F457291

General Info

Members Datasets Scaffolds Average Seq Length
511 237 1022 117

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10186079|Ga0207700_101860791
Length 142
Sequence LRVWARLAIPVVADRIGRSASAKRGVQVTAESIDPTVPPSGTGCAECDEAGGWWFHLRRCALCGHIGCCDTSPSQHASAHAAATGHPLIRSFEPGESWFWSYAEDRMYGSGPDLAPPEHHPVDQPVPGPAGRVPRDWRSHLH

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
49 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
95 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
116 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
217 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
218 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
219 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
220 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
221 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
229 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
230 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.95
Metatranscriptomes 6.85
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 0.98
Rhizosphere 90.02
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10186079 3300025928 Bacteria 1742
2 Ga0070683_100842083 3300005329 Bacteria 879
3 Ga0070660_100090091 3300005339 Bacteria 2417
4 Ga0070691_10606825 3300005341 Bacteria 646
5 Ga0070692_11420029 3300005345 Bacteria 502
6 Ga0070659_100268512 3300005366 Bacteria 1417
7 Ga0070709_10000135 3300005434 Bacteria 49189
8 Ga0070709_10011678 3300005434 Bacteria 4902
9 Ga0070709_10059593 3300005434 Bacteria 2424
10 Ga0070714_100007368 3300005435 Bacteria 8561
11 Ga0070714_100023094 3300005435 Bacteria 5106
12 Ga0070714_100034902 3300005435 Bacteria 4212
13 Ga0070714_100159040 3300005435 Bacteria 2042
14 Ga0070714_100202704 3300005435 Bacteria 1815
15 Ga0070714_100316450 3300005435 Bacteria 1458
16 Ga0070714_101889385 3300005435 Bacteria 583
17 Ga0070713_100002948 3300005436 Bacteria 11159
18 Ga0070713_100101462 3300005436 Bacteria 2493
19 Ga0070713_100117937 3300005436 Bacteria 2323
20 Ga0070713_100122603 3300005436 Bacteria 2282
21 Ga0070713_100271326 3300005436 Bacteria 1554
22 Ga0070713_100714781 3300005436 Bacteria 957
23 Ga0070713_100727412 3300005436 Bacteria 948
24 Ga0070713_101093302 3300005436 Bacteria 770
25 Ga0070713_101463897 3300005436 Bacteria 663
26 Ga0070713_101538352 3300005436 Bacteria 646
27 Ga0070710_10003613 3300005437 Bacteria 7321
28 Ga0070710_10008359 3300005437 Bacteria 5037
29 Ga0070710_10016852 3300005437 Bacteria 3728
30 Ga0070710_10454187 3300005437 Bacteria 869
31 Ga0070711_100003575 3300005439 Bacteria 9065
32 Ga0070711_100013659 3300005439 Bacteria 5102
33 Ga0070711_100030350 3300005439 Bacteria 3577
34 Ga0070711_100073087 3300005439 Bacteria 2421
35 Ga0070708_100025300 3300005445 Bacteria 5073
36 Ga0070708_100029824 3300005445 Bacteria 4708
37 Ga0070708_100139055 3300005445 Bacteria 2251
38 Ga0070708_100491430 3300005445 Bacteria 1158
39 Ga0070708_100664017 3300005445 Bacteria 982
40 Ga0070708_101661776 3300005445 Bacteria 594
41 Ga0070681_10034417 3300005458 Bacteria 5086
42 Ga0070681_10459785 3300005458 Bacteria 1185
43 Ga0070681_11462849 3300005458 Bacteria 607
44 Ga0070706_100002901 3300005467 Bacteria 17066
45 Ga0070706_100004151 3300005467 Bacteria 14089
46 Ga0070706_100005673 3300005467 Bacteria 11872
47 Ga0070706_100036942 3300005467 Bacteria 4512
48 Ga0070706_100042518 3300005467 Bacteria 4199
49 Ga0070706_100059116 3300005467 Bacteria 3538
50 Ga0070706_100339252 3300005467 Bacteria 1401
51 Ga0070706_100411509 3300005467 Bacteria 1259
52 Ga0070707_100000166 3300005468 Bacteria 63590
53 Ga0070707_100000368 3300005468 Bacteria 44585
54 Ga0070707_100008397 3300005468 Bacteria 9589
55 Ga0070707_100012013 3300005468 Bacteria 8082
56 Ga0070707_100016513 3300005468 Bacteria 6927
57 Ga0070707_100101616 3300005468 Bacteria 2786
58 Ga0070707_100333631 3300005468 Bacteria 1473
59 Ga0070698_100000006 3300005471 Bacteria 129236
60 Ga0070698_100004422 3300005471 Bacteria 15442
61 Ga0070698_100004970 3300005471 Bacteria 14569
62 Ga0070698_100009592 3300005471 Bacteria 10361
63 Ga0070698_100015498 3300005471 Bacteria 8051
64 Ga0070698_100024565 3300005471 Bacteria 6286
65 Ga0070698_100062946 3300005471 Bacteria 3742
66 Ga0070698_100344310 3300005471 Bacteria 1422
67 Ga0070698_100355926 3300005471 Bacteria 1396
68 Ga0070698_100473489 3300005471 Bacteria 1189
69 Ga0070699_100042721 3300005518 Bacteria 3923
70 Ga0070699_101045470 3300005518 Bacteria 749
71 Ga0070684_100274894 3300005535 Bacteria 1543
72 Ga0070697_100036703 3300005536 Bacteria 3959
73 Ga0070665_100167926 3300005548 Bacteria 2196
74 Ga0070704_101216087 3300005549 Bacteria 687
75 Ga0068857_100092980 3300005577 Bacteria 2700
76 Ga0068856_100161382 3300005614 Bacteria 2252
77 Ga0068856_100615496 3300005614 Bacteria 1107
