F457292

General Info

Members Datasets Scaffolds Average Seq Length
511 201 1022 163

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10032163|Ga0207665_100321633
Length 198
Sequence MIQKSRVLIVEDQESERSALERVLRVAQYDVAAAANAEEALEWRDQPIDLVISDLRKFNDDRGWLSELFRSDESDPEFFPAMAYTSSTNAGVTRGPHEHVDQADMFCFLGPSNFKLRMWDNRADSPTYQNVMTLIVGADNPKSVVIPRGVVHAYQNIGDVDGIVINCPNRLYMGAERREPIDEIRHEDDPNTIFRIDD

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.13
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 18.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10032163 3300025939 Bacteria 3473
2 SwRhRL3b_contig_2049852 2162886006 Bacteria 1193
3 SwRhRL2b_contig_1621087 2162886007 Unclassified 2179
4 MBSR1b_contig_10124042 2162886012 Bacteria 906
5 rootL2_10345859 3300003322 Bacteria 1248
6 Ga0065704_10185206 3300005289 Bacteria 1197
7 Ga0065712_10068601 3300005290 Bacteria 9684
8 Ga0065715_10005851 3300005293 Bacteria 6117
9 Ga0065715_10103745 3300005293 Bacteria 3011
10 Ga0065715_10162917 3300005293 Bacteria 1608
11 Ga0065715_10165214 3300005293 Bacteria 1593
12 Ga0065715_10185590 3300005293 Bacteria 1447
13 Ga0065715_10430254 3300005293 Bacteria 837
14 Ga0065707_10002540 3300005295 Unclassified 4465
15 Ga0065707_10095984 3300005295 Unclassified 3316
16 Ga0070676_10115268 3300005328 Unclassified 1679
17 Ga0070690_100050501 3300005330 Bacteria 2654
18 Ga0070690_100124204 3300005330 Bacteria 1736
19 Ga0070690_100867910 3300005330 Unclassified 704
20 Ga0070670_101264366 3300005331 Unclassified 675
21 Ga0070670_101834404 3300005331 Bacteria 558
22 Ga0068869_100039107 3300005334 Bacteria 3385
23 Ga0068869_100123941 3300005334 Bacteria 1979
24 Ga0068869_100198227 3300005334 Bacteria 1582
25 Ga0070666_10094284 3300005335 Bacteria 2059
26 Ga0070680_100000976 3300005336 Bacteria 20279
27 Ga0070682_100068715 3300005337 Unclassified 2261
28 Ga0068868_100017053 3300005338 Bacteria 5404
29 Ga0068868_100168504 3300005338 Bacteria 1812
30 Ga0070689_100118450 3300005340 Bacteria 2113
31 Ga0070689_100414082 3300005340 Bacteria 1141
32 Ga0070687_100010363 3300005343 Bacteria 4029
33 Ga0070661_100211919 3300005344 Bacteria 1483
34 Ga0070692_10002529 3300005345 Bacteria 7113
35 Ga0070692_10454364 3300005345 Bacteria 821
36 Ga0070669_101088217 3300005353 Bacteria 688
37 Ga0070669_101347749 3300005353 Unclassified 618
38 Ga0070675_100633387 3300005354 Unclassified 971
39 Ga0070675_100685788 3300005354 Bacteria 932
40 Ga0070675_101581938 3300005354 Unclassified 605
41 Ga0070671_100004147 3300005355 Bacteria 11444
42 Ga0070671_100017451 3300005355 Bacteria 5814
43 Ga0070671_100278002 3300005355 Bacteria 1424
44 Ga0070671_100723852 3300005355 Unclassified 864
45 Ga0070674_100225240 3300005356 Bacteria 1461
46 Ga0070674_100864127 3300005356 Unclassified 785
47 Ga0070673_100027151 3300005364 Bacteria 4240
48 Ga0070673_100042461 3300005364 Bacteria 3506
49 Ga0070673_100123329 3300005364 Bacteria 2165
50 Ga0070673_100397419 3300005364 Bacteria 1232
51 Ga0070688_100170509 3300005365 Bacteria 1501
52 Ga0070688_100224584 3300005365 Bacteria 1325
53 Ga0070667_100144584 3300005367 Unclassified 2085
54 Ga0070667_100446776 3300005367 Bacteria 1181
55 Ga0070703_10000169 3300005406 Bacteria 32165
56 Ga0070710_10195538 3300005437 Bacteria 1274
57 Ga0070701_10174630 3300005438 Bacteria 1254
58 Ga0070711_100846581 3300005439 Unclassified 778
59 Ga0070705_100023711 3300005440 Bacteria 3300
60 Ga0070705_100279549 3300005440 Bacteria 1186
61 Ga0070705_100293178 3300005440 Bacteria 1162
62 Ga0070705_100301264 3300005440 Unclassified 1149
63 Ga0070705_100339675 3300005440 Bacteria 1091
64 Ga0070705_100602792 3300005440 Bacteria 850
65 Ga0070705_100635599 3300005440 Bacteria 830
66 Ga0070700_100013304 3300005441 Bacteria 4621
67 Ga0070700_100021083 3300005441 Bacteria 3785
68 Ga0070700_100072578 3300005441 Bacteria 2201
69 Ga0070700_100156833 3300005441 Bacteria 1563
70 Ga0070700_101243624 3300005441 Unclassified 623
71 Ga0070694_100327758 3300005444 Bacteria 1180
72 Ga0070694_100466772 3300005444 Unclassified 999
73 Ga0070694_100690910 3300005444 Unclassified 829
74 Ga0070694_100952263 3300005444 Unclassified 711
75 Ga0070708_100000227 3300005445 Bacteria 41985
76 Ga0070708_100009886 3300005445 Bacteria 7708
77 Ga0070678_100033270 3300005456 Bacteria 3577
78 Ga0070678_101080278 3300005456 Bacteria 740
79 Ga0070662_100476845 3300005457 Bacteria 1038
80 Ga0070681_10000276 3300005458 Bacteria 41123
81 Ga0070681_10010021 3300005458 Bacteria 9342
82 Ga0070681_10372171 3300005458 Bacteria 1339
83 Ga0068867_100029724 3300005459 Unclassified 3938
84 Ga0068867_100032731 3300005459 Bacteria 3762
85 Ga0068867_100241541 3300005459 Bacteria 1465
86 Ga0070685_10331514 3300005466 Bacteria 1035
87 Ga0070706_100177852 3300005467 Unclassified 1986
88 Ga0070706_100202547 3300005467 Bacteria 1854
89 Ga0070706_100268776 3300005467 Bacteria 1591
90 Ga0070706_100614790 3300005467 Unclassified 1009
