F457289

General Info

Members Datasets Scaffolds Average Seq Length
511 346 1022 156

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10001185|Ga0207663_1000118512
Length 181
Sequence MIRHVGPGSAAQHFALRSIRGTNTEHAMDALPIANAEITRFFRDWLETFAGFVREVDYASARPLFHPDVLAFGTHNDVIPGLDQWVATQWDNVWPKTTDFRFVLEQTQVLASLDGRMAVVISPWTSTGYHADGQPFPRPGRATMVFSRNGDGDGWLCTHSHMSLNRGVPQASHADRPVKAR

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
275 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
276 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
277 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
285 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
288 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
289 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
292 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
295 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
299 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
300 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
301 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
302 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
303 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
304 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
305 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
306 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
307 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
308 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
309 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
310 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
311 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
312 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
313 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
314 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
315 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
316 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
317 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
318 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
319 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
320 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
321 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
322 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
323 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
324 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
325 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
326 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
327 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
328 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
329 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
330 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
331 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
332 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
333 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
334 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
335 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
336 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
337 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
338 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
339 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
340 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
341 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
342 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
343 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
344 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
345 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
346 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 0
Isolates 9.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.24
Nodule 9.39
Rhizoplane 7.05
Rhizosphere 58.71
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10001185 3300025916 Bacteria 12028
2 rootL2_10227347 3300003322 Bacteria 1497
3 JGI25160J50197_1009302 3300003354 Bacteria 3660
4 Ga0065165_1001022 3300005262 Bacteria 33988
5 Ga0065165_1026342 3300005262 Bacteria 1914
6 Ga0065712_10219305 3300005290 Bacteria 1046
7 Ga0065712_10476323 3300005290 Bacteria 666
8 Ga0065715_10018193 3300005293 Bacteria 2711
9 Ga0065715_10093714 3300005293 Bacteria 4589
10 Ga0070690_100876809 3300005330 Bacteria 701
11 Ga0070670_100105616 3300005331 Bacteria 2426
12 Ga0070670_100685551 3300005331 Bacteria 921
13 Ga0070677_10009895 3300005333 Bacteria 3247
14 Ga0068869_100415618 3300005334 Bacteria 1109
15 Ga0068869_100695581 3300005334 Bacteria 866
16 Ga0068869_100890914 3300005334 Bacteria 770
17 Ga0070666_10290816 3300005335 Bacteria 1162
18 Ga0070680_100517676 3300005336 Bacteria 1021
19 Ga0068868_101324316 3300005338 Bacteria 670
20 Ga0068868_102293668 3300005338 Bacteria 515
21 Ga0070689_100690347 3300005340 Bacteria 891
22 Ga0070689_100907821 3300005340 Bacteria 780
23 Ga0070689_101151241 3300005340 Bacteria 695
24 Ga0070668_100271729 3300005347 Bacteria 1413
25 Ga0070669_100351479 3300005353 Bacteria 1197
26 Ga0070675_100777615 3300005354 Bacteria 874
27 Ga0070671_100147606 3300005355 Bacteria 1985
28 Ga0070671_100455711 3300005355 Bacteria 1097
29 Ga0070671_100818117 3300005355 Bacteria 812
30 Ga0070674_100029043 3300005356 Bacteria 3637
31 Ga0070674_100566843 3300005356 Bacteria 955
32 Ga0070674_101126908 3300005356 Bacteria 694
33 Ga0070674_101499601 3300005356 Bacteria 606
34 Ga0070673_100058429 3300005364 Bacteria 3049
35 Ga0070688_100114426 3300005365 Bacteria 1799
36 Ga0070688_100733842 3300005365 Bacteria 768
37 Ga0070667_100221203 3300005367 Bacteria 1685
38 Ga0070667_100425706 3300005367 Bacteria 1211
39 Ga0070667_100824695 3300005367 Bacteria 862
40 Ga0070714_100143682 3300005435 Bacteria 2144
41 Ga0070713_100015210 3300005436 Bacteria 5739
42 Ga0070710_10007908 3300005437 Bacteria 5166
43 Ga0070711_100280538 3300005439 Bacteria 1318
44 Ga0070678_101505229 3300005456 Bacteria 630
45 Ga0070681_10051888 3300005458 Bacteria 4091
46 Ga0068867_100159988 3300005459 Bacteria 1775
47 Ga0070706_100205050 3300005467 Bacteria 1842
48 Ga0070707_101099891 3300005468 Bacteria 761
49 Ga0070699_100868911 3300005518 Bacteria 826
50 Ga0070679_100376111 3300005530 Bacteria 1367
51 Ga0070684_101090925 3300005535 Bacteria 750
52 Ga0068853_100110205 3300005539 Bacteria 2445
53 Ga0068853_100534144 3300005539 Bacteria 1110
54 Ga0068853_100632057 3300005539 Bacteria 1018
55 Ga0068853_100837935 3300005539 Bacteria 882
56 Ga0068853_101705398 3300005539 Bacteria 611
57 Ga0070672_100491627 3300005543 Bacteria 1060
58 Ga0070686_100174999 3300005544 Bacteria 1521
59 Ga0070686_100692493 3300005544 Bacteria 812
60 Ga0070686_100766348 3300005544 Bacteria 775
61 Ga0070665_100942845 3300005548 Bacteria 876