78 Ga0068852_100969167 3300005616 Bacteria 869
79 Ga0068861_101604703 3300005719 Bacteria 641
80 Ga0068858_100946984 3300005842 Bacteria 843
81 Ga0070717_10011333 3300006028 Bacteria 6765
82 Ga0070717_10046523 3300006028 Bacteria 3550
83 Ga0070717_10094625 3300006028 Bacteria 2527
84 Ga0070717_10132287 3300006028 Bacteria 2146
85 Ga0070717_10181311 3300006028 Bacteria 1836
86 Ga0070717_10833787 3300006028 Bacteria 839
87 Ga0070717_12069145 3300006028 Bacteria 512
88 Ga0075432_10134258 3300006058 Bacteria 940
89 Ga0070715_10170765 3300006163 Bacteria 1083
90 Ga0070715_11031542 3300006163 Bacteria 514
91 Ga0070716_100000846 3300006173 Bacteria 13188
92 Ga0070716_100252049 3300006173 Bacteria 1203
93 Ga0070716_100446612 3300006173 Bacteria 942
94 Ga0070712_100001434 3300006175 Bacteria 14533
95 Ga0070712_100017678 3300006175 Bacteria 4619
96 Ga0070712_100022533 3300006175 Bacteria 4151
97 Ga0070712_100054127 3300006175 Bacteria 2804
98 Ga0070712_100098379 3300006175 Bacteria 2158
99 Ga0075433_10024155 3300006852 Bacteria 5126
100 Ga0075434_100001250 3300006871 Bacteria 21174
101 Ga0075434_100621149 3300006871 Bacteria 1099
102 Ga0075436_100006875 3300006914 Bacteria 7781
103 Ga0075436_100321019 3300006914 Bacteria 1112
104 Ga0075435_100039040 3300007076 Bacteria 3788
105 Ga0075435_100145770 3300007076 Bacteria 1988
106 Ga0075435_100696224 3300007076 Bacteria 883
107 Ga0105240_11076141 3300009093 Bacteria 857
108 Ga0111539_10159631 3300009094 Bacteria 2637
109 Ga0114129_10058732 3300009147 Bacteria 5380
110 Ga0105237_10786091 3300009545 Bacteria 958
111 Ga0105238_11425030 3300009551 Bacteria 720
112 Ga0154012_139431 3300013059 Bacteria 969
113 Ga0157370_10050112 3300013104 Bacteria 3993
114 Ga0157370_10259160 3300013104 Bacteria 1607
115 Ga0157370_11268517 3300013104 Bacteria 664
116 Ga0157369_10978697 3300013105 Bacteria 866
117 Ga0157369_11315034 3300013105 Bacteria 737
118 Ga0163162_13213678 3300013306 Bacteria 524
119 Ga0197907_10368602 3300020069 Bacteria 3239
120 Ga0206356_10382677 3300020070 Bacteria 959
121 Ga0206356_11093735 3300020070 Bacteria 3503
122 Ga0206356_11381598 3300020070 Bacteria 1400
123 Ga0206349_1695617 3300020075 Bacteria 1199
124 Ga0206349_1859487 3300020075 Bacteria 1436
125 Ga0206355_1362175 3300020076 Bacteria 1304
126 Ga0206351_10289740 3300020077 Bacteria 1052
127 Ga0206351_10470278 3300020077 Bacteria 2151
128 Ga0206352_10150376 3300020078 Bacteria 1098
129 Ga0206352_11202591 3300020078 Bacteria 1153
130 Ga0206350_10470171 3300020080 Bacteria 2256
131 Ga0206350_10837362 3300020080 Bacteria 607
132 Ga0206350_10902187 3300020080 Bacteria 1067
133 Ga0206354_10403311 3300020081 Bacteria 1053
134 Ga0206354_10430084 3300020081 Bacteria 1675
135 Ga0206354_10527040 3300020081 Bacteria 1939
136 Ga0206353_11375874 3300020082 Bacteria 1463
137 Ga0206353_11974104 3300020082 Bacteria 3054
138 Ga0154015_1418534 3300020610 Bacteria 1626
139 Ga0213874_10085815 3300021377 Bacteria 1027
140 Ga0213875_10000197 3300021388 Bacteria 61686
141 Ga0213875_10128916 3300021388 Bacteria 1183
142 Ga0224712_10003212 3300022467 Bacteria 4202
143 Ga0224712_10003482 3300022467 Bacteria 4099
144 Ga0224712_10042394 3300022467 Bacteria 1724
145 Ga0207692_10000294 3300025898 Bacteria 17332
146 Ga0207692_10000342 3300025898 Bacteria 16158
147 Ga0207692_10836524 3300025898 Bacteria 603
148 Ga0207685_10044309 3300025905 Bacteria 1681
149 Ga0207699_10000148 3300025906 Bacteria 45232
150 Ga0207699_10085187 3300025906 Bacteria 1970
151 Ga0207705_10132980 3300025909 Bacteria 1852
152 Ga0207684_10002440 3300025910 Bacteria 18754
153 Ga0207684_10004504 3300025910 Bacteria 13099
154 Ga0207684_10004888 3300025910 Bacteria 12511
155 Ga0207684_10014856 3300025910 Bacteria 6701
156 Ga0207684_10199824 3300025910 Bacteria 1725
157 Ga0207684_10323784 3300025910 Bacteria 1328
158 Ga0207684_11374537 3300025910 Bacteria 579
159 Ga0207707_10559082 3300025912 Bacteria 971
160 Ga0207695_11213304 3300025913 Bacteria 634
161 Ga0207693_10007091 3300025915 Bacteria 9251
162 Ga0207693_10130207 3300025915 Bacteria 1978
163 Ga0207663_10001571 3300025916 Bacteria 10721
164 Ga0207663_10007199 3300025916 Bacteria 5757
165 Ga0207660_10947547 3300025917 Bacteria 702
166 Ga0207657_10057759 3300025919 Bacteria 3343
167 Ga0207652_10084539 3300025921 Bacteria 2780
168 Ga0207646_10000049 3300025922 Bacteria 171680
169 Ga0207646_10000507 3300025922 Bacteria 52135
170 Ga0207646_10020203 3300025922 Bacteria 6174
171 Ga0207646_10062664 3300025922 Bacteria 3320
172 Ga0207646_10974063 3300025922 Bacteria 750
173 Ga0207646_11481342 3300025922 Bacteria 588
174 Ga0207694_10990770 3300025924 Bacteria 711
175 Ga0207700_10000793 3300025928 Bacteria 18260
176 Ga0207700_10012142 3300025928 Bacteria 5539
177 Ga0207700_10013003 3300025928 Bacteria 5395