91 Ga0070707_100060996 3300005468 Bacteria 3617
92 Ga0070707_100107220 3300005468 Bacteria 2710
93 Ga0070707_100152224 3300005468 Bacteria 2252
94 Ga0070707_100230653 3300005468 Bacteria 1802
95 Ga0070707_100260763 3300005468 Unclassified 1686
96 Ga0070707_100296614 3300005468 Bacteria 1571
97 Ga0070707_100408842 3300005468 Bacteria 1317
98 Ga0070707_100810612 3300005468 Bacteria 900
99 Ga0070707_101678569 3300005468 Unclassified 602
100 Ga0070698_100065817 3300005471 Bacteria 3649
101 Ga0070698_100177147 3300005471 Unclassified 2071
102 Ga0070698_100267979 3300005471 Bacteria 1639
103 Ga0070698_100362659 3300005471 Bacteria 1381
104 Ga0070699_100004809 3300005518 Bacteria 11924
105 Ga0070699_100100102 3300005518 Unclassified 2540
106 Ga0070699_100182982 3300005518 Unclassified 1860
107 Ga0070699_100196425 3300005518 Bacteria 1793
108 Ga0070699_100214331 3300005518 Bacteria 1715
109 Ga0070699_100312385 3300005518 Bacteria 1411
110 Ga0070699_100340998 3300005518 Bacteria 1349
111 Ga0070699_100480922 3300005518 Bacteria 1127
112 Ga0070699_100716863 3300005518 Bacteria 914
113 Ga0070699_100780933 3300005518 Unclassified 874
114 Ga0070699_101423756 3300005518 Unclassified 636
115 Ga0070679_100000023 3300005530 Bacteria 123167
116 Ga0070697_100009468 3300005536 Bacteria 7613
117 Ga0070697_100018631 3300005536 Bacteria 5475
118 Ga0070697_100118466 3300005536 Bacteria 2213
119 Ga0070697_100347680 3300005536 Bacteria 1280
120 Ga0070697_100907353 3300005536 Unclassified 782
121 Ga0070697_101681379 3300005536 Unclassified 568
122 Ga0068853_100116933 3300005539 Bacteria 2375
123 Ga0068853_100207287 3300005539 Unclassified 1786
124 Ga0068853_100887097 3300005539 Bacteria 856
125 Ga0070672_100055206 3300005543 Bacteria 3111
126 Ga0070686_100037651 3300005544 Bacteria 3001
127 Ga0070686_100094373 3300005544 Bacteria 2008
128 Ga0070686_100174796 3300005544 Bacteria 1521
129 Ga0070695_100038791 3300005545 Bacteria 3008
130 Ga0070695_100100653 3300005545 Bacteria 1946
131 Ga0070695_100134565 3300005545 Bacteria 1707
132 Ga0070695_100266947 3300005545 Unclassified 1252
133 Ga0070695_100827307 3300005545 Unclassified 743
134 Ga0070696_100029802 3300005546 Bacteria 3733
135 Ga0070696_100161086 3300005546 Bacteria 1653
136 Ga0070696_100335181 3300005546 Bacteria 1168
137 Ga0070693_100336579 3300005547 Bacteria 1029
138 Ga0070693_100340265 3300005547 Bacteria 1024
139 Ga0070665_100104683 3300005548 Bacteria 2832
140 Ga0070665_100519420 3300005548 Bacteria 1202
141 Ga0070704_100075085 3300005549 Bacteria 2468
142 Ga0070704_100222615 3300005549 Bacteria 1535
143 Ga0070704_100249790 3300005549 Bacteria 1456
144 Ga0070704_100466754 3300005549 Bacteria 1090
145 Ga0070704_101577280 3300005549 Bacteria 605
146 Ga0068855_100538033 3300005563 Bacteria 1266
147 Ga0068855_100866396 3300005563 Bacteria 956
148 Ga0070664_100068205 3300005564 Bacteria 3041
149 Ga0070664_100910193 3300005564 Unclassified 825
150 Ga0068857_100206718 3300005577 Bacteria 1791
151 Ga0068857_100626922 3300005577 Bacteria 1018
152 Ga0068857_101092966 3300005577 Bacteria 770
153 Ga0068854_100348646 3300005578 Bacteria 1211
154 Ga0068856_100002356 3300005614 Bacteria 19435
155 Ga0068856_100583809 3300005614 Bacteria 1139
156 Ga0070702_100021283 3300005615 Bacteria 3410
157 Ga0070702_100087369 3300005615 Bacteria 1883
158 Ga0070702_100222133 3300005615 Unclassified 1264
159 Ga0068852_100073151 3300005616 Unclassified 3015
160 Ga0068852_100792991 3300005616 Bacteria 961
161 Ga0068859_100049326 3300005617 Bacteria 4228
162 Ga0068859_100172557 3300005617 Bacteria 2244
163 Ga0068859_100342369 3300005617 Bacteria 1589
164 Ga0068859_100434351 3300005617 Bacteria 1409
165 Ga0068859_100552903 3300005617 Bacteria 1245
166 Ga0068859_100681487 3300005617 Bacteria 1119
167 Ga0068864_100013658 3300005618 Bacteria 6733
168 Ga0068864_100060656 3300005618 Bacteria 3274
169 Ga0068864_100075146 3300005618 Bacteria 2950
170 Ga0068864_100327405 3300005618 Bacteria 1440
171 Ga0068866_10018871 3300005718 Bacteria 3128
172 Ga0068861_100053512 3300005719 Bacteria 3071
173 Ga0068861_100478427 3300005719 Bacteria 1121
174 Ga0068861_100740982 3300005719 Bacteria 917
175 Ga0068851_10046413 3300005834 Bacteria 2197
176 Ga0068851_10287915 3300005834 Bacteria 941
177 Ga0068870_10121538 3300005840 Unclassified 1505
178 Ga0068870_10278413 3300005840 Unclassified 1048
179 Ga0068863_100766099 3300005841 Bacteria 961
180 Ga0068863_100853470 3300005841 Bacteria 910
181 Ga0068863_101010321 3300005841 Bacteria 834
182 Ga0068858_100102015 3300005842 Bacteria 2676
183 Ga0068858_100137727 3300005842 Bacteria 2291
184 Ga0068858_100276124 3300005842 Bacteria 1600
185 Ga0068860_100007291 3300005843 Bacteria 11059
186 Ga0068860_100068179 3300005843 Bacteria 3380
187 Ga0068860_100078306 3300005843 Bacteria 3143
188 Ga0068860_100088200 3300005843 Bacteria 2953
189 Ga0068860_100303079 3300005843 Bacteria 1566
