 3300005457 Ga0070662_100073925 Ga0070662_1000739252 484
53 3300026067 Ga0207678_10045519 Ga0207678_100455192 484
54 3300026121 Ga0207683_10112448 Ga0207683_101124481 484
55 3300048907 Ga0496104_0080281 Ga0496104_0080281_67_1608 484
56 3300005290 Ga0065712_10079275 Ga0065712_100792753 488
57 3300005293 Ga0065715_10099172 Ga0065715_100991722 488
58 3300005456 Ga0070678_100020951 Ga0070678_1000209513 488
59 3300025315 Ga0207697_10008950 Ga0207697_100089505 488
60 3300025901 Ga0207688_10016857 Ga0207688_100168573 488
61 3300025903 Ga0207680_10037340 Ga0207680_100373401 488
62 3300025937 Ga0207669_10020315 Ga0207669_100203153 488
63 3300025944 Ga0207661_10102254 Ga0207661_101022542 488
64 3300026121 Ga0207683_10089956 Ga0207683_100899563 488
65 3300026121 Ga0207683_10135021 Ga0207683_101350212 488
66 3300028379 Ga0268266_10235430 Ga0268266_102354301 488
67 3300048911 Ga0496108_0078403 Ga0496108_0078403_1250_2779 488
68 3300048913 Ga0496110_0020594 Ga0496110_0020594_1076_2605 488
69 3300048915 Ga0496112_0076860 Ga0496112_0076860_961_2490 488
70 3300048917 Ga0496114_0154663 Ga0496114_0154663_273_1802 488
71 3300005295 Ga0065707_10001522 Ga0065707_100015224 489
72 3300005564 Ga0070664_100048400 Ga0070664_1000484003 489
73 3300005844 Ga0068862_100048217 Ga0068862_1000482172 489
74 3300009094 Ga0111539_10002159 Ga0111539_100021596 489
75 3300009094 Ga0111539_10116685 Ga0111539_101166853 489
76 3300009147 Ga0114129_10000581 Ga0114129_1000058112 489
77 3300014326 Ga0157380_10040295 Ga0157380_100402952 489
78 3300014745 Ga0157377_10058027 Ga0157377_100580272 489
79 3300025925 Ga0207650_10097992 Ga0207650_100979921 489
80 3300025940 Ga0207691_10035559 Ga0207691_100355592 489
81 3300025960 Ga0207651_10030871 Ga0207651_100308711 489
82 3300049572 Ga0501036_0047532 Ga0501036_0047532_526_2058 489
83 3300049576 Ga0501040_0067942 Ga0501040_0067942_106_1638 489
84 3300049578 Ga0501042_0001976 Ga0501042_0001976_9325_10857 489
85 3300049590 Ga0501074_0032845 Ga0501074_0032845_1249_2781 489
86 3300049592 Ga0501076_0145623 Ga0501076_0145623_350_1882 489
87 3300049741 Ga0501079_0029581 Ga0501079_0029581_143_1675 489
88 3300050507 nmdc:mga05p37_29662_c1 nmdc:mga05p37_29662_c1_3079_4611 489
89 3300050507 nmdc:mga05p37_5552_c1 nmdc:mga05p37_5552_c1_6344_7876 489
90 3300050508 nmdc:mga09592_11816_c1 nmdc:mga09592_11816_c1_4211_5743 489
91 3300050511 nmdc:mga08y16_3818_c1 nmdc:mga08y16_3818_c1_8502_10034 489
92 3300050512 nmdc:mga0n895_7773_c1 nmdc:mga0n895_7773_c1_7296_8828 489
93 3300005293 Ga0065715_10101548 Ga0065715_101015482 490
94 3300005295 Ga0065707_10002910 Ga0065707_100029104 490
95 3300005331 Ga0070670_100017601 Ga0070670_1000176013 490
96 3300005340 Ga0070689_100007394 Ga0070689_1000073944 490
97 3300005341 Ga0070691_10012035 Ga0070691_100120353 490
98 3300005354 Ga0070675_100000311 Ga0070675_10000031116 490
99 3300005354 Ga0070675_100007377 Ga0070675_1000073775 490
100 3300005365 Ga0070688_100006975 Ga0070688_1000069754 490
101 3300005440 Ga0070705_100079626 Ga0070705_1000796262 490
102 3300005467 Ga0070706_100091154 Ga0070706_1000911542 490
103 3300005471 Ga0070698_100001813 Ga0070698_10000181317 490
104 3300005471 Ga0070698_100006892 Ga0070698_1000068925 490
105 3300005518 Ga0070699_100001754 Ga0070699_1000017543 490
106 3300005535 Ga0070684_100075794 Ga0070684_1000757943 490
107 3300005536 Ga0070697_100078283 Ga0070697_1000782832 490
108 3300005543 Ga0070672_100030420 Ga0070672_1000304202 490
109 3300005544 Ga0070686_100138756 Ga0070686_1001387561 490
110 3300005545 Ga0070695_100031758 Ga0070695_1000317582 490
111 3300005546 Ga0070696_100060492 Ga0070696_1000604922 490
112 3300005549 Ga0070704_100003231 Ga0070704_1000032316 490
113 3300005549 Ga0070704_100036021 Ga0070704_1000360212 490