178 Ga0207700_10056063 3300025928 Bacteria 2965
179 Ga0207700_10120794 3300025928 Bacteria 2124
180 Ga0207700_10142732 3300025928 Bacteria 1970
181 Ga0207700_10247570 3300025928 Bacteria 1521
182 Ga0207700_10284504 3300025928 Bacteria 1423
183 Ga0207700_11566086 3300025928 Bacteria 584
184 Ga0207664_10000246 3300025929 Bacteria 40614
185 Ga0207664_10010413 3300025929 Bacteria 6565
186 Ga0207664_10022938 3300025929 Bacteria 4669
187 Ga0207664_10309596 3300025929 Bacteria 1391
188 Ga0207664_10466617 3300025929 Bacteria 1128
189 Ga0207664_10555416 3300025929 Bacteria 1030
190 Ga0207664_11217668 3300025929 Bacteria 671
191 Ga0207690_10375119 3300025932 Bacteria 1129
192 Ga0207665_10000940 3300025939 Bacteria 19700
193 Ga0207665_10009151 3300025939 Bacteria 6501
194 Ga0207665_10142859 3300025939 Bacteria 1708
195 Ga0207661_10855246 3300025944 Bacteria 837
196 Ga0207702_10593456 3300026078 Bacteria 1086
197 Ga0207674_10069615 3300026116 Bacteria 3539
198 Ga0207675_100472899 3300026118 Bacteria 1245
199 Ga0207675_101400927 3300026118 Bacteria 720
200 Ga0207428_10246503 3300027907 Bacteria 1333
201 Ga0224573_1013307 3300028019 Bacteria 633
202 Ga0268266_10321637 3300028379 Bacteria 1448
203 Ga0307517_10028469 3300028786 Bacteria 6656
204 Ga0307513_10011739 3300031456 Bacteria 10863
205 Ga0307509_10361106 3300031507 Bacteria 1172
206 Ga0307508_10243203 3300031616 Bacteria 1396
207 Ga0307514_10166760 3300031649 Bacteria 1447
208 Ga0307516_10113650 3300031730 Bacteria 2506
209 Ga0307405_10047549 3300031731 Bacteria 2642
210 Ga0307413_10046432 3300031824 Bacteria 2582
211 Ga0307406_10246380 3300031901 Bacteria 1343
212 Ga0307411_11285673 3300032005 Bacteria 666
213 Ga0307415_100294844 3300032126 Bacteria 1340
214 Ga0307507_10001863 3300033179 Bacteria 46053
215 Ga0316214_1000666 3300033545 Bacteria 3629
216 Ga0316216_1008160 3300033548 Bacteria 793
217 Ga0373926_0419104 3300035083 Bacteria 530
218 Ga0373934_0030004 3300035086 Bacteria 2125
219 Ga0373934_0055995 3300035086 Bacteria 1568
220 Ga0373934_0236581 3300035086 Bacteria 754
221 Ga0373923_0002238 3300035111 Bacteria 5888
222 Ga0373923_0075144 3300035111 Bacteria 1457
223 Ga0373923_0132208 3300035111 Bacteria 1122
224 Ga0373923_0351304 3300035111 Bacteria 704
225 Ga0373923_0360597 3300035111 Bacteria 695
226 Ga0373936_0013730 3300035113 Bacteria 3091
227 Ga0373936_0033668 3300035113 Bacteria 2032
228 Ga0373936_0258983 3300035113 Bacteria 778
229 Ga0373936_0502290 3300035113 Bacteria 564
230 Ga0373945_0109101 3300035116 Bacteria 1090
231 Ga0373945_0344870 3300035116 Bacteria 645
232 Ga0373953_0005097 3300035117 Bacteria 4242
233 Ga0373953_0184911 3300035117 Bacteria 899
234 Ga0373954_0005194 3300035118 Bacteria 5625
235 Ga0373954_0043933 3300035118 Bacteria 2084
236 Ga0373956_0238839 3300035119 Bacteria 863
237 Ga0373956_0501019 3300035119 Bacteria 579
238 Ga0373957_0004512 3300035120 Bacteria 4238
239 Ga0373957_0009437 3300035120 Bacteria 3193
240 Ga0373943_0021531 3300035170 Bacteria 2978
241 Ga0373943_0077453 3300035170 Bacteria 1698
242 Ga0373946_0226441 3300035171 Bacteria 904
243 Ga0373946_0306672 3300035171 Bacteria 786
244 Ga0373946_0672366 3300035171 Bacteria 540
245 Ga0373955_0022935 3300035172 Bacteria 3173
246 Ga0373955_0024563 3300035172 Bacteria 3083
247 Ga0373924_0017693 3300035410 Bacteria 2737
248 Ga0373924_0049107 3300035410 Bacteria 1745
249 Ga0373924_0135065 3300035410 Bacteria 1074
250 Ga0373924_0347755 3300035410 Bacteria 661
251 Ga0373931_0016552 3300035691 Bacteria 3632
252 Ga0373935_0018963 3300035692 Bacteria 4193
253 Ga0373935_0119201 3300035692 Bacteria 1761
254 Ga0373935_0272824 3300035692 Bacteria 1189
255 Ga0373927_0432917 3300035695 Bacteria 868
256 Ga0373927_0515079 3300035695 Bacteria 791
257 Ga0373933_0011023 3300035724 Bacteria 4966
258 Ga0373933_0154538 3300035724 Bacteria 1454
259 Ga0373947_0083277 3300035725 Bacteria 1983
260 Ga0373947_0230403 3300035725 Bacteria 1220
261 Ga0373937_0094473 3300036401 Bacteria 2772
262 Ga0373937_0213556 3300036401 Bacteria 1815
263 Ga0310112_060434 3300036458 Bacteria 512
264 Ga0372808_000925 3300036459 Bacteria 2755
265 Ga0372808_006660 3300036459 Bacteria 1563
266 Ga0372808_043742 3300036459 Bacteria 641
267 Ga0373925_0000070 3300037068 Bacteria 107528
268 Ga0373925_0000926 3300037068 Bacteria 26707
269 Ga0373925_0008123 3300037068 Bacteria 7643
270 Ga0373925_0181738 3300037068 Bacteria 1665
271 Ga0373925_1321033 3300037068 Bacteria 591
272 Ga0395905_0118968 3300037471 Bacteria 2483
273 Ga0436364_0073207 3300037853 Unclassified 703
274 Ga0436364_0110263 3300037853 Bacteria 1831
275 Ga0436364_0212006 3300037853 Bacteria 61210
276 Ga0436364_0405396 3300037853 Bacteria 1297
277 Ga0395901_1149273 3300038443 Bacteria 745
278 Ga0436360_1154662 3300039438 Bacteria 613