190 Ga0068860_100348608 3300005843 Bacteria 1457
191 Ga0068860_100365400 3300005843 Bacteria 1422
192 Ga0068862_100016042 3300005844 Bacteria 6230
193 Ga0068862_100068954 3300005844 Bacteria 3051
194 Ga0081539_10000428 3300005985 Bacteria 89485
195 Ga0081539_10000652 3300005985 Bacteria 69804
196 Ga0081539_10108087 3300005985 Bacteria 1406
197 Ga0081539_10308632 3300005985 Unclassified 677
198 Ga0070715_10000034 3300006163 Bacteria 80012
199 Ga0070716_100000046 3300006173 Bacteria 49780
200 Ga0070716_100659938 3300006173 Bacteria 794
201 Ga0097621_100009167 3300006237 Bacteria 7173
202 Ga0097621_100058430 3300006237 Bacteria 3155
203 Ga0097621_100112836 3300006237 Bacteria 2299
204 Ga0097621_100168148 3300006237 Bacteria 1888
205 Ga0068871_100009882 3300006358 Bacteria 6928
206 Ga0068871_100020003 3300006358 Bacteria 5121
207 Ga0068871_100247310 3300006358 Bacteria 1552
208 Ga0068871_100559352 3300006358 Bacteria 1037
209 Ga0068871_101217372 3300006358 Bacteria 707
210 Ga0075433_10011665 3300006852 Bacteria 7077
211 Ga0075433_10078017 3300006852 Bacteria 2918
212 Ga0075434_100050177 3300006871 Bacteria 4144
213 Ga0075434_101320289 3300006871 Unclassified 732
214 Ga0075434_102101588 3300006871 Bacteria 569
215 Ga0075429_100290406 3300006880 Bacteria 1432
216 Ga0068865_100091659 3300006881 Bacteria 2206
217 Ga0068865_100188636 3300006881 Bacteria 1592
218 Ga0068865_100461669 3300006881 Bacteria 1052
219 Ga0075436_100000013 3300006914 Bacteria 177118
220 Ga0075436_100472412 3300006914 Unclassified 915
221 Ga0097620_100049325 3300006931 Bacteria 4228
222 Ga0097620_100172549 3300006931 Bacteria 2244
223 Ga0097620_100342364 3300006931 Bacteria 1589
224 Ga0097620_100434365 3300006931 Bacteria 1409
225 Ga0097620_100552855 3300006931 Bacteria 1245
226 Ga0097620_100681397 3300006931 Bacteria 1119
227 Ga0075435_100000870 3300007076 Bacteria 18936
228 Ga0075435_100005399 3300007076 Bacteria 8912
229 Ga0075435_100624832 3300007076 Unclassified 934
230 Ga0099794_10000664 3300007265 Bacteria 11504
231 Ga0105251_10075900 3300009011 Bacteria 1560
232 Ga0105250_10375577 3300009092 Unclassified 626
233 Ga0105240_10083294 3300009093 Bacteria 3925
234 Ga0105240_11338717 3300009093 Unclassified 754
235 Ga0111539_10009392 3300009094 Bacteria 12346
236 Ga0111539_10765645 3300009094 Bacteria 1124
237 Ga0105245_10007937 3300009098 Bacteria 9281
238 Ga0105245_10277095 3300009098 Bacteria 1638
239 Ga0105245_11395575 3300009098 Bacteria 750
240 Ga0105247_10058770 3300009101 Bacteria 2379
241 Ga0105247_10192463 3300009101 Unclassified 1366
242 Ga0114129_10012036 3300009147 Bacteria 12305
243 Ga0114129_10020944 3300009147 Bacteria 9288
244 Ga0105243_10000482 3300009148 Bacteria 40773
245 Ga0105243_10002266 3300009148 Bacteria 16166
246 Ga0105243_10007104 3300009148 Bacteria 8611
247 Ga0105243_10063800 3300009148 Bacteria 2953
248 Ga0105243_10801403 3300009148 Unclassified 928
249 Ga0105243_10978432 3300009148 Unclassified 847
250 Ga0105243_11439398 3300009148 Bacteria 711
251 Ga0105241_10037521 3300009174 Bacteria 3651
252 Ga0105241_10083525 3300009174 Bacteria 2506
253 Ga0105241_10166037 3300009174 Bacteria 1819
254 Ga0105241_10235594 3300009174 Bacteria 1545
255 Ga0105241_10456339 3300009174 Bacteria 1131
256 Ga0105242_10000118 3300009176 Bacteria 57840
257 Ga0105242_10008111 3300009176 Bacteria 8079
258 Ga0105242_10093657 3300009176 Bacteria 2533
259 Ga0105242_10148012 3300009176 Bacteria 2045
260 Ga0105242_11303048 3300009176 Bacteria 750
261 Ga0105242_11685207 3300009176 Unclassified 670
262 Ga0105248_10033498 3300009177 Bacteria 5739
263 Ga0105248_10049738 3300009177 Bacteria 4701
264 Ga0105248_10400614 3300009177 Bacteria 1545
265 Ga0105248_11064447 3300009177 Bacteria 914
266 Ga0105248_11761099 3300009177 Unclassified 702
267 Ga0105237_10059302 3300009545 Bacteria 3829
268 Ga0105237_10111057 3300009545 Bacteria 2733
269 Ga0105237_10619054 3300009545 Bacteria 1089
270 Ga0105238_10006918 3300009551 Bacteria 11331
271 Ga0105249_10015468 3300009553 Bacteria 6752
272 Ga0105249_10017970 3300009553 Bacteria 6285
273 Ga0105249_10045662 3300009553 Bacteria 3985
274 Ga0105249_10138784 3300009553 Unclassified 2329
275 Ga0105249_10394013 3300009553 Bacteria 1414
276 Ga0105239_10087281 3300010375 Bacteria 3439
277 Ga0105239_10216556 3300010375 Bacteria 2147
278 Ga0105239_10588277 3300010375 Bacteria 1269
279 Ga0105239_11972032 3300010375 Bacteria 678
280 Ga0105246_10013794 3300011119 Bacteria 5071
281 Ga0105246_10837118 3300011119 Unclassified 819
282 Ga0105246_12117831 3300011119 Unclassified 545
283 Ga0157373_10363243 3300013100 Unclassified 1034
284 Ga0157373_11045653 3300013100 Bacteria 611
285 Ga0157371_10614880 3300013102 Unclassified 809
286 Ga0157374_10006823 3300013296 Bacteria 9712
287 Ga0157378_10000025 3300013297 Bacteria 128568
288 Ga0157378_10005237 3300013297 Bacteria 11388
289 Ga0157378_10006797 3300013297 Bacteria 9978