114 3300005577 Ga0068857_100029433 Ga0068857_1000294332 490
115 3300005615 Ga0070702_100050355 Ga0070702_1000503552 490
116 3300005617 Ga0068859_100029054 Ga0068859_1000290543 490
117 3300005618 Ga0068864_100009517 Ga0068864_1000095173 490
118 3300005841 Ga0068863_100031041 Ga0068863_1000310413 490
119 3300005842 Ga0068858_100006773 Ga0068858_1000067734 490
120 3300006042 Ga0075368_10032959 Ga0075368_100329592 490
121 3300006178 Ga0075367_10001698 Ga0075367_100016986 490
122 3300006358 Ga0068871_100132725 Ga0068871_1001327252 490
123 3300006844 Ga0075428_100008375 Ga0075428_1000083757 490
124 3300006847 Ga0075431_100018355 Ga0075431_1000183553 490
125 3300006871 Ga0075434_100002491 Ga0075434_1000024919 490
126 3300006931 Ga0097620_100029055 Ga0097620_1000290553 490
127 3300007076 Ga0075435_100030226 Ga0075435_1000302263 490
128 3300009147 Ga0114129_10058684 Ga0114129_100586843 490
129 3300025910 Ga0207684_10067468 Ga0207684_100674683 490
130 3300025912 Ga0207707_10055167 Ga0207707_100551673 490
131 3300025925 Ga0207650_10011044 Ga0207650_100110443 490
132 3300025926 Ga0207659_10000975 Ga0207659_100009758 490
133 3300025926 Ga0207659_10059162 Ga0207659_100591622 490
134 3300025931 Ga0207644_10023772 Ga0207644_100237723 490
135 3300025935 Ga0207709_10022240 Ga0207709_100222403 490
136 3300025940 Ga0207691_10078308 Ga0207691_100783082 490
137 3300025945 Ga0207679_10034123 Ga0207679_100341233 490
138 3300026075 Ga0207708_10069070 Ga0207708_100690702 490
139 3300028381 Ga0268264_10011433 Ga0268264_100114334 490
140 3300031824 Ga0307413_10024351 Ga0307413_100243512 490
141 3300031852 Ga0307410_10036675 Ga0307410_100366752 490
142 3300031903 Ga0307407_10021381 Ga0307407_100213812 490
143 3300031911 Ga0307412_10048355 Ga0307412_100483553 490
144 3300032002 Ga0307416_100060127 Ga0307416_1000601272 490
145 3300032005 Ga0307411_10046951 Ga0307411_100469512 490
146 3300032126 Ga0307415_100009010 Ga0307415_1000090104 490
147 3300045051 Ga0451576_0009851 Ga0451576_0009851_4041_5576 490
148 3300045051 Ga0451576_0049993 Ga0451576_0049993_1463_2998 490
149 3300045051 Ga0451576_0053012 Ga0451576_0053012_1019_2554 490
150 3300045051 Ga0451576_0106536 Ga0451576_0106536_460_1995 490
151 3300046455 Ga0495603_0011818 Ga0495603_0011818_2298_3833 490
152 3300046491 Ga0495584_0033012 Ga0495584_0033012_383_1930 490
153 3300046499 Ga0495594_0006783 Ga0495594_0006783_816_2351 490
154 3300046539 Ga0495621_0001796 Ga0495621_0001796_3398_4933 490
155 3300046539 Ga0495621_0021083 Ga0495621_0021083_520_2055 490
156 3300046674 Ga0495588_0011078 Ga0495588_0011078_193_1728 490
157 3300049590 Ga0501074_0153747 Ga0501074_0153747_30_1565 490
158 3300049592 Ga0501076_0053990 Ga0501076_0053990_854_2389 490
159 3300049593 Ga0501077_0115013 Ga0501077_0115013_147_1682 490
160 3300050507 nmdc:mga05p37_129088_c1 nmdc:mga05p37_129088_c1_1088_2629 490
161 3300050507 nmdc:mga05p37_5913_c1 nmdc:mga05p37_5913_c1_5055_6590 490
162 3300050512 nmdc:mga0n895_10512_c1 nmdc:mga0n895_10512_c1_4391_5926 490
163 3300050512 nmdc:mga0n895_71366_c1 nmdc:mga0n895_71366_c1_370_1905 490
164 3300050512 nmdc:mga0n895_93694_c1 nmdc:mga0n895_93694_c1_1010_2545 490
165 3300050513 nmdc:mga0rr50_11772_c1 nmdc:mga0rr50_11772_c1_2204_3739 490
166 3300054114 Ga0501084_0093528 Ga0501084_0093528_928_2463 490
167 3300059421 Ga0590071_002572 Ga0590071_002572_1813_3348 490
168 3300059424 Ga0590075_002020 Ga0590075_002020_1544_3079 490
169 3300059426 Ga0590077_000362 Ga0590077_000362_1146_2681 490
170 3300061734 Ga0530510_0063973 Ga0530510_0063973_131_1666 490
171 3300005295 Ga0065707_10097767 Ga0065707_100977673 491
172 3300006844 Ga0075428_100038724 Ga0075428_1000387243 491
173 3300006846 Ga0075430_100002425 Ga0075430_1000024259 491
174 3300006847 Ga0075431_100016547 Ga0075431_1000165475 491