279 Ga0436361_0678365 3300039447 Bacteria 1929
280 Ga0436363_0017111 3300039450 Bacteria 848
281 Ga0436363_1660122 3300039450 Bacteria 1298
282 Ga0451853_2660232 3300041512 Bacteria 2114
283 Ga0439448_0047659 3300042005 Bacteria 1398
284 Ga0466963_0196544 3300044694 Bacteria 1410
285 Ga0466963_0348716 3300044694 Bacteria 1042
286 Ga0466968_0036100 3300044735 Bacteria 2070
287 Ga0466970_0110209 3300044765 Bacteria 1503
288 Ga0466957_0927595 3300044842 Bacteria 623
289 Ga0466959_0942780 3300045049 Bacteria 575
290 Ga0466967_0042007 3300045976 Bacteria 3948
291 Ga0466967_1001327 3300045976 Bacteria 832
292 Ga0495592_0052814 3300046454 Bacteria 3016
293 Ga0495592_0080101 3300046454 Bacteria 2363
294 Ga0495592_0437101 3300046454 Bacteria 822
295 Ga0495603_0008195 3300046455 Bacteria 6315
296 Ga0495603_0153755 3300046455 Bacteria 1336
297 Ga0495629_0033792 3300046459 Bacteria 3616
298 Ga0495629_0061945 3300046459 Bacteria 2614
299 Ga0495629_0370679 3300046459 Bacteria 975
300 Ga0495641_0004812 3300046461 Bacteria 9388
301 Ga0495641_0008628 3300046461 Bacteria 6174
302 Ga0495641_0574644 3300046461 Bacteria 515
303 Ga0495651_0021268 3300046462 Bacteria 5041
304 Ga0495651_0070859 3300046462 Bacteria 2651
305 Ga0495651_0206714 3300046462 Bacteria 1369
306 Ga0495651_0262917 3300046462 Bacteria 1173
307 Ga0495653_0007019 3300046463 Bacteria 9245
308 Ga0495653_0013877 3300046463 Bacteria 6568
309 Ga0495653_0104514 3300046463 Bacteria 2046
310 Ga0495580_0026103 3300046472 Bacteria 4262
311 Ga0495582_0004205 3300046473 Bacteria 8096
312 Ga0495582_0016856 3300046473 Bacteria 4000
313 Ga0495662_0015480 3300046476 Bacteria 3701
314 Ga0495662_0060404 3300046476 Bacteria 1830
315 Ga0495662_0080545 3300046476 Bacteria 1583
316 Ga0495664_0019647 3300046477 Bacteria 3887
317 Ga0495664_0034652 3300046477 Bacteria 2970
318 Ga0495664_0051464 3300046477 Bacteria 2445
319 Ga0495664_0093100 3300046477 Bacteria 1813
320 Ga0495664_0139899 3300046477 Bacteria 1467
321 Ga0495664_0387817 3300046477 Bacteria 839
322 Ga0495585_0010995 3300046492 Bacteria 5375
323 Ga0495585_0064580 3300046492 Bacteria 2007
324 Ga0495594_0048563 3300046499 Bacteria 2332
325 Ga0495594_0117086 3300046499 Bacteria 1505
326 Ga0495607_0179057 3300046501 Bacteria 1064
327 Ga0495608_0002382 3300046511 Bacteria 13521
328 Ga0495608_0081257 3300046511 Bacteria 2106
329 Ga0495608_0337148 3300046511 Bacteria 929
330 Ga0495608_0359901 3300046511 Bacteria 894
331 Ga0495610_0182109 3300046512 Bacteria 873
332 Ga0495618_0019854 3300046514 Bacteria 4137
333 Ga0495618_0022197 3300046514 Bacteria 3918
334 Ga0495618_0044731 3300046514 Bacteria 2792
335 Ga0495618_0714176 3300046514 Bacteria 588
336 Ga0495620_0271318 3300046515 Bacteria 646
337 Ga0495628_0041668 3300046516 Bacteria 3665
338 Ga0495628_0111056 3300046516 Bacteria 2108
339 Ga0495628_0197992 3300046516 Bacteria 1514
340 Ga0495628_0242981 3300046516 Bacteria 1346
341 Ga0495630_0015392 3300046517 Bacteria 5585
342 Ga0495630_0027100 3300046517 Bacteria 4248
343 Ga0495630_0055007 3300046517 Bacteria 2982
344 Ga0495630_0179601 3300046517 Bacteria 1613
345 Ga0495632_0037705 3300046519 Bacteria 2451
346 Ga0495643_0021908 3300046522 Bacteria 3655
347 Ga0495666_0012221 3300046526 Bacteria 4282
348 Ga0495666_0184893 3300046526 Bacteria 961
349 Ga0495652_0009859 3300046529 Bacteria 8658
350 Ga0495652_0061010 3300046529 Bacteria 3184
351 Ga0495665_0005799 3300046531 Bacteria 6665
352 Ga0495665_0013999 3300046531 Bacteria 4332
353 Ga0495665_0078474 3300046531 Bacteria 1737
354 Ga0495665_0195634 3300046531 Bacteria 1049
355 Ga0495640_0011173 3300046533 Bacteria 6911
356 Ga0495640_0012981 3300046533 Bacteria 6347
357 Ga0495640_0019339 3300046533 Bacteria 5028
358 Ga0495640_0064799 3300046533 Bacteria 2469
359 Ga0495640_0859753 3300046533 Bacteria 538
360 Ga0495586_0010026 3300046535 Bacteria 5047
361 Ga0495586_0081219 3300046535 Bacteria 1781
362 Ga0495586_0084601 3300046535 Bacteria 1746
363 Ga0495586_0132415 3300046535 Bacteria 1396
364 Ga0495587_0015892 3300046536 Bacteria 4688
365 Ga0495587_0027974 3300046536 Bacteria 3432
366 Ga0495587_0182472 3300046536 Bacteria 1189
367 Ga0495645_0001849 3300046543 Bacteria 14367
368 Ga0495645_0032301 3300046543 Bacteria 3817
369 Ga0495645_0088532 3300046543 Bacteria 2214
370 Ga0495645_0117289 3300046543 Bacteria 1878
371 Ga0495645_0531197 3300046543 Bacteria 731
372 Ga0495667_0003861 3300046559 Bacteria 10058
373 Ga0495667_0016239 3300046559 Bacteria 5028
374 Ga0495667_0259385 3300046559 Bacteria 1105
375 Ga0495667_0983181 3300046559 Bacteria 515
376 Ga0495668_0782925 3300046616 Bacteria 528
377 Ga0495634_0007606 3300046642 Bacteria 8117
378 Ga0495634_0009376 3300046642 Bacteria 7221
379 Ga0495634_0061227 3300046642 Bacteria 2502
380 Ga0495634_0244488 3300046642 Bacteria 1099