290 Ga0157378_10045898 3300013297 Bacteria 3884
291 Ga0157378_10061044 3300013297 Bacteria 3363
292 Ga0157378_10161076 3300013297 Bacteria 2098
293 Ga0157378_10386824 3300013297 Bacteria 1375
294 Ga0157378_10977654 3300013297 Unclassified 880
295 Ga0157378_11051258 3300013297 Bacteria 850
296 Ga0157378_12186189 3300013297 Unclassified 604
297 Ga0163162_10000217 3300013306 Bacteria 52537
298 Ga0163162_10002802 3300013306 Bacteria 16578
299 Ga0163162_10009762 3300013306 Bacteria 9344
300 Ga0163162_10392047 3300013306 Bacteria 1521
301 Ga0157372_10022224 3300013307 Bacteria 6863
302 Ga0157375_10000961 3300013308 Bacteria 24932
303 Ga0157375_10030714 3300013308 Bacteria 5070
304 Ga0157375_10134793 3300013308 Bacteria 2592
305 Ga0157375_10242556 3300013308 Bacteria 1962
306 Ga0157375_10801330 3300013308 Bacteria 1091
307 Ga0163163_10011974 3300014325 Bacteria 7893
308 Ga0163163_10017931 3300014325 Bacteria 6613
309 Ga0163163_10052684 3300014325 Bacteria 4015
310 Ga0163163_10058380 3300014325 Bacteria 3815
311 Ga0163163_10098992 3300014325 Bacteria 2937
312 Ga0157380_10000172 3300014326 Bacteria 37297
313 Ga0157380_10023212 3300014326 Bacteria 4679
314 Ga0157380_10393506 3300014326 Bacteria 1312
315 Ga0157380_10533199 3300014326 Bacteria 1148
316 Ga0157380_11818646 3300014326 Bacteria 669
317 Ga0157377_10012287 3300014745 Bacteria 4301
318 Ga0157379_10679493 3300014968 Unclassified 965
319 Ga0157379_10851956 3300014968 Bacteria 862
320 Ga0157379_11305426 3300014968 Unclassified 701
321 Ga0157376_10005235 3300014969 Bacteria 9057
322 Ga0157376_10023461 3300014969 Bacteria 4828
323 Ga0157376_10108323 3300014969 Bacteria 2441
324 Ga0157376_11011359 3300014969 Unclassified 854
325 Ga0207653_10000117 3300025885 Bacteria 55842
326 Ga0207653_10066820 3300025885 Bacteria 1222
327 Ga0207692_10187765 3300025898 Bacteria 1208
328 Ga0207642_10017692 3300025899 Unclassified 2718
329 Ga0207642_10102807 3300025899 Bacteria 1438
330 Ga0207642_10588783 3300025899 Unclassified 691
331 Ga0207710_10001685 3300025900 Bacteria 10735
332 Ga0207688_10220470 3300025901 Bacteria 1142
333 Ga0207680_10020886 3300025903 Bacteria 3535
334 Ga0207647_10008632 3300025904 Bacteria 7289
335 Ga0207647_10148025 3300025904 Bacteria 1373
336 Ga0207685_10000008 3300025905 Bacteria 273136
337 Ga0207699_11049830 3300025906 Unclassified 603
338 Ga0207643_10113095 3300025908 Bacteria 1601
339 Ga0207684_10015129 3300025910 Bacteria 6643
340 Ga0207684_10190262 3300025910 Unclassified 1770
341 Ga0207684_10532848 3300025910 Unclassified 1005
342 Ga0207654_10033911 3300025911 Bacteria 2833
343 Ga0207654_10067423 3300025911 Bacteria 2114
344 Ga0207654_10225162 3300025911 Bacteria 1246
345 Ga0207654_10549679 3300025911 Bacteria 820
346 Ga0207707_10000007 3300025912 Bacteria 368555
347 Ga0207707_10094488 3300025912 Bacteria 2612
348 Ga0207695_10947683 3300025913 Unclassified 740
349 Ga0207660_10005155 3300025917 Bacteria 8495
350 Ga0207662_10005761 3300025918 Bacteria 6631
351 Ga0207662_10144083 3300025918 Bacteria 1511
352 Ga0207662_10178282 3300025918 Bacteria 1366
353 Ga0207662_10273748 3300025918 Bacteria 1115
354 Ga0207652_10000315 3300025921 Bacteria 49929
355 Ga0207646_10025284 3300025922 Bacteria 5432
356 Ga0207646_10044358 3300025922 Unclassified 3991
357 Ga0207646_10066493 3300025922 Bacteria 3219
358 Ga0207646_10165310 3300025922 Bacteria 1997
359 Ga0207646_10239863 3300025922 Bacteria 1638
360 Ga0207646_10252545 3300025922 Bacteria 1593
361 Ga0207646_10508295 3300025922 Unclassified 1085
362 Ga0207681_10124953 3300025923 Bacteria 1893
363 Ga0207681_10548173 3300025923 Unclassified 951
364 Ga0207694_10027713 3300025924 Bacteria 4315
365 Ga0207694_10559997 3300025924 Unclassified 960
366 Ga0207650_10102267 3300025925 Bacteria 2207
367 Ga0207659_10048042 3300025926 Bacteria 3021
368 Ga0207659_10547069 3300025926 Unclassified 984
369 Ga0207687_10208867 3300025927 Bacteria 1530
370 Ga0207687_10294720 3300025927 Bacteria 1305
371 Ga0207644_10000961 3300025931 Bacteria 18372
372 Ga0207644_10003009 3300025931 Bacteria 10844
373 Ga0207644_10011976 3300025931 Bacteria 5751
374 Ga0207644_10506014 3300025931 Bacteria 997
375 Ga0207644_10720681 3300025931 Unclassified 832
376 Ga0207706_10482335 3300025933 Unclassified 1071
377 Ga0207686_10119714 3300025934 Bacteria 1790
378 Ga0207686_10214788 3300025934 Bacteria 1385
379 Ga0207686_10320800 3300025934 Bacteria 1157
380 Ga0207709_10000937 3300025935 Bacteria 21889
381 Ga0207709_10004195 3300025935 Bacteria 8361
382 Ga0207709_10253471 3300025935 Bacteria 1287
383 Ga0207709_10910051 3300025935 Unclassified 715
384 Ga0207670_10092824 3300025936 Bacteria 2137
385 Ga0207665_10000131 3300025939 Bacteria 49773
386 Ga0207665_10062720 3300025939 Bacteria 2522
387 Ga0207691_10000666 3300025940 Bacteria 33938
388 Ga0207711_10061190 3300025941 Bacteria 3246
389 Ga0207711_10273635 3300025941 Bacteria 1554
390 Ga0207711_10290920 3300025941 Bacteria 1506