175 3300006880 Ga0075429_100030035 Ga0075429_1000300353 491
176 3300031548 Ga0307408_100024339 Ga0307408_1000243392 491
177 3300031731 Ga0307405_10073182 Ga0307405_100731821 491
178 3300046459 Ga0495629_0008227 Ga0495629_0008227_1461_3005 491
179 3300047317 Ga0495604_0108915 Ga0495604_0108915_186_1727 491
180 3300049571 Ga0501034_0053414 Ga0501034_0053414_656_2197 491
181 3300049572 Ga0501036_0076137 Ga0501036_0076137_402_1940 491
182 3300049577 Ga0501041_0008737 Ga0501041_0008737_642_2180 491
183 3300049588 Ga0501072_0023678 Ga0501072_0023678_914_2452 491
184 3300049592 Ga0501076_0091562 Ga0501076_0091562_748_2286 491
185 3300049741 Ga0501079_0050125 Ga0501079_0050125_686_2224 491
186 3300049824 Ga0501045_0123847 Ga0501045_0123847_73_1611 491
187 3300050507 nmdc:mga05p37_66250_c2 nmdc:mga05p37_66250_c2_2527_4065 491
188 3300050508 nmdc:mga09592_7154_c1 nmdc:mga09592_7154_c1_995_2533 491
189 3300050509 nmdc:mga0qj67_1417_c1 nmdc:mga0qj67_1417_c1_14360_15898 491
190 3300050510 nmdc:mga06r32_6938_c1 nmdc:mga06r32_6938_c1_1749_3287 491
191 3300061734 Ga0530510_0019754 Ga0530510_0019754_330_1868 491
192 3300002459 JGI24751J29686_10005675 JGI24751J29686_100056753 492
193 3300003203 JGI25406J46586_10007699 JGI25406J46586_100076992 492
194 3300005290 Ga0065712_10001865 Ga0065712_1000186510 492
195 3300005290 Ga0065712_10068417 Ga0065712_100684172 492
196 3300005290 Ga0065712_10077523 Ga0065712_100775235 492
197 3300005290 Ga0065712_10089783 Ga0065712_100897832 492
198 3300005290 Ga0065712_10104388 Ga0065712_101043882 492
199 3300005293 Ga0065715_10107958 Ga0065715_101079581 492
200 3300005328 Ga0070676_10010750 Ga0070676_100107502 492
201 3300005331 Ga0070670_100011093 Ga0070670_1000110934 492
202 3300005331 Ga0070670_100014785 Ga0070670_1000147853 492
203 3300005331 Ga0070670_100023960 Ga0070670_1000239605 492
204 3300005334 Ga0068869_100000256 Ga0068869_1000002563 492
205 3300005335 Ga0070666_10136307 Ga0070666_101363071 492
206 3300005339 Ga0070660_100013139 Ga0070660_1000131392 492
207 3300005343 Ga0070687_100028003 Ga0070687_1000280032 492
208 3300005353 Ga0070669_100002881 Ga0070669_1000028817 492
209 3300005353 Ga0070669_100079022 Ga0070669_1000790222 492
210 3300005354 Ga0070675_100002200 Ga0070675_1000022004 492
211 3300005354 Ga0070675_100002452 Ga0070675_1000024524 492
212 3300005356 Ga0070674_100001848 Ga0070674_1000018489 492
213 3300005356 Ga0070674_100002130 Ga0070674_1000021304 492
214 3300005356 Ga0070674_100131485 Ga0070674_1001314851 492
215 3300005364 Ga0070673_100018890 Ga0070673_1000188902 492
216 3300005364 Ga0070673_100172743 Ga0070673_1001727432 492
217 3300005366 Ga0070659_100010629 Ga0070659_1000106293 492
218 3300005367 Ga0070667_100028989 Ga0070667_1000289894 492
219 3300005367 Ga0070667_100095032 Ga0070667_1000950321 492
220 3300005438 Ga0070701_10003990 Ga0070701_100039902 492
221 3300005445 Ga0070708_100000002 Ga0070708_100000002143 492
222 3300005456 Ga0070678_100024033 Ga0070678_1000240331 492
223 3300005456 Ga0070678_100030823 Ga0070678_1000308233 492
224 3300005458 Ga0070681_10019926 Ga0070681_100199264 492
225 3300005458 Ga0070681_10067199 Ga0070681_100671991 492
226 3300005459 Ga0068867_100011691 Ga0068867_1000116915 492
227 3300005471 Ga0070698_100018706 Ga0070698_1000187066 492
228 3300005471 Ga0070698_100136158 Ga0070698_1001361582 492
229 3300005471 Ga0070698_100153230 Ga0070698_1001532302 492
230 3300005518 Ga0070699_100000980 Ga0070699_1000009806 492
231 3300005518 Ga0070699_100004768 Ga0070699_1000047689 492
232 3300005535 Ga0070684_100015248 Ga0070684_1000152482 492
233 3300005535 Ga0070684_100024056 Ga0070684_1000240564 492
234 3300005536 Ga0070697_100027184 Ga0070697_1000271843 492
235 3300005543 Ga0070672_100015797 Ga0070672_1000157972 492