62 Ga0070665_102160251 3300005548 Bacteria 561
63 Ga0068857_100015806 3300005577 Bacteria 6605
64 Ga0068857_100332418 3300005577 Bacteria 1405
65 Ga0068857_101168088 3300005577 Bacteria 745
66 Ga0068854_100815554 3300005578 Bacteria 814
67 Ga0068856_100932510 3300005614 Bacteria 887
68 Ga0068856_100942301 3300005614 Bacteria 882
69 Ga0068859_100137217 3300005617 Bacteria 2519
70 Ga0068864_100116868 3300005618 Bacteria 2380
71 Ga0068870_10414716 3300005840 Bacteria 880
72 Ga0068858_100448801 3300005842 Bacteria 1243
73 Ga0068858_100750228 3300005842 Bacteria 951
74 Ga0068860_100000548 3300005843 Bacteria 45747
75 Ga0068862_100390970 3300005844 Bacteria 1299
76 Ga0070717_10843480 3300006028 Bacteria 834
77 Ga0075365_10722775 3300006038 Bacteria 703
78 Ga0075368_10028564 3300006042 Bacteria 2155
79 Ga0075368_10077777 3300006042 Bacteria 1347
80 Ga0075364_10010663 3300006051 Bacteria 5557
81 Ga0075364_10230285 3300006051 Bacteria 1258
82 Ga0070715_10044369 3300006163 Bacteria 1879
83 Ga0070712_100102528 3300006175 Bacteria 2119
84 Ga0070712_100728215 3300006175 Bacteria 847
85 Ga0075362_10016632 3300006177 Bacteria 3015
86 Ga0075369_10023328 3300006186 Bacteria 2557
87 Ga0075369_10081226 3300006186 Bacteria 1438
88 Ga0075366_10018298 3300006195 Bacteria 4043
89 Ga0075366_10039281 3300006195 Bacteria 2798
90 Ga0075366_10365000 3300006195 Bacteria 887
91 Ga0075366_10570286 3300006195 Bacteria 701
92 Ga0075370_10350691 3300006353 Bacteria 882
93 Ga0068871_100348135 3300006358 Bacteria 1310
94 Ga0068865_100228275 3300006881 Bacteria 1459
95 Ga0068865_100479461 3300006881 Bacteria 1034
96 Ga0068865_102056930 3300006881 Bacteria 519
97 Ga0097620_100137229 3300006931 Bacteria 2519
98 Ga0105250_10125538 3300009092 Bacteria 1057
99 Ga0105240_10744045 3300009093 Bacteria 1066
100 Ga0105240_11184493 3300009093 Bacteria 810
101 Ga0111539_12052244 3300009094 Bacteria 663
102 Ga0105245_10199054 3300009098 Bacteria 1923
103 Ga0105245_10286761 3300009098 Bacteria 1611
104 Ga0105245_11208510 3300009098 Bacteria 804
105 Ga0105245_11373646 3300009098 Bacteria 756
106 Ga0105247_10021465 3300009101 Bacteria 3885
107 Ga0105247_10175153 3300009101 Bacteria 1428
108 Ga0105247_10186451 3300009101 Bacteria 1387
109 Ga0105247_10268470 3300009101 Bacteria 1173
110 Ga0105247_10336704 3300009101 Bacteria 1057
111 Ga0105247_10899751 3300009101 Bacteria 683
112 Ga0105243_10130378 3300009148 Bacteria 2132
113 Ga0105241_10077921 3300009174 Bacteria 2589
114 Ga0105241_10345168 3300009174 Bacteria 1291
115 Ga0105242_10026396 3300009176 Bacteria 4604
116 Ga0105248_10199949 3300009177 Bacteria 2252
117 Ga0105248_12194910 3300009177 Bacteria 628
118 Ga0105237_10108758 3300009545 Bacteria 2763
119 Ga0105237_10747335 3300009545 Bacteria 985
120 Ga0105237_11005436 3300009545 Bacteria 841
121 Ga0105238_10214753 3300009551 Bacteria 1900
122 Ga0105238_10345737 3300009551 Bacteria 1476
123 Ga0105249_10494984 3300009553 Bacteria 1267
124 Ga0105239_10017591 3300010375 Bacteria 7906
125 Ga0105239_11543075 3300010375 Bacteria 768
126 Ga0105239_12328277 3300010375 Bacteria 623
127 Ga0105239_12882644 3300010375 Bacteria 561
128 Ga0105246_10369104 3300011119 Bacteria 1182
129 Ga0105246_10387515 3300011119 Bacteria 1157
130 Ga0105246_10429139 3300011119 Bacteria 1105
131 Ga0105246_10632387 3300011119 Bacteria 929
132 Ga0157374_10026942 3300013296 Bacteria 5177