391 Ga0207689_10002191 3300025942 Bacteria 18319
392 Ga0207689_10042068 3300025942 Bacteria 3782
393 Ga0207689_10111702 3300025942 Bacteria 2246
394 Ga0207689_10175492 3300025942 Bacteria 1767
395 Ga0207689_10284658 3300025942 Bacteria 1369
396 Ga0207689_10641724 3300025942 Bacteria 894
397 Ga0207679_10022372 3300025945 Bacteria 4303
398 Ga0207679_10844719 3300025945 Bacteria 836
399 Ga0207667_10763071 3300025949 Bacteria 966
400 Ga0207667_10771101 3300025949 Bacteria 960
401 Ga0207651_10011455 3300025960 Bacteria 4967
402 Ga0207651_10128049 3300025960 Bacteria 1938
403 Ga0207651_10299177 3300025960 Bacteria 1337
404 Ga0207651_10323936 3300025960 Bacteria 1289
405 Ga0207651_10412758 3300025960 Unclassified 1151
406 Ga0207712_10066887 3300025961 Bacteria 2570
407 Ga0207712_10074074 3300025961 Unclassified 2457
408 Ga0207640_10155434 3300025981 Unclassified 1685
409 Ga0207640_10495276 3300025981 Bacteria 1017
410 Ga0207658_10022369 3300025986 Bacteria 4402
411 Ga0207703_10296564 3300026035 Unclassified 1473
412 Ga0207703_10794171 3300026035 Unclassified 903
413 Ga0207639_10064221 3300026041 Bacteria 2845
414 Ga0207639_10202526 3300026041 Bacteria 1703
415 Ga0207639_10901746 3300026041 Bacteria 826
416 Ga0207708_10000201 3300026075 Bacteria 47331
417 Ga0207708_10147368 3300026075 Bacteria 1850
418 Ga0207708_10215412 3300026075 Bacteria 1537
419 Ga0207708_10336660 3300026075 Bacteria 1235
420 Ga0207708_10635736 3300026075 Bacteria 907
421 Ga0207708_10906874 3300026075 Bacteria 763
422 Ga0207641_10131835 3300026088 Bacteria 2245
423 Ga0207641_10523649 3300026088 Bacteria 1153
424 Ga0207641_10526626 3300026088 Bacteria 1150
425 Ga0207641_10720744 3300026088 Bacteria 983
426 Ga0207641_11792820 3300026088 Bacteria 616
427 Ga0207648_10043455 3300026089 Unclassified 3944
428 Ga0207648_10085744 3300026089 Unclassified 2747
429 Ga0207648_10106756 3300026089 Bacteria 2457
430 Ga0207648_10144188 3300026089 Bacteria 2100
431 Ga0207648_10232063 3300026089 Bacteria 1641
432 Ga0207648_10771527 3300026089 Bacteria 894
433 Ga0207676_10007145 3300026095 Bacteria 7907
434 Ga0207676_10058154 3300026095 Bacteria 3049
435 Ga0207676_10074469 3300026095 Bacteria 2736
436 Ga0207676_10117904 3300026095 Bacteria 2233
437 Ga0207676_10237987 3300026095 Bacteria 1631
438 Ga0207674_10042576 3300026116 Bacteria 4689
439 Ga0207674_10708041 3300026116 Bacteria 972
440 Ga0207674_11530662 3300026116 Unclassified 636
441 Ga0207675_100000466 3300026118 Bacteria 39467
442 Ga0207675_100000467 3300026118 Bacteria 39445
443 Ga0207675_100769034 3300026118 Bacteria 975
444 Ga0207675_101656609 3300026118 Unclassified 660
445 Ga0207683_10052134 3300026121 Bacteria 3584
446 Ga0207698_10220749 3300026142 Bacteria 1713
447 Ga0207698_10701008 3300026142 Bacteria 1007
448 Ga0207698_11415730 3300026142 Unclassified 710
449 Ga0209588_1008957 3300027671 Unclassified 2979
450 Ga0207428_10007143 3300027907 Bacteria 10217
451 Ga0207428_10388998 3300027907 Bacteria 1022
452 Ga0268266_10013318 3300028379 Bacteria 7087
453 Ga0268266_10439500 3300028379 Bacteria 1239
454 Ga0268265_10369694 3300028380 Bacteria 1316
455 Ga0268265_10579125 3300028380 Bacteria 1069
456 Ga0268265_12198683 3300028380 Bacteria 559
457 Ga0268264_10149409 3300028381 Bacteria 2093
458 Ga0268264_10229523 3300028381 Bacteria 1713
459 Ga0268264_10253945 3300028381 Bacteria 1635
460 Ga0268264_10459860 3300028381 Bacteria 1234
461 Ga0268264_11122845 3300028381 Unclassified 795
462 Ga0268264_11813638 3300028381 Bacteria 620
463 Ga0307513_10199499 3300031456 Bacteria 1843
464 Ga0307408_100174515 3300031548 Bacteria 1719
465 Ga0307416_101142826 3300032002 Bacteria 884
466 Ga0373940_0023215 3300035088 Bacteria 1599
467 Ga0373941_0014554 3300035115 Bacteria 2104
468 Ga0373931_0101207 3300035691 Bacteria 1621
469 Ga0373937_0206772 3300036401 Bacteria 1846
470 Ga0395900_0568586 3300037418 Bacteria 1077
471 Ga0395905_1124008 3300037471 Unclassified 689
472 Ga0242420_004727 3300038996 Bacteria 2073
473 Ga0439465_0050639 3300041413 Unclassified 1359
474 Ga0439432_057069 3300042006 Unclassified 1209
475 Ga0453683_0020349 3300044673 Unclassified 4242
476 Ga0451576_1696766 3300045051 Unclassified 654
477 Ga0495663_0058870 3300046525 Bacteria 1205
478 Ga0495663_0132772 3300046525 Unclassified 841
479 Ga0495621_0061128 3300046539 Bacteria 1368
480 Ga0495636_0058780 3300047318 Bacteria 1622
481 Ga0495672_0092333 3300047320 Bacteria 1660
482 Ga0496102_0223252 3300048905 Bacteria 1776
483 Ga0496103_0227261 3300048906 Bacteria 1200
484 Ga0496103_0861405 3300048906 Unclassified 569
485 Ga0496104_0020313 3300048907 Bacteria 6087
486 Ga0496105_0878702 3300048908 Unclassified 677
487 Ga0496106_0001166 3300048909 Bacteria 19534
488 Ga0496106_0174247 3300048909 Bacteria 1706
489 Ga0496107_0143991 3300048910 Bacteria 1762
490 Ga0496108_0093882 3300048911 Bacteria 2553
491 Ga0496109_0598913 3300048912 Bacteria 1038