381 Ga0495611_0152009 3300046648 Bacteria 1081
382 Ga0495635_0012544 3300046663 Bacteria 5937
383 Ga0495635_0028211 3300046663 Bacteria 3901
384 Ga0495635_0108398 3300046663 Bacteria 1897
385 Ga0495635_0866205 3300046663 Bacteria 579
386 Ga0495657_0009082 3300046675 Bacteria 7556
387 Ga0495657_0026685 3300046675 Bacteria 4087
388 Ga0495657_0308502 3300046675 Bacteria 942
389 Ga0495599_0052347 3300046678 Bacteria 2557
390 Ga0495599_0066575 3300046678 Bacteria 2250
391 Ga0495599_0496721 3300046678 Bacteria 718
392 Ga0495623_0054695 3300046679 Bacteria 2517
393 Ga0495623_0179116 3300046679 Bacteria 1233
394 Ga0495623_0355168 3300046679 Bacteria 797
395 Ga0495646_0035113 3300046680 Bacteria 3110
396 Ga0495646_0128508 3300046680 Bacteria 1428
397 Ga0495646_0253229 3300046680 Bacteria 942
398 Ga0495646_0374240 3300046680 Bacteria 743
399 Ga0495658_0003380 3300046683 Bacteria 7907
400 Ga0495658_0016252 3300046683 Bacteria 3831
401 Ga0495613_0005916 3300046689 Bacteria 9154
402 Ga0495613_0028824 3300046689 Bacteria 4129
403 Ga0495613_0039700 3300046689 Bacteria 3489
404 Ga0495613_0061759 3300046689 Bacteria 2743
405 Ga0495613_0112906 3300046689 Bacteria 1956
406 Ga0495624_0007956 3300046690 Bacteria 7433
407 Ga0495624_0026080 3300046690 Bacteria 3832
408 Ga0495670_0022699 3300046691 Bacteria 3099
409 Ga0495589_0320450 3300046794 Bacteria 716
410 Ga0495600_0019308 3300046809 Bacteria 4351
411 Ga0495600_0156613 3300046809 Bacteria 1473
412 Ga0495600_0162452 3300046809 Bacteria 1443
413 Ga0495600_0166960 3300046809 Bacteria 1421
414 Ga0495581_0002299 3300047315 Bacteria 10757
415 Ga0495581_0030571 3300047315 Bacteria 3120
416 Ga0495604_0013279 3300047317 Bacteria 6558
417 Ga0495604_0016282 3300047317 Bacteria 5941
418 Ga0495604_0046753 3300047317 Bacteria 3374
419 Ga0495604_0047631 3300047317 Bacteria 3338
420 Ga0495604_0082023 3300047317 Bacteria 2412
421 Ga0495604_0953771 3300047317 Bacteria 533
422 Ga0495674_0008838 3300047319 Bacteria 9582
423 Ga0495674_0015094 3300047319 Bacteria 7226
424 Ga0495674_0075365 3300047319 Bacteria 2903
425 Ga0495674_0105839 3300047319 Bacteria 2389
426 Ga0495674_0109058 3300047319 Bacteria 2348
427 Ga0495674_0269502 3300047319 Bacteria 1397
428 Ga0495676_0053611 3300047321 Bacteria 3212
429 Ga0495680_0016613 3300047322 Bacteria 6315
430 Ga0495680_0114952 3300047322 Bacteria 1991
431 Ga0495680_0275284 3300047322 Bacteria 1187
432 Ga0495687_077991 3300047443 Bacteria 1306
433 Ga0495687_145726 3300047443 Bacteria 817
434 Ga0495675_0032906 3300047444 Bacteria 3307
435 Ga0495675_0176138 3300047444 Bacteria 1311
436 Ga0495675_0512017 3300047444 Bacteria 688
437 Ga0495685_001880 3300047447 Bacteria 6485
438 Ga0495681_0172051 3300047470 Bacteria 895
439 Ga0495684_0008445 3300047471 Bacteria 7976
440 Ga0495684_0151949 3300047471 Bacteria 1730
441 Ga0495684_0877992 3300047471 Bacteria 579
442 Ga0495593_0001906 3300047673 Bacteria 12433
443 Ga0495593_0006907 3300047673 Bacteria 6647
444 Ga0495593_0083342 3300047673 Bacteria 1652
445 Ga0495602_0101306 3300048088 Bacteria 2362
446 Ga0495602_0226756 3300048088 Bacteria 1406
447 Ga0495614_0014813 3300048089 Bacteria 3408
448 Ga0495614_0339134 3300048089 Bacteria 699
449 Ga0495626_0327406 3300048091 Bacteria 601
450 Ga0496102_0255239 3300048905 Bacteria 1653
451 Ga0496104_0723077 3300048907 Bacteria 903
452 Ga0496109_0448229 3300048912 Bacteria 1219
453 Ga0496112_0059771 3300048915 Bacteria 3756
454 Ga0496115_0007632 3300048918 Bacteria 7971
455 Ga0496117_0270831 3300048920 Bacteria 915
456 Ga0496119_0082210 3300048922 Bacteria 1853
457 Ga0496126_0073655 3300048929 Bacteria 3035
458 Ga0501041_0702796 3300049577 Bacteria 647
459 Ga0501046_0072047 3300049580 Bacteria 2683
460 Ga0501047_0093278 3300049581 Bacteria 2890
461 Ga0501047_0690466 3300049581 Bacteria 838
462 Ga0501047_1168735 3300049581 Bacteria 583
463 Ga0501070_0248795 3300049586 Bacteria 1454
464 Ga0501035_0817556 3300049822 Bacteria 743
465 Ga0501044_0341619 3300049823 Bacteria 1418
466 nmdc:mga05p37_35517_c1 3300050507 Bacteria 6112
467 nmdc:mga0n895_51972_c1 3300050512 Bacteria 4022
468 nmdc:mga0rr50_159154_c1 3300050513 Bacteria 1832
469 nmdc:mga0rr50_332989_c1 3300050513 Bacteria 1275
470 nmdc:mga08x19_127580_c1 3300050514 Bacteria 1709
471 nmdc:mga08x19_34472_c1 3300050514 Bacteria 3200
472 nmdc:mga08x19_551667_c1 3300050514 Bacteria 815
473 nmdc:mga0a205_502242_c1 3300050515 Bacteria 1070
474 Ga0495601_0033164 3300053077 Bacteria 3216
475 Ga0495601_0089517 3300053077 Bacteria 1979
476 Ga0495601_0091257 3300053077 Bacteria 1961
477 Ga0495601_0226124 3300053077 Bacteria 1222
478 Ga0495612_0022897 3300053078 Bacteria 2504
479 Ga0495612_0142112 3300053078 Bacteria 1041
480 Ga0495612_0160668 3300053078 Bacteria 981
481 Ga0495595_0000677 3300053084 Bacteria 13048