133 Ga0157374_10450724 3300013296 Bacteria 1288
134 Ga0157374_10703327 3300013296 Bacteria 1024
135 Ga0157374_11181249 3300013296 Bacteria 786
136 Ga0157378_10254814 3300013297 Bacteria 1681
137 Ga0157378_10593264 3300013297 Bacteria 1118
138 Ga0157378_10894881 3300013297 Bacteria 918
139 Ga0157378_11105522 3300013297 Bacteria 830
140 Ga0163162_10156622 3300013306 Bacteria 2398
141 Ga0163162_10474989 3300013306 Bacteria 1382
142 Ga0163162_10766660 3300013306 Bacteria 1083
143 Ga0163162_10814403 3300013306 Bacteria 1051
144 Ga0157372_11510336 3300013307 Bacteria 774
145 Ga0157375_10098968 3300013308 Bacteria 2994
146 Ga0157375_12313376 3300013308 Bacteria 641
147 Ga0163163_10213423 3300014325 Bacteria 1979
148 Ga0163163_10512784 3300014325 Bacteria 1261
149 Ga0163163_10737090 3300014325 Bacteria 1049
150 Ga0157380_10104179 3300014326 Bacteria 2369
151 Ga0157377_10357355 3300014745 Bacteria 982
152 Ga0157379_10346823 3300014968 Bacteria 1359
153 Ga0157376_10059212 3300014969 Bacteria 3211
154 Ga0163161_11068520 3300017792 Bacteria 692
155 Ga0214544_1005918 3300021320 Bacteria 23137
156 Ga0214542_1000185 3300021321 Bacteria 96676
157 Ga0214545_1000102 3300021324 Bacteria 96676
158 Ga0214543_1022238 3300021327 Bacteria 4559
159 Ga0209455_1001783 3300025272 Bacteria 9089
160 Ga0209564_1004297 3300025295 Bacteria 8822
161 Ga0209758_1001698 3300025297 Bacteria 24781
162 Ga0209758_1015291 3300025297 Bacteria 3989
163 Ga0209256_1031299 3300025299 Bacteria 1456
164 Ga0207426_1075759 3300025302 Bacteria 925
165 Ga0207682_10000252 3300025893 Bacteria 24133
166 Ga0207642_10050614 3300025899 Bacteria 1875
167 Ga0207688_10025858 3300025901 Bacteria 3226
168 Ga0207688_10121003 3300025901 Bacteria 1527
169 Ga0207647_10043017 3300025904 Bacteria 2829
170 Ga0207685_10008965 3300025905 Bacteria 2883
171 Ga0207699_10057215 3300025906 Bacteria 2327
172 Ga0207645_10034528 3300025907 Bacteria 3250
173 Ga0207643_10366254 3300025908 Bacteria 907
174 Ga0207684_10089940 3300025910 Bacteria 2616
175 Ga0207654_10125115 3300025911 Bacteria 1620
176 Ga0207707_10386043 3300025912 Bacteria 1203
177 Ga0207671_10078782 3300025914 Bacteria 2468
178 Ga0207663_10507113 3300025916 Bacteria 938
179 Ga0207660_10737480 3300025917 Bacteria 804
180 Ga0207662_10045514 3300025918 Bacteria 2594
181 Ga0207662_10387162 3300025918 Bacteria 945
182 Ga0207652_11397958 3300025921 Bacteria 603
183 Ga0207646_10274216 3300025922 Bacteria 1525
184 Ga0207694_10081722 3300025924 Bacteria 2539
185 Ga0207694_10309061 3300025924 Bacteria 1303
186 Ga0207650_10330228 3300025925 Bacteria 1251
187 Ga0207650_10368374 3300025925 Bacteria 1185
188 Ga0207650_10473623 3300025925 Bacteria 1044
189 Ga0207687_10186243 3300025927 Bacteria 1612
190 Ga0207687_10687750 3300025927 Bacteria 867
191 Ga0207664_10025147 3300025929 Bacteria 4481
192 Ga0207664_10510732 3300025929 Bacteria 1076
193 Ga0207644_10353811 3300025931 Bacteria 1193
194 Ga0207644_10803597 3300025931 Bacteria 787
195 Ga0207706_10389877 3300025933 Bacteria 1208
196 Ga0207706_10408780 3300025933 Bacteria 1176
197 Ga0207709_11244542 3300025935 Bacteria 614
198 Ga0207670_10613758 3300025936 Bacteria 894
199 Ga0207669_10025229 3300025937 Bacteria 3208
200 Ga0207669_10522436 3300025937 Bacteria 953
201 Ga0207669_11049678 3300025937 Bacteria 686
202 Ga0207691_10017733 3300025940 Bacteria 6749