492 Ga0496110_0041230 3300048913 Bacteria 4028
493 Ga0496110_1076757 3300048913 Bacteria 712
494 Ga0496112_0096549 3300048915 Bacteria 2926
495 Ga0496112_0122095 3300048915 Bacteria 2576
496 Ga0496113_0055428 3300048916 Bacteria 2972
497 Ga0496113_1171441 3300048916 Unclassified 601
498 nmdc:mga05p37_124402_c1 3300050507 Bacteria 3167
499 nmdc:mga05p37_67512_c1 3300050507 Bacteria 4399
500 nmdc:mga09592_484710_c1 3300050508 Bacteria 1065
501 nmdc:mga08y16_7718_c1 3300050511 Bacteria 11267
502 nmdc:mga0n895_552483_c1 3300050512 Bacteria 1157
503 nmdc:mga0n895_593317_c1 3300050512 Bacteria 1111
504 nmdc:mga0n895_71338_c1 3300050512 Bacteria 3444
505 nmdc:mga0rr50_337_c1 3300050513 Bacteria 25438
506 nmdc:mga0rr50_385358_c1 3300050513 Bacteria 1182
507 nmdc:mga0rr50_491245_c1 3300050513 Unclassified 1043
508 nmdc:mga08x19_29_c1 3300050514 Bacteria 214647
509 nmdc:mga0a205_25415_c1 3300050515 Bacteria 5643
510 nmdc:mga0a205_343093_c1 3300050515 Bacteria 1362
511 nmdc:mga0a205_54269_c1 3300050515 Unclassified 3869
512 Ga0207665_10032163
513 SwRhRL3b_contig_2049852
514 SwRhRL2b_contig_1621087
515 MBSR1b_contig_10124042
516 rootL2_10345859
517 Ga0065704_10185206
518 Ga0065712_10068601
519 Ga0065715_10005851
520 Ga0065715_10103745
521 Ga0065715_10162917
522 Ga0065715_10165214
523 Ga0065715_10185590
524 Ga0065715_10430254
525 Ga0065707_10002540
526 Ga0065707_10095984
527 Ga0070676_10115268
528 Ga0070690_100050501
529 Ga0070690_100124204
530 Ga0070690_100867910
531 Ga0070670_101264366
532 Ga0070670_101834404
533 Ga0068869_100039107
534 Ga0068869_100123941
535 Ga0068869_100198227
536 Ga0070666_10094284
537 Ga0070680_100000976
538 Ga0070682_100068715
539 Ga0068868_100017053
540 Ga0068868_100168504
541 Ga0070689_100118450
542 Ga0070689_100414082
543 Ga0070687_100010363
544 Ga0070661_100211919
545 Ga0070692_10002529
546 Ga0070692_10454364
547 Ga0070669_101088217
548 Ga0070669_101347749
549 Ga0070675_100633387
550 Ga0070675_100685788
551 Ga0070675_101581938
552 Ga0070671_100004147
553 Ga0070671_100017451
554 Ga0070671_100278002
555 Ga0070671_100723852
556 Ga0070674_100225240
557 Ga0070674_100864127
558 Ga0070673_100027151
559 Ga0070673_100042461
560 Ga0070673_100123329
561 Ga0070673_100397419
562 Ga0070688_100170509
563 Ga0070688_100224584
564 Ga0070667_100144584
565 Ga0070667_100446776
566 Ga0070703_10000169
567 Ga0070710_10195538
568 Ga0070701_10174630
569 Ga0070711_100846581
570 Ga0070705_100023711
571 Ga0070705_100279549
572 Ga0070705_100293178
573 Ga0070705_100301264
574 Ga0070705_100339675
575 Ga0070705_100602792
576 Ga0070705_100635599
577 Ga0070700_100013304
578 Ga0070700_100021083
579 Ga0070700_100072578
580 Ga0070700_100156833
581 Ga0070700_101243624
582 Ga0070694_100327758
583 Ga0070694_100466772
584 Ga0070694_100690910
585 Ga0070694_100952263
586 Ga0070708_100000227
587 Ga0070708_100009886
588 Ga0070678_100033270
589 Ga0070678_101080278
590 Ga0070662_100476845
591 Ga0070681_10000276
592 Ga0070681_10010021
593 Ga0070681_10372171
594 Ga0068867_100029724
595 Ga0068867_100032731
596 Ga0068867_100241541
597 Ga0070685_10331514
598 Ga0070706_100177852
599 Ga0070706_100202547
600 Ga0070706_100268776
601 Ga0070706_100614790
602 Ga0070707_100060996
603 Ga0070707_100107220
604 Ga0070707_100152224
605 Ga0070707_100230653
606 Ga0070707_100260763
607 Ga0070707_100296614
608 Ga0070707_100408842
609 Ga0070707_100810612
610 Ga0070707_101678569
611 Ga0070698_100065817
612 Ga0070698_100177147
613 Ga0070698_100267979
614 Ga0070698_100362659
615 Ga0070699_100004809
616 Ga0070699_100100102
617 Ga0070699_100182982
618 Ga0070699_100196425
619 Ga0070699_100214331
620 Ga0070699_100312385
621 Ga0070699_100340998
622 Ga0070699_100480922
623 Ga0070699_100716863
624 Ga0070699_100780933
625 Ga0070699_101423756
626 Ga0070679_100000023
627 Ga0070697_100009468
628 Ga0070697_100018631
629 Ga0070697_100118466
630 Ga0070697_100347680
631 Ga0070697_100907353
632 Ga0070697_101681379
633 Ga0068853_100116933
634 Ga0068853_100207287
635 Ga0068853_100887097
636 Ga0070672_100055206
637 Ga0070686_100037651
638 Ga0070686_100094373
639 Ga0070686_100174796
640 Ga0070695_100038791
641 Ga0070695_100100653
642 Ga0070695_100134565
643 Ga0070695_100266947
644 Ga0070695_100827307
645 Ga0070696_100029802
646 Ga0070696_100161086
647 Ga0070696_100335181
648 Ga0070693_100336579
649 Ga0070693_100340265
650 Ga0070665_100104683
651 Ga0070665_100519420
652 Ga0070704_100075085
653 Ga0070704_100222615
654 Ga0070704_100249790
655 Ga0070704_100466754
656 Ga0070704_101577280
657 Ga0068855_100538033
658 Ga0068855_100866396
659 Ga0070664_100068205
660 Ga0070664_100910193
661 Ga0068857_100206718
662 Ga0068857_100626922
663 Ga0068857_101092966
664 Ga0068854_100348646
665 Ga0068856_100002356
666 Ga0068856_100583809
667 Ga0070702_100021283
668 Ga0070702_100087369
669 Ga0070702_100222133
670 Ga0068852_100073151
671 Ga0068852_100792991
672 Ga0068859_100049326
673 Ga0068859_100172557
674 Ga0068859_100342369