236 3300005544 Ga0070686_100004936 Ga0070686_1000049367 492
237 3300005544 Ga0070686_100028383 Ga0070686_1000283832 492
238 3300005544 Ga0070686_100066538 Ga0070686_1000665382 492
239 3300005547 Ga0070693_100021406 Ga0070693_1000214063 492
240 3300005548 Ga0070665_100001061 Ga0070665_1000010617 492
241 3300005548 Ga0070665_100112265 Ga0070665_1001122652 492
242 3300005563 Ga0068855_100040709 Ga0068855_1000407094 492
243 3300005564 Ga0070664_100000832 Ga0070664_10000083213 492
244 3300005564 Ga0070664_100031404 Ga0070664_1000314042 492
245 3300005564 Ga0070664_100155113 Ga0070664_1001551132 492
246 3300005578 Ga0068854_100002437 Ga0068854_1000024375 492
247 3300005578 Ga0068854_100006157 Ga0068854_1000061572 492
248 3300005617 Ga0068859_100013874 Ga0068859_1000138742 492
249 3300005618 Ga0068864_100030550 Ga0068864_1000305502 492
250 3300005718 Ga0068866_10002372 Ga0068866_100023722 492
251 3300005719 Ga0068861_100161312 Ga0068861_1001613121 492
252 3300005834 Ga0068851_10008332 Ga0068851_100083324 492
253 3300005841 Ga0068863_100044292 Ga0068863_1000442921 492
254 3300005841 Ga0068863_100067747 Ga0068863_1000677472 492
255 3300005842 Ga0068858_100132773 Ga0068858_1001327732 492
256 3300005843 Ga0068860_100064216 Ga0068860_1000642162 492
257 3300005844 Ga0068862_100044485 Ga0068862_1000444853 492
258 3300005985 Ga0081539_10000110 Ga0081539_10000110130 492
259 3300006038 Ga0075365_10011620 Ga0075365_100116203 492
260 3300006038 Ga0075365_10044558 Ga0075365_100445583 492
261 3300006177 Ga0075362_10001435 Ga0075362_100014354 492
262 3300006195 Ga0075366_10045956 Ga0075366_100459561 492
263 3300006237 Ga0097621_100016903 Ga0097621_1000169032 492
264 3300006358 Ga0068871_100001984 Ga0068871_1000019846 492
265 3300006844 Ga0075428_100000030 Ga0075428_10000003041 492
266 3300006844 Ga0075428_100006014 Ga0075428_1000060141 492
267 3300006844 Ga0075428_100008632 Ga0075428_1000086324 492
268 3300006844 Ga0075428_100026750 Ga0075428_1000267502 492
269 3300006844 Ga0075428_100112270 Ga0075428_1001122702 492
270 3300006846 Ga0075430_100009976 Ga0075430_1000099762 492
271 3300006847 Ga0075431_100012354 Ga0075431_1000123544 492
272 3300006847 Ga0075431_100112615 Ga0075431_1001126152 492
273 3300006852 Ga0075433_10044987 Ga0075433_100449874 492
274 3300006871 Ga0075434_100003288 Ga0075434_1000032882 492
275 3300006871 Ga0075434_100108317 Ga0075434_1001083173 492
276 3300006880 Ga0075429_100005123 Ga0075429_1000051232 492
277 3300006881 Ga0068865_100073067 Ga0068865_1000730671 492
278 3300006914 Ga0075436_100002164 Ga0075436_10000216412 492
279 3300006914 Ga0075436_100038228 Ga0075436_1000382283 492
280 3300006931 Ga0097620_100013874 Ga0097620_1000138744 492
281 3300007076 Ga0075435_100000034 Ga0075435_10000003445 492
282 3300007076 Ga0075435_100000542 Ga0075435_10000054216 492
283 3300007076 Ga0075435_100012725 Ga0075435_1000127252 492
284 3300007076 Ga0075435_100106714 Ga0075435_1001067142 492
285 3300009094 Ga0111539_10000015 Ga0111539_10000015100 492
286 3300009094 Ga0111539_10000657 Ga0111539_1000065719 492
287 3300009094 Ga0111539_10002052 Ga0111539_100020523 492
288 3300009094 Ga0111539_10042646 Ga0111539_100426465 492
289 3300009094 Ga0111539_10108842 Ga0111539_101088422 492
290 3300009098 Ga0105245_10043479 Ga0105245_100434792 492
291 3300009098 Ga0105245_10147065 Ga0105245_101470652 492
292 3300009147 Ga0114129_10001174 Ga0114129_1000117410 492
293 3300009147 Ga0114129_10006497 Ga0114129_100064974 492
294 3300009147 Ga0114129_10095275 Ga0114129_100952752 492
295 3300009148 Ga0105243_10049415 Ga0105243_100494152 492
296 3300009176 Ga0105242_10006802 Ga0105242_100068026 492
297 3300009176 Ga0105242_10007503 Ga0105242_100075032 492
298 3300009177 Ga0105248_10019397 Ga0105248_100193976 492
299 3300009177 Ga0105248_10143370 Ga0105248_101433701 492