482 Ga0495595_0498350 3300053084 Bacteria 621
483 Ga0495619_0008240 3300053085 Bacteria 6595
484 Ga0495619_0085696 3300053085 Bacteria 2128
485 Ga0495619_0195453 3300053085 Bacteria 1400
486 Ga0500578_0183509 3300053086 Bacteria 1288
487 Ga0500643_141324 3300053087 Bacteria 647
488 Ga0500646_0347852 3300053090 Bacteria 540
489 Ga0500641_0283981 3300053096 Bacteria 685
490 Ga0500660_149553 3300053100 Bacteria 909
491 Ga0500553_020786 3300053101 Bacteria 3324
492 Ga0500560_082321 3300053107 Bacteria 1070
493 Ga0500569_003914 3300053109 Bacteria 3088
494 Ga0500580_174569 3300053113 Bacteria 741
495 Ga0500614_020895 3300053123 Bacteria 1515
496 Ga0500652_007078 3300053131 Bacteria 3648
497 Ga0500658_0026916 3300053134 Bacteria 2219
498 Ga0500579_121059 3300053143 Bacteria 1269
499 Ga0500588_0328037 3300053146 Bacteria 581
500 Ga0500600_0005585 3300053149 Bacteria 7430
501 Ga0500616_0020809 3300053153 Bacteria 3683
502 Ga0500633_0012971 3300053160 Bacteria 2320
503 Ga0500587_000425 3300053739 Bacteria 4947
504 Ga0587084_003567 3300059477 Bacteria 1719
505 Ga0587066_013258 3300059490 Bacteria 1245
506 Ga0587085_011501 3300059506 Bacteria 1196
507 Ga0587092_007680 3300059512 Bacteria 1406
508 Ga0587067_003365 3300059640 Bacteria 1993
509 Ga0587069_001772 3300059642 Bacteria 2060
510 Ga0587107_007399 3300059652 Bacteria 1236
511 3006327462 3006321560 Bacteria 8247479
512 Ga0207700_10186079
513 Ga0070683_100842083
514 Ga0070660_100090091
515 Ga0070691_10606825
516 Ga0070692_11420029
517 Ga0070659_100268512
518 Ga0070709_10000135
519 Ga0070709_10011678
520 Ga0070709_10059593
521 Ga0070714_100007368
522 Ga0070714_100023094
523 Ga0070714_100034902
524 Ga0070714_100159040
525 Ga0070714_100202704
526 Ga0070714_100316450
527 Ga0070714_101889385
528 Ga0070713_100002948
529 Ga0070713_100101462
530 Ga0070713_100117937
531 Ga0070713_100122603
532 Ga0070713_100271326
533 Ga0070713_100714781
534 Ga0070713_100727412
535 Ga0070713_101093302
536 Ga0070713_101463897
537 Ga0070713_101538352
538 Ga0070710_10003613
539 Ga0070710_10008359
540 Ga0070710_10016852
541 Ga0070710_10454187
542 Ga0070711_100003575
543 Ga0070711_100013659
544 Ga0070711_100030350
545 Ga0070711_100073087
546 Ga0070708_100025300
547 Ga0070708_100029824
548 Ga0070708_100139055
549 Ga0070708_100491430
550 Ga0070708_100664017
551 Ga0070708_101661776
552 Ga0070681_10034417
553 Ga0070681_10459785
554 Ga0070681_11462849
555 Ga0070706_100002901
556 Ga0070706_100004151
557 Ga0070706_100005673
558 Ga0070706_100036942
559 Ga0070706_100042518
560 Ga0070706_100059116
561 Ga0070706_100339252
562 Ga0070706_100411509
563 Ga0070707_100000166
564 Ga0070707_100000368
565 Ga0070707_100008397
566 Ga0070707_100012013
567 Ga0070707_100016513
568 Ga0070707_100101616
569 Ga0070707_100333631
570 Ga0070698_100000006
571 Ga0070698_100004422
572 Ga0070698_100004970
573 Ga0070698_100009592
574 Ga0070698_100015498
575 Ga0070698_100024565
576 Ga0070698_100062946
577 Ga0070698_100344310
578 Ga0070698_100355926
579 Ga0070698_100473489
580 Ga0070699_100042721
581 Ga0070699_101045470
582 Ga0070684_100274894
583 Ga0070697_100036703
584 Ga0070665_100167926
585 Ga0070704_101216087
586 Ga0068857_100092980
587 Ga0068856_100161382
588 Ga0068856_100615496
589 Ga0068852_100969167
590 Ga0068861_101604703
591 Ga0068858_100946984
592 Ga0070717_10011333
593 Ga0070717_10046523
594 Ga0070717_10094625
595 Ga0070717_10132287
596 Ga0070717_10181311
597 Ga0070717_10833787
598 Ga0070717_12069145
599 Ga0075432_10134258
600 Ga0070715_10170765
601 Ga0070715_11031542
602 Ga0070716_100000846
603 Ga0070716_100252049
604 Ga0070716_100446612
605 Ga0070712_100001434
606 Ga0070712_100017678
607 Ga0070712_100022533
608 Ga0070712_100054127
609 Ga0070712_100098379
610 Ga0075433_10024155
611 Ga0075434_100001250
612 Ga0075434_100621149
613 Ga0075436_100006875
614 Ga0075436_100321019
615 Ga0075435_100039040
616 Ga0075435_100145770
617 Ga0075435_100696224
618 Ga0105240_11076141
619 Ga0111539_10159631
620 Ga0114129_10058732
621 Ga0105237_10786091
622 Ga0105238_11425030
623 Ga0154012_139431
624 Ga0157370_10050112
625 Ga0157370_10259160
626 Ga0157370_11268517
627 Ga0157369_10978697
628 Ga0157369_11315034
629 Ga0163162_13213678
630 Ga0197907_10368602
631 Ga0206356_10382677
632 Ga0206356_11093735
633 Ga0206356_11381598
634 Ga0206349_1695617
635 Ga0206349_1859487
636 Ga0206355_1362175
637 Ga0206351_10289740
638 Ga0206351_10470278
639 Ga0206352_10150376
640 Ga0206352_11202591
641 Ga0206350_10470171
642 Ga0206350_10837362
643 Ga0206350_10902187
644 Ga0206354_10403311
645 Ga0206354_10430084
646 Ga0206354_10527040
647 Ga0206353_11375874
648 Ga0206353_11974104
649 Ga0154015_1418534
650 Ga0213874_10085815
651 Ga0213875_10000197
652 Ga0213875_10128916
653 Ga0224712_10003212
654 Ga0224712_10003482