675 Ga0068859_100434351
676 Ga0068859_100552903
677 Ga0068859_100681487
678 Ga0068864_100013658
679 Ga0068864_100060656
680 Ga0068864_100075146
681 Ga0068864_100327405
682 Ga0068866_10018871
683 Ga0068861_100053512
684 Ga0068861_100478427
685 Ga0068861_100740982
686 Ga0068851_10046413
687 Ga0068851_10287915
688 Ga0068870_10121538
689 Ga0068870_10278413
690 Ga0068863_100766099
691 Ga0068863_100853470
692 Ga0068863_101010321
693 Ga0068858_100102015
694 Ga0068858_100137727
695 Ga0068858_100276124
696 Ga0068860_100007291
697 Ga0068860_100068179
698 Ga0068860_100078306
699 Ga0068860_100088200
700 Ga0068860_100303079
701 Ga0068860_100348608
702 Ga0068860_100365400
703 Ga0068862_100016042
704 Ga0068862_100068954
705 Ga0081539_10000428
706 Ga0081539_10000652
707 Ga0081539_10108087
708 Ga0081539_10308632
709 Ga0070715_10000034
710 Ga0070716_100000046
711 Ga0070716_100659938
712 Ga0097621_100009167
713 Ga0097621_100058430
714 Ga0097621_100112836
715 Ga0097621_100168148
716 Ga0068871_100009882
717 Ga0068871_100020003
718 Ga0068871_100247310
719 Ga0068871_100559352
720 Ga0068871_101217372
721 Ga0075433_10011665
722 Ga0075433_10078017
723 Ga0075434_100050177
724 Ga0075434_101320289
725 Ga0075434_102101588
726 Ga0075429_100290406
727 Ga0068865_100091659
728 Ga0068865_100188636
729 Ga0068865_100461669
730 Ga0075436_100000013
731 Ga0075436_100472412
732 Ga0097620_100049325
733 Ga0097620_100172549
734 Ga0097620_100342364
735 Ga0097620_100434365
736 Ga0097620_100552855
737 Ga0097620_100681397
738 Ga0075435_100000870
739 Ga0075435_100005399
740 Ga0075435_100624832
741 Ga0099794_10000664
742 Ga0105251_10075900
743 Ga0105250_10375577
744 Ga0105240_10083294
745 Ga0105240_11338717
746 Ga0111539_10009392
747 Ga0111539_10765645
748 Ga0105245_10007937
749 Ga0105245_10277095
750 Ga0105245_11395575
751 Ga0105247_10058770
752 Ga0105247_10192463
753 Ga0114129_10012036
754 Ga0114129_10020944
755 Ga0105243_10000482
756 Ga0105243_10002266
757 Ga0105243_10007104
758 Ga0105243_10063800
759 Ga0105243_10801403
760 Ga0105243_10978432
761 Ga0105243_11439398
762 Ga0105241_10037521
763 Ga0105241_10083525
764 Ga0105241_10166037
765 Ga0105241_10235594
766 Ga0105241_10456339
767 Ga0105242_10000118
768 Ga0105242_10008111
769 Ga0105242_10093657
770 Ga0105242_10148012
771 Ga0105242_11303048
772 Ga0105242_11685207
773 Ga0105248_10033498
774 Ga0105248_10049738
775 Ga0105248_10400614
776 Ga0105248_11064447
777 Ga0105248_11761099
778 Ga0105237_10059302
779 Ga0105237_10111057
780 Ga0105237_10619054
781 Ga0105238_10006918
782 Ga0105249_10015468
783 Ga0105249_10017970
784 Ga0105249_10045662
785 Ga0105249_10138784
786 Ga0105249_10394013
787 Ga0105239_10087281
788 Ga0105239_10216556
789 Ga0105239_10588277
790 Ga0105239_11972032
791 Ga0105246_10013794
792 Ga0105246_10837118
793 Ga0105246_12117831
794 Ga0157373_10363243
795 Ga0157373_11045653
796 Ga0157371_10614880
797 Ga0157374_10006823
798 Ga0157378_10000025
799 Ga0157378_10005237
800 Ga0157378_10006797
801 Ga0157378_10045898
802 Ga0157378_10061044
803 Ga0157378_10161076
804 Ga0157378_10386824
805 Ga0157378_10977654
806 Ga0157378_11051258
807 Ga0157378_12186189
808 Ga0163162_10000217
809 Ga0163162_10002802
810 Ga0163162_10009762
811 Ga0163162_10392047
812 Ga0157372_10022224
813 Ga0157375_10000961
814 Ga0157375_10030714
815 Ga0157375_10134793
816 Ga0157375_10242556
817 Ga0157375_10801330
818 Ga0163163_10011974
819 Ga0163163_10017931
820 Ga0163163_10052684
821 Ga0163163_10058380
822 Ga0163163_10098992
823 Ga0157380_10000172
824 Ga0157380_10023212
825 Ga0157380_10393506
826 Ga0157380_10533199
827 Ga0157380_11818646
828 Ga0157377_10012287
829 Ga0157379_10679493
830 Ga0157379_10851956
831 Ga0157379_11305426
832 Ga0157376_10005235
833 Ga0157376_10023461
834 Ga0157376_10108323
835 Ga0157376_11011359
836 Ga0207653_10000117
837 Ga0207653_10066820
838 Ga0207692_10187765
839 Ga0207642_10017692
840 Ga0207642_10102807
841 Ga0207642_10588783
842 Ga0207710_10001685
843 Ga0207688_10220470
844 Ga0207680_10020886
845 Ga0207647_10008632
846 Ga0207647_10148025
847 Ga0207685_10000008
848 Ga0207699_11049830
849 Ga0207643_10113095
850 Ga0207684_10015129
851 Ga0207684_10190262
852 Ga0207684_10532848
853 Ga0207654_10033911
854 Ga0207654_10067423
855 Ga0207654_10225162
856 Ga0207654_10549679
857 Ga0207707_10000007
858 Ga0207707_10094488
859 Ga0207695_10947683
860 Ga0207660_10005155
861 Ga0207662_10005761
862 Ga0207662_10144083
863 Ga0207662_10178282
864 Ga0207662_10273748
865 Ga0207652_10000315
866 Ga0207646_10025284
867 Ga0207646_10044358
868 Ga0207646_10066493
869 Ga0207646_10165310
870 Ga0207646_10239863
871 Ga0207646_10252545
872 Ga0207646_10508295
873 Ga0207681_10124953
874 Ga0207681_10548173
875 Ga0207694_10027713
876 Ga0207694_10559997
877 Ga0207650_10102267
878 Ga0207659_10048042
879 Ga0207659_10547069
880 Ga0207687_10208867
881 Ga0207687_10294720
882 Ga0207644_10000961
883 Ga0207644_10003009
884 Ga0207644_10011976