203 Ga0207691_10781692 3300025940 Bacteria 803
204 Ga0207711_10086437 3300025941 Bacteria 2749
205 Ga0207651_10338870 3300025960 Bacteria 1263
206 Ga0207640_10536731 3300025981 Bacteria 980
207 Ga0207658_11248684 3300025986 Bacteria 679
208 Ga0207677_10287883 3300026023 Bacteria 1352
209 Ga0207677_10721598 3300026023 Bacteria 886
210 Ga0207677_11301810 3300026023 Bacteria 667
211 Ga0207703_10163824 3300026035 Bacteria 1949
212 Ga0207703_11970011 3300026035 Bacteria 560
213 Ga0207639_10070080 3300026041 Bacteria 2738
214 Ga0207639_10372701 3300026041 Bacteria 1280
215 Ga0207639_10412414 3300026041 Bacteria 1219
216 Ga0207639_10689125 3300026041 Bacteria 947
217 Ga0207678_10219135 3300026067 Bacteria 1629
218 Ga0207702_10294459 3300026078 Bacteria 1538
219 Ga0207702_10711908 3300026078 Bacteria 990
220 Ga0207702_10872317 3300026078 Bacteria 891
221 Ga0207641_10048738 3300026088 Bacteria 3577
222 Ga0207648_10105372 3300026089 Bacteria 2473
223 Ga0207648_10244490 3300026089 Bacteria 1599
224 Ga0207676_10121794 3300026095 Bacteria 2201
225 Ga0207674_10046802 3300026116 Bacteria 4439
226 Ga0207674_10194413 3300026116 Bacteria 1978
227 Ga0207683_10073851 3300026121 Bacteria 3017
228 Ga0265318_10019387 3300028577 Bacteria 2759
229 Ga0265338_10007347 3300028800 Bacteria 13725
230 Ga0265332_10009459 3300031238 Bacteria 4352
231 Ga0265328_10067328 3300031239 Bacteria 1316
232 Ga0265320_10100604 3300031240 Bacteria 1331
233 Ga0265325_10120490 3300031241 Bacteria 1265
234 Ga0265340_10011287 3300031247 Bacteria 4754
235 Ga0265339_10042173 3300031249 Bacteria 2527
236 Ga0265339_10049240 3300031249 Bacteria 2308
237 Ga0265331_10051817 3300031250 Bacteria 1963
238 Ga0265316_10102942 3300031344 Bacteria 2168
239 Ga0307513_10068555 3300031456 Bacteria 3715
240 Ga0307513_10303142 3300031456 Bacteria 1363
241 Ga0265313_10054856 3300031595 Bacteria 1890
242 Ga0307508_10078440 3300031616 Bacteria 2883
243 Ga0307508_10083279 3300031616 Bacteria 2781
244 Ga0307508_10173128 3300031616 Bacteria 1762
245 Ga0265314_10039745 3300031711 Bacteria 3384
246 Ga0265342_10026342 3300031712 Bacteria 3644
247 Ga0265342_10043748 3300031712 Bacteria 2701
248 Ga0307516_10014947 3300031730 Bacteria 8186
249 Ga0307516_10035237 3300031730 Bacteria 5023
250 Ga0307507_10453351 3300033179 Bacteria 707
251 Ga0307510_10157513 3300033180 Bacteria 1875
252 Ga0373948_0082572 3300034817 Bacteria 735
253 Ga0373958_0096534 3300034819 Bacteria 688
254 Ga0373938_0052899 3300034957 Bacteria 932
255 Ga0373928_0108359 3300035084 Bacteria 732
256 Ga0373928_0265825 3300035084 Bacteria 515
257 Ga0373929_0096036 3300035085 Bacteria 742
258 Ga0373939_0100947 3300035114 Bacteria 990
259 Ga0373941_0045142 3300035115 Bacteria 1378
260 Ga0373943_0442026 3300035170 Bacteria 755
261 Ga0373942_0138006 3300035207 Bacteria 774
262 Ga0373931_0033068 3300035691 Bacteria 2678
263 Ga0373931_0342762 3300035691 Bacteria 934
264 Ga0373935_0124628 3300035692 Bacteria 1725
265 Ga0373927_0183360 3300035695 Bacteria 1373
266 Ga0373927_0960721 3300035695 Bacteria 564
267 Ga0395900_0966924 3300037418 Bacteria 772
268 Ga0395905_0142011 3300037471 Bacteria 2259
269 Ga0395905_0533387 3300037471 Unclassified 1074
270 Ga0436364_1387003 3300037853 Bacteria 5043
271 Ga0436364_1482992 3300037853 Bacteria 873
272 Ga0436365_0314488 3300039437 Bacteria 1734
273 Ga0436365_0399061 3300039437 Bacteria 767