655 Ga0224712_10042394
656 Ga0207692_10000294
657 Ga0207692_10000342
658 Ga0207692_10836524
659 Ga0207685_10044309
660 Ga0207699_10000148
661 Ga0207699_10085187
662 Ga0207705_10132980
663 Ga0207684_10002440
664 Ga0207684_10004504
665 Ga0207684_10004888
666 Ga0207684_10014856
667 Ga0207684_10199824
668 Ga0207684_10323784
669 Ga0207684_11374537
670 Ga0207707_10559082
671 Ga0207695_11213304
672 Ga0207693_10007091
673 Ga0207693_10130207
674 Ga0207663_10001571
675 Ga0207663_10007199
676 Ga0207660_10947547
677 Ga0207657_10057759
678 Ga0207652_10084539
679 Ga0207646_10000049
680 Ga0207646_10000507
681 Ga0207646_10020203
682 Ga0207646_10062664
683 Ga0207646_10974063
684 Ga0207646_11481342
685 Ga0207694_10990770
686 Ga0207700_10000793
687 Ga0207700_10012142
688 Ga0207700_10013003
689 Ga0207700_10056063
690 Ga0207700_10120794
691 Ga0207700_10142732
692 Ga0207700_10247570
693 Ga0207700_10284504
694 Ga0207700_11566086
695 Ga0207664_10000246
696 Ga0207664_10010413
697 Ga0207664_10022938
698 Ga0207664_10309596
699 Ga0207664_10466617
700 Ga0207664_10555416
701 Ga0207664_11217668
702 Ga0207690_10375119
703 Ga0207665_10000940
704 Ga0207665_10009151
705 Ga0207665_10142859
706 Ga0207661_10855246
707 Ga0207702_10593456
708 Ga0207674_10069615
709 Ga0207675_100472899
710 Ga0207675_101400927
711 Ga0207428_10246503
712 Ga0224573_1013307
713 Ga0268266_10321637
714 Ga0307517_10028469
715 Ga0307513_10011739
716 Ga0307509_10361106
717 Ga0307508_10243203
718 Ga0307514_10166760
719 Ga0307516_10113650
720 Ga0307405_10047549
721 Ga0307413_10046432
722 Ga0307406_10246380
723 Ga0307411_11285673
724 Ga0307415_100294844
725 Ga0307507_10001863
726 Ga0316214_1000666
727 Ga0316216_1008160
728 Ga0373926_0419104
729 Ga0373934_0030004
730 Ga0373934_0055995
731 Ga0373934_0236581
732 Ga0373923_0002238
733 Ga0373923_0075144
734 Ga0373923_0132208
735 Ga0373923_0351304
736 Ga0373923_0360597
737 Ga0373936_0013730
738 Ga0373936_0033668
739 Ga0373936_0258983
740 Ga0373936_0502290
741 Ga0373945_0109101
742 Ga0373945_0344870
743 Ga0373953_0005097
744 Ga0373953_0184911
745 Ga0373954_0005194
746 Ga0373954_0043933
747 Ga0373956_0238839
748 Ga0373956_0501019
749 Ga0373957_0004512
750 Ga0373957_0009437
751 Ga0373943_0021531
752 Ga0373943_0077453
753 Ga0373946_0226441
754 Ga0373946_0306672
755 Ga0373946_0672366
756 Ga0373955_0022935
757 Ga0373955_0024563
758 Ga0373924_0017693
759 Ga0373924_0049107
760 Ga0373924_0135065
761 Ga0373924_0347755
762 Ga0373931_0016552
763 Ga0373935_0018963
764 Ga0373935_0119201
765 Ga0373935_0272824
766 Ga0373927_0432917
767 Ga0373927_0515079
768 Ga0373933_0011023
769 Ga0373933_0154538
770 Ga0373947_0083277
771 Ga0373947_0230403
772 Ga0373937_0094473
773 Ga0373937_0213556
774 Ga0310112_060434
775 Ga0372808_000925
776 Ga0372808_006660
777 Ga0372808_043742
778 Ga0373925_0000070
779 Ga0373925_0000926
780 Ga0373925_0008123
781 Ga0373925_0181738
782 Ga0373925_1321033
783 Ga0395905_0118968
784 Ga0436364_0073207
785 Ga0436364_0110263
786 Ga0436364_0212006
787 Ga0436364_0405396
788 Ga0395901_1149273
789 Ga0436360_1154662
790 Ga0436361_0678365
791 Ga0436363_0017111
792 Ga0436363_1660122
793 Ga0451853_2660232
794 Ga0439448_0047659
795 Ga0466963_0196544
796 Ga0466963_0348716
797 Ga0466968_0036100
798 Ga0466970_0110209
799 Ga0466957_0927595
800 Ga0466959_0942780
801 Ga0466967_0042007
802 Ga0466967_1001327
803 Ga0495592_0052814
804 Ga0495592_0080101
805 Ga0495592_0437101
806 Ga0495603_0008195
807 Ga0495603_0153755
808 Ga0495629_0033792
809 Ga0495629_0061945
810 Ga0495629_0370679
811 Ga0495641_0004812
812 Ga0495641_0008628
813 Ga0495641_0574644
814 Ga0495651_0021268
815 Ga0495651_0070859
816 Ga0495651_0206714
817 Ga0495651_0262917
818 Ga0495653_0007019
819 Ga0495653_0013877
820 Ga0495653_0104514
821 Ga0495580_0026103
822 Ga0495582_0004205
823 Ga0495582_0016856
824 Ga0495662_0015480
825 Ga0495662_0060404
826 Ga0495662_0080545
827 Ga0495664_0019647
828 Ga0495664_0034652
829 Ga0495664_0051464
830 Ga0495664_0093100
831 Ga0495664_0139899
832 Ga0495664_0387817
833 Ga0495585_0010995
834 Ga0495585_0064580
835 Ga0495594_0048563
836 Ga0495594_0117086
837 Ga0495607_0179057
838 Ga0495608_0002382
839 Ga0495608_0081257
840 Ga0495608_0337148
841 Ga0495608_0359901
842 Ga0495610_0182109
843 Ga0495618_0019854
844 Ga0495618_0022197
845 Ga0495618_0044731
846 Ga0495618_0714176
847 Ga0495620_0271318
848 Ga0495628_0041668
849 Ga0495628_0111056
850 Ga0495628_0197992
851 Ga0495628_0242981
852 Ga0495630_0015392
853 Ga0495630_0027100
854 Ga0495630_0055007
855 Ga0495630_0179601
856 Ga0495632_0037705
857 Ga0495643_0021908
858 Ga0495666_0012221
859 Ga0495666_0184893
860 Ga0495652_0009859
861 Ga0495652_0061010
862 Ga0495665_0005799
863 Ga0495665_0013999
864 Ga0495665_0078474
865 Ga0495665_0195634
866 Ga0495640_0011173
867 Ga0495640_0012981
868 Ga0495640_0019339