885 Ga0207644_10506014
886 Ga0207644_10720681
887 Ga0207706_10482335
888 Ga0207686_10119714
889 Ga0207686_10214788
890 Ga0207686_10320800
891 Ga0207709_10000937
892 Ga0207709_10004195
893 Ga0207709_10253471
894 Ga0207709_10910051
895 Ga0207670_10092824
896 Ga0207665_10000131
897 Ga0207665_10062720
898 Ga0207691_10000666
899 Ga0207711_10061190
900 Ga0207711_10273635
901 Ga0207711_10290920
902 Ga0207689_10002191
903 Ga0207689_10042068
904 Ga0207689_10111702
905 Ga0207689_10175492
906 Ga0207689_10284658
907 Ga0207689_10641724
908 Ga0207679_10022372
909 Ga0207679_10844719
910 Ga0207667_10763071
911 Ga0207667_10771101
912 Ga0207651_10011455
913 Ga0207651_10128049
914 Ga0207651_10299177
915 Ga0207651_10323936
916 Ga0207651_10412758
917 Ga0207712_10066887
918 Ga0207712_10074074
919 Ga0207640_10155434
920 Ga0207640_10495276
921 Ga0207658_10022369
922 Ga0207703_10296564
923 Ga0207703_10794171
924 Ga0207639_10064221
925 Ga0207639_10202526
926 Ga0207639_10901746
927 Ga0207708_10000201
928 Ga0207708_10147368
929 Ga0207708_10215412
930 Ga0207708_10336660
931 Ga0207708_10635736
932 Ga0207708_10906874
933 Ga0207641_10131835
934 Ga0207641_10523649
935 Ga0207641_10526626
936 Ga0207641_10720744
937 Ga0207641_11792820
938 Ga0207648_10043455
939 Ga0207648_10085744
940 Ga0207648_10106756
941 Ga0207648_10144188
942 Ga0207648_10232063
943 Ga0207648_10771527
944 Ga0207676_10007145
945 Ga0207676_10058154
946 Ga0207676_10074469
947 Ga0207676_10117904
948 Ga0207676_10237987
949 Ga0207674_10042576
950 Ga0207674_10708041
951 Ga0207674_11530662
952 Ga0207675_100000466
953 Ga0207675_100000467
954 Ga0207675_100769034
955 Ga0207675_101656609
956 Ga0207683_10052134
957 Ga0207698_10220749
958 Ga0207698_10701008
959 Ga0207698_11415730
960 Ga0209588_1008957
961 Ga0207428_10007143
962 Ga0207428_10388998
963 Ga0268266_10013318
964 Ga0268266_10439500
965 Ga0268265_10369694
966 Ga0268265_10579125
967 Ga0268265_12198683
968 Ga0268264_10149409
969 Ga0268264_10229523
970 Ga0268264_10253945
971 Ga0268264_10459860
972 Ga0268264_11122845
973 Ga0268264_11813638
974 Ga0307513_10199499
975 Ga0307408_100174515
976 Ga0307416_101142826
977 Ga0373940_0023215
978 Ga0373941_0014554
979 Ga0373931_0101207
980 Ga0373937_0206772
981 Ga0395900_0568586
982 Ga0395905_1124008
983 Ga0242420_004727
984 Ga0439465_0050639
985 Ga0439432_057069
986 Ga0453683_0020349
987 Ga0451576_1696766
988 Ga0495663_0058870
989 Ga0495663_0132772
990 Ga0495621_0061128
991 Ga0495636_0058780
992 Ga0495672_0092333
993 Ga0496102_0223252
994 Ga0496103_0227261
995 Ga0496103_0861405
996 Ga0496104_0020313
997 Ga0496105_0878702
998 Ga0496106_0001166
999 Ga0496106_0174247
1000 Ga0496107_0143991
1001 Ga0496108_0093882
1002 Ga0496109_0598913
1003 Ga0496110_0041230
1004 Ga0496110_1076757
1005 Ga0496112_0096549
1006 Ga0496112_0122095
1007 Ga0496113_0055428
1008 Ga0496113_1171441
1009 nmdc:mga05p37_124402_c1
1010 nmdc:mga05p37_67512_c1
1011 nmdc:mga09592_484710_c1
1012 nmdc:mga08y16_7718_c1
1013 nmdc:mga0n895_552483_c1
1014 nmdc:mga0n895_593317_c1
1015 nmdc:mga0n895_71338_c1
1016 nmdc:mga0rr50_337_c1
1017 nmdc:mga0rr50_385358_c1
1018 nmdc:mga0rr50_491245_c1
1019 nmdc:mga08x19_29_c1
1020 nmdc:mga0a205_25415_c1
1021 nmdc:mga0a205_343093_c1
1022 nmdc:mga0a205_54269_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

63

0.94

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

46

188

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.9098 10 153
4q29-assembly1.cif.gz_B ensemble refinement of plu4264 protein from photorhabdus luminescens 0.8598 46 131
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.8569 7 135
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.8565 5 135
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.8521 6 135
ID Description Score Start End Superfamily
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9032 46 148 2.60.120.10
af_A0A1D6KN97_1_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8975 46 132 2.60.120.10
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8843 10 153 2.60.120.10
af_F1LVA4_327_469_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8794 45 151 2.60.120.10
af_A0A0R0GUX4_36_216_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8759 46 129 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1L290-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase family protein 0.9991 5 130 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2V8PHX6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9984 1 160 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7Y5LB19-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase family protein 0.998 5 160 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A832FU38-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.997 10 160 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2H0V8T8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9927 9 160 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map