274 Ga0436361_1004982 3300039447 Unclassified 641
275 Ga0436361_1217669 3300039447 Plasmid 2688
276 Ga0436363_1131308 3300039450 Bacteria 948
277 Ga0439453_0005581 3300041408 Bacteria 1922
278 Ga0451797_0564693 3300041453 Bacteria 763
279 Ga0451807_2742087 3300041486 Bacteria 784
280 Ga0451835_0627357 3300041492 Bacteria 530
281 Ga0451841_1414325 3300041498 Bacteria 731
282 Ga0451849_0748322 3300041505 Bacteria 666
283 Ga0451855_1291161 3300041511 Bacteria 785
284 Ga0451853_1061493 3300041512 Bacteria 783
285 Ga0439443_004993 3300042003 Bacteria 1757
286 Ga0439446_0331559 3300042156 Bacteria 539
287 Ga0439464_0044807 3300042439 Bacteria 1268
288 Ga0466972_0004957 3300044658 Bacteria 6684
289 Ga0466965_0040397 3300044683 Bacteria 2296
290 Ga0466966_0000734 3300044684 Bacteria 20851
291 Ga0466961_0000084 3300044693 Bacteria 58908
292 Ga0466968_0054827 3300044735 Bacteria 1709
293 Ga0466960_0017444 3300044901 Bacteria 3129
294 Ga0466959_0001520 3300045049 Bacteria 14240
295 Ga0451576_0821742 3300045051 Bacteria 976
296 Ga0495651_0016139 3300046462 Bacteria 5784
297 Ga0495651_0216447 3300046462 Bacteria 1329
298 Ga0495653_0099673 3300046463 Bacteria 2108
299 Ga0495580_0119527 3300046472 Bacteria 1830
300 Ga0495605_0222251 3300046474 Bacteria 816
301 Ga0495662_0242262 3300046476 Bacteria 888
302 Ga0495606_0044078 3300046507 Bacteria 2969
303 Ga0495606_0276539 3300046507 Bacteria 920
304 Ga0495606_0280167 3300046507 Bacteria 912
305 Ga0495608_0450037 3300046511 Bacteria 784
306 Ga0495618_0150519 3300046514 Bacteria 1487
307 Ga0495618_0746532 3300046514 Bacteria 573
308 Ga0495620_0117556 3300046515 Bacteria 1050
309 Ga0495630_0643918 3300046517 Bacteria 812
310 Ga0495643_0121280 3300046522 Bacteria 1321
311 Ga0495648_0047517 3300046524 Bacteria 2651
312 Ga0495665_0254597 3300046531 Bacteria 903
313 Ga0495640_0171234 3300046533 Bacteria 1387
314 Ga0495587_0280094 3300046536 Bacteria 934
315 Ga0495598_0058048 3300046537 Bacteria 1186
316 Ga0495621_0027661 3300046539 Bacteria 1922
317 Ga0495597_0245529 3300046542 Bacteria 705
318 Ga0495645_0398756 3300046543 Bacteria 877
319 Ga0495667_0666731 3300046559 Bacteria 646
320 Ga0495668_0097615 3300046616 Bacteria 1608
321 Ga0495625_0104485 3300046660 Bacteria 1942
322 Ga0495635_0142971 3300046663 Bacteria 1629
323 Ga0495661_0272988 3300046665 Bacteria 855
324 Ga0495588_0149382 3300046674 Bacteria 1235
325 Ga0495588_0681424 3300046674 Bacteria 538
326 Ga0495657_0339755 3300046675 Bacteria 890
327 Ga0495599_0599843 3300046678 Bacteria 641
328 Ga0495646_0179181 3300046680 Bacteria 1164
329 Ga0495613_0717270 3300046689 Unclassified 657
330 Ga0495649_0014605 3300046694 Bacteria 4493
331 Ga0495600_0251377 3300046809 Bacteria 1124
332 Ga0495581_0110007 3300047315 Bacteria 1602
333 Ga0495604_0060294 3300047317 Bacteria 2906
334 Ga0495674_0227208 3300047319 Bacteria 1541
335 Ga0495674_0616720 3300047319 Bacteria 858
336 Ga0495680_0249479 3300047322 Bacteria 1258
337 Ga0495687_064491 3300047443 Bacteria 1495
338 Ga0495673_0116831 3300047469 Bacteria 1060
339 Ga0495686_0322713 3300047472 Bacteria 846
340 Ga0495602_0092835 3300048088 Bacteria 2499
341 Ga0496100_0552906 3300048903 Bacteria 891
342 Ga0496101_0164894 3300048904 Bacteria 1701
343 Ga0496101_0456264 3300048904 Bacteria 1008
344 Ga0496102_0009946 3300048905 Bacteria 8180