300 3300009545 Ga0105237_10081662 Ga0105237_100816623 492
301 3300009551 Ga0105238_10002716 Ga0105238_1000271611 492
302 3300009553 Ga0105249_10001257 Ga0105249_100012579 492
303 3300009553 Ga0105249_10052897 Ga0105249_100528973 492
304 3300013296 Ga0157374_10087859 Ga0157374_100878592 492
305 3300013306 Ga0163162_10024574 Ga0163162_100245744 492
306 3300014325 Ga0163163_10000005 Ga0163163_1000000556 492
307 3300014325 Ga0163163_10015247 Ga0163163_100152474 492
308 3300014325 Ga0163163_10033344 Ga0163163_100333442 492
309 3300014325 Ga0163163_10041293 Ga0163163_100412934 492
310 3300014326 Ga0157380_10000415 Ga0157380_100004158 492
311 3300014326 Ga0157380_10000549 Ga0157380_100005498 492
312 3300014326 Ga0157380_10031476 Ga0157380_100314763 492
313 3300014326 Ga0157380_10081845 Ga0157380_100818453 492
314 3300014969 Ga0157376_10074275 Ga0157376_100742752 492
315 3300025321 Ga0207656_10005665 Ga0207656_100056654 492
316 3300025893 Ga0207682_10013055 Ga0207682_100130552 492
317 3300025893 Ga0207682_10024964 Ga0207682_100249642 492
318 3300025899 Ga0207642_10004075 Ga0207642_100040753 492
319 3300025907 Ga0207645_10005378 Ga0207645_100053782 492
320 3300025910 Ga0207684_10008593 Ga0207684_100085933 492
321 3300025912 Ga0207707_10016097 Ga0207707_100160972 492
322 3300025912 Ga0207707_10029951 Ga0207707_100299512 492
323 3300025913 Ga0207695_10141094 Ga0207695_101410942 492
324 3300025914 Ga0207671_10068672 Ga0207671_100686722 492
325 3300025918 Ga0207662_10003753 Ga0207662_100037533 492
326 3300025919 Ga0207657_10008592 Ga0207657_100085924 492
327 3300025921 Ga0207652_10021929 Ga0207652_100219294 492
328 3300025923 Ga0207681_10104325 Ga0207681_101043251 492
329 3300025924 Ga0207694_10004377 Ga0207694_100043774 492
330 3300025924 Ga0207694_10165195 Ga0207694_101651951 492
331 3300025926 Ga0207659_10008248 Ga0207659_100082482 492
332 3300025926 Ga0207659_10013544 Ga0207659_100135443 492
333 3300025926 Ga0207659_10020371 Ga0207659_100203711 492
334 3300025927 Ga0207687_10039424 Ga0207687_100394242 492
335 3300025927 Ga0207687_10068596 Ga0207687_100685962 492
336 3300025931 Ga0207644_10021961 Ga0207644_100219612 492
337 3300025932 Ga0207690_10057404 Ga0207690_100574043 492
338 3300025934 Ga0207686_10002593 Ga0207686_100025936 492
339 3300025934 Ga0207686_10006503 Ga0207686_100065033 492
340 3300025934 Ga0207686_10018478 Ga0207686_100184782 492
341 3300025935 Ga0207709_10007528 Ga0207709_100075284 492
342 3300025936 Ga0207670_10009719 Ga0207670_100097193 492
343 3300025937 Ga0207669_10000576 Ga0207669_1000057614 492
344 3300025938 Ga0207704_10008141 Ga0207704_100081412 492
345 3300025938 Ga0207704_10010027 Ga0207704_100100271 492
346 3300025938 Ga0207704_10061764 Ga0207704_100617641 492
347 3300025940 Ga0207691_10004280 Ga0207691_1000428013 492
348 3300025940 Ga0207691_10005737 Ga0207691_100057376 492
349 3300025941 Ga0207711_10113018 Ga0207711_101130182 492
350 3300025942 Ga0207689_10000674 Ga0207689_1000067419 492
351 3300025942 Ga0207689_10071885 Ga0207689_100718853 492
352 3300025942 Ga0207689_10085545 Ga0207689_100855452 492
353 3300025942 Ga0207689_10119829 Ga0207689_101198292 492
354 3300025949 Ga0207667_10056520 Ga0207667_100565202 492
355 3300025960 Ga0207651_10015926 Ga0207651_100159263 492
356 3300025961 Ga0207712_10004150 Ga0207712_100041508 492
357 3300025981 Ga0207640_10007641 Ga0207640_100076412 492
358 3300025986 Ga0207658_10028480 Ga0207658_100284801 492
359 3300026035 Ga0207703_10159847 Ga0207703_101598472 492
360 3300026067 Ga0207678_10012995 Ga0207678_100129952 492
361 3300026075 Ga0207708_10001495 Ga0207708_100014956 492
362 3300026075 Ga0207708_10006720 Ga0207708_100067203 492
363 3300026075 Ga0207708_10014468 Ga0207708_100144685 492