869 Ga0495640_0064799
870 Ga0495640_0859753
871 Ga0495586_0010026
872 Ga0495586_0081219
873 Ga0495586_0084601
874 Ga0495586_0132415
875 Ga0495587_0015892
876 Ga0495587_0027974
877 Ga0495587_0182472
878 Ga0495645_0001849
879 Ga0495645_0032301
880 Ga0495645_0088532
881 Ga0495645_0117289
882 Ga0495645_0531197
883 Ga0495667_0003861
884 Ga0495667_0016239
885 Ga0495667_0259385
886 Ga0495667_0983181
887 Ga0495668_0782925
888 Ga0495634_0007606
889 Ga0495634_0009376
890 Ga0495634_0061227
891 Ga0495634_0244488
892 Ga0495611_0152009
893 Ga0495635_0012544
894 Ga0495635_0028211
895 Ga0495635_0108398
896 Ga0495635_0866205
897 Ga0495657_0009082
898 Ga0495657_0026685
899 Ga0495657_0308502
900 Ga0495599_0052347
901 Ga0495599_0066575
902 Ga0495599_0496721
903 Ga0495623_0054695
904 Ga0495623_0179116
905 Ga0495623_0355168
906 Ga0495646_0035113
907 Ga0495646_0128508
908 Ga0495646_0253229
909 Ga0495646_0374240
910 Ga0495658_0003380
911 Ga0495658_0016252
912 Ga0495613_0005916
913 Ga0495613_0028824
914 Ga0495613_0039700
915 Ga0495613_0061759
916 Ga0495613_0112906
917 Ga0495624_0007956
918 Ga0495624_0026080
919 Ga0495670_0022699
920 Ga0495589_0320450
921 Ga0495600_0019308
922 Ga0495600_0156613
923 Ga0495600_0162452
924 Ga0495600_0166960
925 Ga0495581_0002299
926 Ga0495581_0030571
927 Ga0495604_0013279
928 Ga0495604_0016282
929 Ga0495604_0046753
930 Ga0495604_0047631
931 Ga0495604_0082023
932 Ga0495604_0953771
933 Ga0495674_0008838
934 Ga0495674_0015094
935 Ga0495674_0075365
936 Ga0495674_0105839
937 Ga0495674_0109058
938 Ga0495674_0269502
939 Ga0495676_0053611
940 Ga0495680_0016613
941 Ga0495680_0114952
942 Ga0495680_0275284
943 Ga0495687_077991
944 Ga0495687_145726
945 Ga0495675_0032906
946 Ga0495675_0176138
947 Ga0495675_0512017
948 Ga0495685_001880
949 Ga0495681_0172051
950 Ga0495684_0008445
951 Ga0495684_0151949
952 Ga0495684_0877992
953 Ga0495593_0001906
954 Ga0495593_0006907
955 Ga0495593_0083342
956 Ga0495602_0101306
957 Ga0495602_0226756
958 Ga0495614_0014813
959 Ga0495614_0339134
960 Ga0495626_0327406
961 Ga0496102_0255239
962 Ga0496104_0723077
963 Ga0496109_0448229
964 Ga0496112_0059771
965 Ga0496115_0007632
966 Ga0496117_0270831
967 Ga0496119_0082210
968 Ga0496126_0073655
969 Ga0501041_0702796
970 Ga0501046_0072047
971 Ga0501047_0093278
972 Ga0501047_0690466
973 Ga0501047_1168735
974 Ga0501070_0248795
975 Ga0501035_0817556
976 Ga0501044_0341619
977 nmdc:mga05p37_35517_c1
978 nmdc:mga0n895_51972_c1
979 nmdc:mga0rr50_159154_c1
980 nmdc:mga0rr50_332989_c1
981 nmdc:mga08x19_127580_c1
982 nmdc:mga08x19_34472_c1
983 nmdc:mga08x19_551667_c1
984 nmdc:mga0a205_502242_c1
985 Ga0495601_0033164
986 Ga0495601_0089517
987 Ga0495601_0091257
988 Ga0495601_0226124
989 Ga0495612_0022897
990 Ga0495612_0142112
991 Ga0495612_0160668
992 Ga0495595_0000677
993 Ga0495595_0498350
994 Ga0495619_0008240
995 Ga0495619_0085696
996 Ga0495619_0195453
997 Ga0500578_0183509
998 Ga0500643_141324
999 Ga0500646_0347852
1000 Ga0500641_0283981
1001 Ga0500660_149553
1002 Ga0500553_020786
1003 Ga0500560_082321
1004 Ga0500569_003914
1005 Ga0500580_174569
1006 Ga0500614_020895
1007 Ga0500652_007078
1008 Ga0500658_0026916
1009 Ga0500579_121059
1010 Ga0500588_0328037
1011 Ga0500600_0005585
1012 Ga0500616_0020809
1013 Ga0500633_0012971
1014 Ga0500587_000425
1015 Ga0587084_003567
1016 Ga0587066_013258
1017 Ga0587085_011501
1018 Ga0587092_007680
1019 Ga0587067_003365
1020 Ga0587069_001772
1021 Ga0587107_007399
1022 3006327462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

44

111

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.9059 30 83
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7962 1 92
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.765 1 82
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.7554 1 82
2ysc-assembly1.cif.gz_A solution structure of the ww domain from the human amyloid beta a4 precursor protein-binding family b member 3, apbb3 0.7533 62 89
ID Description Score Start End Superfamily
af_Q54QE6_6_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8856 17 83 3.30.40.10
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8662 17 86 3.30.40.10
af_Q11119_140_246_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8612 30 83 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8545 18 82 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8528 1 86 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A1F8QE91-F1-model_v4 UBP-type domain-containing protein 0.9808 11 84 GO:0008270
AF-A0A536YFN5-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9784 13 84 GO:0008270
AF-A0A7W1GCI9-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9774 14 82 GO:0008270
AF-A0A356HIJ5-F1-model_v4 deleted 0.9731 7 66
AF-A0A535ISM2-F1-model_v4 UBP-type zinc finger domain-containing protein 0.973 29 85 GO:0008270

Map