364 3300026088 Ga0207641_10183273 Ga0207641_101832732 492
365 3300026089 Ga0207648_10001691 Ga0207648_100016918 492
366 3300026095 Ga0207676_10102496 Ga0207676_101024962 492
367 3300026118 Ga0207675_100025629 Ga0207675_1000256293 492
368 3300026118 Ga0207675_100093292 Ga0207675_1000932923 492
369 3300026121 Ga0207683_10018524 Ga0207683_100185241 492
370 3300026121 Ga0207683_10022945 Ga0207683_100229455 492
371 3300026121 Ga0207683_10046565 Ga0207683_100465652 492
372 3300027907 Ga0207428_10000048 Ga0207428_10000048100 492
373 3300027907 Ga0207428_10002183 Ga0207428_1000218313 492
374 3300027907 Ga0207428_10015984 Ga0207428_100159842 492
375 3300028379 Ga0268266_10002445 Ga0268266_100024453 492
376 3300028379 Ga0268266_10098920 Ga0268266_100989201 492
377 3300031548 Ga0307408_100005017 Ga0307408_1000050176 492
378 3300031824 Ga0307413_10008047 Ga0307413_100080472 492
379 3300031852 Ga0307410_10009285 Ga0307410_100092855 492
380 3300031852 Ga0307410_10082640 Ga0307410_100826402 492
381 3300031903 Ga0307407_10039358 Ga0307407_100393583 492
382 3300031911 Ga0307412_10012962 Ga0307412_100129623 492
383 3300031995 Ga0307409_100000402 Ga0307409_1000004024 492
384 3300031995 Ga0307409_100020749 Ga0307409_1000207492 492
385 3300031995 Ga0307409_100045657 Ga0307409_1000456572 492
386 3300031995 Ga0307409_100056397 Ga0307409_1000563973 492
387 3300031995 Ga0307409_100242837 Ga0307409_1002428371 492
388 3300032002 Ga0307416_100038785 Ga0307416_1000387854 492
389 3300032002 Ga0307416_100041405 Ga0307416_1000414053 492
390 3300032002 Ga0307416_100044313 Ga0307416_1000443132 492
391 3300032002 Ga0307416_100079312 Ga0307416_1000793122 492
392 3300032002 Ga0307416_100097160 Ga0307416_1000971602 492
393 3300032005 Ga0307411_10008127 Ga0307411_100081272 492
394 3300032005 Ga0307411_10028199 Ga0307411_100281992 492
395 3300035115 Ga0373941_0001687 Ga0373941_0001687_1744_3285 492
396 3300035692 Ga0373935_0087192 Ga0373935_0087192_471_2018 492
397 3300037068 Ga0373925_0006974 Ga0373925_0006974_16_1557 492
398 3300042156 Ga0439446_0019092 Ga0439446_0019092_195_1736 492
399 3300042435 Ga0439434_0006671 Ga0439434_0006671_1121_2662 492
400 3300045051 Ga0451576_0003740 Ga0451576_0003740_1071_2615 492
401 3300046516 Ga0495628_0072683 Ga0495628_0072683_502_2070 492
402 3300046522 Ga0495643_0011558 Ga0495643_0011558_2834_4384 492
403 3300046678 Ga0495599_0083031 Ga0495599_0083031_119_1687 492
404 3300046683 Ga0495658_0018058 Ga0495658_0018058_530_2071 492
405 3300046689 Ga0495613_0110108 Ga0495613_0110108_27_1568 492
406 3300048905 Ga0496102_0161896 Ga0496102_0161896_398_1939 492
407 3300048907 Ga0496104_0001099 Ga0496104_0001099_20930_22471 492
408 3300048909 Ga0496106_0198942 Ga0496106_0198942_12_1553 492
409 3300048911 Ga0496108_0091880 Ga0496108_0091880_470_2011 492
410 3300048912 Ga0496109_0079324 Ga0496109_0079324_765_2306 492
411 3300048912 Ga0496109_0128755 Ga0496109_0128755_759_2303 492
412 3300048913 Ga0496110_0003707 Ga0496110_0003707_9545_11086 492
413 3300048914 Ga0496111_0088149 Ga0496111_0088149_27_1568 492
414 3300048915 Ga0496112_0068255 Ga0496112_0068255_501_2042 492
415 3300048915 Ga0496112_0182968 Ga0496112_0182968_143_1711 492
416 3300048916 Ga0496113_0147357 Ga0496113_0147357_230_1774 492
417 3300048917 Ga0496114_0119760 Ga0496114_0119760_629_2173 492
418 3300049568 Ga0501031_0012441 Ga0501031_0012441_1376_2917 492
419 3300049568 Ga0501031_0077778 Ga0501031_0077778_77_1618 492
420 3300049569 Ga0501032_0021792 Ga0501032_0021792_228_1769 492
421 3300049571 Ga0501034_0001388 Ga0501034_0001388_19542_21083 492
422 3300049571 Ga0501034_0001525 Ga0501034_0001525_4678_6225 492
423 3300049574 Ga0501038_0025399 Ga0501038_0025399_3609_5150 492
424 3300049574 Ga0501038_0102636 Ga0501038_0102636_171_1712 492
425 3300049575 Ga0501039_0078018 Ga0501039_0078018_511_2052 492
426 3300049576 Ga0501040_0002796 Ga0501040_0002796_8405_10000 492
427 3300049577 Ga0501041_0067277 Ga0501041_0067277_282_1823 492
428 3300049579 Ga0501043_0000899 Ga0501043_0000899_21534_23075 492
429 3300049579 Ga0501043_0044925 Ga0501043_0044925_1212_2753 492
430 3300049580 Ga0501046_0006626 Ga0501046_0006626_7314_8909 492
431 3300049580 Ga0501046_0154569 Ga0501046_0154569_40_1581 492
432 3300049581 Ga0501047_0001422 Ga0501047_0001422_4886_6427 492
433 3300049581 Ga0501047_0001540 Ga0501047_0001540_1689_3230 492
434 3300049582 Ga0501048_0008042 Ga0501048_0008042_5544_7139 492
435 3300049582 Ga0501048_0025998 Ga0501048_0025998_2086_3636 492
436 3300049583 Ga0501067_0076716 Ga0501067_0076716_224_1771 492
437 3300049585 Ga0501069_0005956 Ga0501069_0005956_3931_5472 492
438 3300049585 Ga0501069_0022519 Ga0501069_0022519_1689_3230 492
439 3300049586 Ga0501070_0187038 Ga0501070_0187038_110_1651 492
440 3300049587 Ga0501071_0008680 Ga0501071_0008680_4931_6526 492
441 3300049587 Ga0501071_0037904 Ga0501071_0037904_1511_3091 492
442 3300049588 Ga0501072_0045285 Ga0501072_0045285_508_2049 492
443 3300049588 Ga0501072_0045289 Ga0501072_0045289_1204_2754 492
444 3300049589 Ga0501073_0081209 Ga0501073_0081209_213_1754 492
445 3300049590 Ga0501074_0046671 Ga0501074_0046671_694_2289 492
446 3300049591 Ga0501075_0001452 Ga0501075_0001452_20_1615 492
447 3300049592 Ga0501076_0002028 Ga0501076_0002028_607_2202 492
448 3300049592 Ga0501076_0002929 Ga0501076_0002929_590_2140 492
449 3300049592 Ga0501076_0073132 Ga0501076_0073132_934_2514 492
450 3300049593 Ga0501077_0020923 Ga0501077_0020923_1322_2863 492
451 3300049593 Ga0501077_0023625 Ga0501077_0023625_902_2497 492
452 3300049593 Ga0501077_0050840 Ga0501077_0050840_435_1976 492
453 3300049593 Ga0501077_0064615 Ga0501077_0064615_617_2158 492
454 3300049741 Ga0501079_0001840 Ga0501079_0001840_7308_8903 492
455 3300049741 Ga0501079_0132836 Ga0501079_0132836_232_1812 492
456 3300049741 Ga0501079_0135330 Ga0501079_0135330_60_1601 492
457 3300049742 Ga0501080_0012848 Ga0501080_0012848_3897_5438 492
458 3300049743 Ga0501081_0033058 Ga0501081_0033058_1867_3417 492
459 3300049744 Ga0501083_0044099 Ga0501083_0044099_1181_2722 492
460 3300049822 Ga0501035_0021878 Ga0501035_0021878_3488_5083 492
461 3300049823 Ga0501044_0007926 Ga0501044_0007926_7285_8826 492
462 3300049823 Ga0501044_0012726 Ga0501044_0012726_7320_8861 492
463 3300049823 Ga0501044_0046001 Ga0501044_0046001_1757_3298 492
464 3300049824 Ga0501045_0000979 Ga0501045_0000979_3639_5234 492
465 3300050489 nmdc:mga03683_719_c1 nmdc:mga03683_719_c1_3874_5421 492
466 3300050491 nmdc:mga00v17_27098_c1 nmdc:mga00v17_27098_c1_1268_2812 492
467 3300050492 nmdc:mga0yw44_4529_c1 nmdc:mga0yw44_4529_c1_1631_3178 492
468 3300050493 nmdc:mga0k408_51708_c1 nmdc:mga0k408_51708_c1_600_2150 492
469 3300050493 nmdc:mga0k408_92373_c1 nmdc:mga0k408_92373_c1_104_1645 492
470 3300050494 nmdc:mga06z11_24730_c1 nmdc:mga06z11_24730_c1_1243_2790 492
471 3300050494 nmdc:mga06z11_47833_c1 nmdc:mga06z11_47833_c1_335_1882 492
472 3300050507 nmdc:mga05p37_4830_c1 nmdc:mga05p37_4830_c1_4802_6343 492
473 3300050507 nmdc:mga05p37_6192_c1 nmdc:mga05p37_6192_c1_10520_12061 492
474 3300050507 nmdc:mga05p37_66131_c1 nmdc:mga05p37_66131_c1_456_1997 492
475 3300050507 nmdc:mga05p37_8223_c1 nmdc:mga05p37_8223_c1_4852_6393 492
476 3300050507 nmdc:mga05p37_85623_c1 nmdc:mga05p37_85623_c1_72_1613 492
477 3300050510 nmdc:mga06r32_13806_c1 nmdc:mga06r32_13806_c1_1123_2664 492
478 3300050510 nmdc:mga06r32_22840_c1 nmdc:mga06r32_22840_c1_1006_2547 492
479 3300050511 nmdc:mga08y16_18417_c1 nmdc:mga08y16_18417_c1_1200_2741 492
480 3300050511 nmdc:mga08y16_26216_c1 nmdc:mga08y16_26216_c1_3029_4570 492
481 3300050511 nmdc:mga08y16_527_c1 nmdc:mga08y16_527_c1_20208_21755 492
482 3300050511 nmdc:mga08y16_69084_c1 nmdc:mga08y16_69084_c1_847_2388 492
483 3300050511 nmdc:mga08y16_8_c1 nmdc:mga08y16_8_c1_438175_439722 492
484 3300050512 nmdc:mga0n895_11_c1 nmdc:mga0n895_11_c1_85262_86803 492
485 3300050512 nmdc:mga0n895_68981_c1 nmdc:mga0n895_68981_c1_1133_2674 492
486 3300050513 nmdc:mga0rr50_19_c1 nmdc:mga0rr50_19_c1_97468_99009 492
487 3300050513 nmdc:mga0rr50_326_c1 nmdc:mga0rr50_326_c1_9449_10990 492
488 3300050513 nmdc:mga0rr50_5246_c1 nmdc:mga0rr50_5246_c1_2258_3799 492
489 3300050514 nmdc:mga08x19_1476_c1 nmdc:mga08x19_1476_c1_7131_8672 492
490 3300050514 nmdc:mga08x19_23388_c1 nmdc:mga08x19_23388_c1_19_1560 492
491 3300050514 nmdc:mga08x19_79423_c1 nmdc:mga08x19_79423_c1_360_1901 492
492 3300050515 nmdc:mga0a205_13380_c1 nmdc:mga0a205_13380_c1_5396_6937 492
493 3300050515 nmdc:mga0a205_13986_c2 nmdc:mga0a205_13986_c2_2495_4036 492
494 3300053077 Ga0495601_0136829 Ga0495601_0136829_42_1583 492
495 3300053085 Ga0495619_0076176 Ga0495619_0076176_640_2181 492
496 3300053085 Ga0495619_0102612 Ga0495619_0102612_335_1882 492
497 3300053103 Ga0500555_002706 Ga0500555_002706_1581_3125 492
498 3300053153 Ga0500616_0003153 Ga0500616_0003153_6419_7963 492
499 3300053730 Ga0500645_000514 Ga0500645_000514_21414_22958 492
500 3300054114 Ga0501084_0006120 Ga0501084_0006120_3098_4639 492
501 3300054114 Ga0501084_0010694 Ga0501084_0010694_5079_6674 492
502 3300054114 Ga0501084_0033139 Ga0501084_0033139_533_2074 492
503 3300059421 Ga0590071_000152 Ga0590071_000152_17940_19481 492
504 3300059421 Ga0590071_001725 Ga0590071_001725_2375_3916 492
505 3300059421 Ga0590071_003768 Ga0590071_003768_2057_3598 492
506 3300059421 Ga0590071_005352 Ga0590071_005352_547_2088 492
507 3300059423 Ga0590074_000017 Ga0590074_000017_13618_15159 492
508 3300059424 Ga0590075_003519 Ga0590075_003519_2001_3542 492
509 3300059424 Ga0590075_019609 Ga0590075_019609_107_1648 492
510 3300060353 Ga0501082_0001004 Ga0501082_0001004_15544_17139 492
511 3300061734 Ga0530510_0000888 Ga0530510_0000888_11976_13571 492

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

1

437

0.98

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

192

387

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pn8-assembly1.cif.gz_F engineered glycolyl-coa carboxylase (l100n variant) with bound coa 0.9027 5 492
3n6r-assembly1.cif.gz_L crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) 0.9024 6 492
8pn7-assembly1.cif.gz_E engineered glycolyl-coa carboxylase (g20r variant) with bound coa 0.9015 5 492
1vrg-assembly1.cif.gz_F crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution 0.8995 1 492
1on3-assembly1.cif.gz_E transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) 0.8985 5 492
ID Description Score Start End Superfamily
af_Q20676_22_285_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8982 4 234 3.90.226.10
4l6wA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8892 240 473 3.90.226.10
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8888 75 219 3.90.226.10
5fifB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8882 247 473 3.90.226.10
3h0sB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8776 75 226 3.90.226.10
ID Description Score Start End GO Terms
AF-X1VRZ5-F1-model_v4 CoA carboxyltransferase C-terminal domain-containing protein 0.9981 245 339 GO:0004658
AF-H1QFV4-F1-model_v4 deleted 0.9938 254 341
AF-M9TIK7-F1-model_v4 Acetyl-CoA carboxylase alpha subunit 0.9936 155 304 GO:0004658
AF-A0A4Q0IVL7-F1-model_v4 deleted 0.9907 187 316
AF-A8YPL3-F1-model_v4 Acetyl-CoA carboxylase alpha subunit (EC 6.4.1.2) 0.9856 155 274 GO:0003989
GO:0004658

Feature Viewer

pLDDT pTM Quality
81.12 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map