345 Ga0496102_0544820 3300048905 Bacteria 1083
346 Ga0496103_0024648 3300048906 Bacteria 3631
347 Ga0496104_0037242 3300048907 Bacteria 4549
348 Ga0496104_0296938 3300048907 Bacteria 1528
349 Ga0496104_0540145 3300048907 Bacteria 1076
350 Ga0496105_0167852 3300048908 Bacteria 1800
351 Ga0496106_0009323 3300048909 Bacteria 7256
352 Ga0496106_0430346 3300048909 Bacteria 1060
353 Ga0496107_0029633 3300048910 Bacteria 3895
354 Ga0496107_0977736 3300048910 Bacteria 615
355 Ga0496108_0009837 3300048911 Bacteria 7749
356 Ga0496108_0246146 3300048911 Bacteria 1555
357 Ga0496108_0766455 3300048911 Bacteria 834
358 Ga0496108_0833343 3300048911 Bacteria 794
359 Ga0496110_0061113 3300048913 Bacteria 3324
360 Ga0496110_0613820 3300048913 Bacteria 986
361 Ga0496110_0630733 3300048913 Bacteria 971
362 Ga0496111_0101812 3300048914 Bacteria 2111
363 Ga0496112_0307124 3300048915 Bacteria 1531
364 Ga0496112_0368179 3300048915 Bacteria 1379
365 Ga0496112_0406337 3300048915 Bacteria 1301
366 Ga0496113_0001431 3300048916 Bacteria 13249
367 Ga0496113_0174634 3300048916 Bacteria 1702
368 Ga0496113_0965644 3300048916 Bacteria 672
369 Ga0496114_0036386 3300048917 Bacteria 4069
370 Ga0496114_0579580 3300048917 Bacteria 990
371 Ga0496114_0923254 3300048917 Bacteria 755
372 Ga0496115_0019589 3300048918 Bacteria 5209
373 Ga0496115_0152082 3300048918 Bacteria 1911
374 Ga0496115_0210472 3300048918 Bacteria 1606
375 Ga0496117_0092743 3300048920 Bacteria 1939
376 Ga0496117_0238225 3300048920 Bacteria 1001
377 Ga0496118_0155033 3300048921 Bacteria 1426
378 Ga0496118_0180278 3300048921 Bacteria 1277
379 Ga0496118_0278410 3300048921 Bacteria 933
380 Ga0496119_0294318 3300048922 Bacteria 803
381 Ga0496121_0024165 3300048924 Bacteria 5821
382 Ga0496121_0053855 3300048924 Bacteria 3367
383 Ga0496121_0101624 3300048924 Bacteria 2216
384 Ga0496121_0164034 3300048924 Bacteria 1621
385 Ga0496121_0356940 3300048924 Bacteria 972
386 Ga0496125_0121510 3300048928 Bacteria 1862
387 Ga0496125_0395676 3300048928 Bacteria 809
388 Ga0496126_0045727 3300048929 Bacteria 4021
389 Ga0496126_0062336 3300048929 Bacteria 3346
390 Ga0496126_0150326 3300048929 Bacteria 1997
391 Ga0496126_0177620 3300048929 Bacteria 1810
392 Ga0496126_0187578 3300048929 Bacteria 1753
393 Ga0496126_0585028 3300048929 Bacteria 881
394 Ga0495682_0009840 3300049460 Bacteria 3721
395 Ga0495682_0126651 3300049460 Bacteria 914
396 Ga0501072_0001640 3300049588 Bacteria 16735
397 nmdc:mga03683_378378_c1 3300050489 Bacteria 674
398 nmdc:mga03n38_157703_c1 3300050490 Bacteria 1147
399 nmdc:mga00v17_44554_c1 3300050491 Bacteria 2676
400 nmdc:mga00v17_520285_c1 3300050491 Bacteria 770
401 nmdc:mga00v17_81249_c1 3300050491 Bacteria 2024
402 nmdc:mga0yw44_396675_c1 3300050492 Bacteria 933
403 nmdc:mga0k408_35525_c1 3300050493 Bacteria 2858
404 nmdc:mga0k408_51067_c1 3300050493 Bacteria 2395
405 nmdc:mga0k408_515057_c1 3300050493 Bacteria 708
406 nmdc:mga06z11_117596_c1 3300050494 Bacteria 1480
407 nmdc:mga04h51_198701_c1 3300050495 Bacteria 787
408 nmdc:mga07m45_161073_c1 3300050496 Bacteria 1302
409 nmdc:mga07m45_365942_c1 3300050496 Bacteria 838
410 nmdc:mga07m45_377372_c1 3300050496 Bacteria 823
411 nmdc:mga07m45_497678_c1 3300050496 Bacteria 706
412 nmdc:mga0sz30_101991_c2 3300050516 Bacteria 724
413 nmdc:mga0sz30_11330_c1 3300050516 Bacteria 3441
414 nmdc:mga0sz30_288886_c1 3300050516 Bacteria 731
415 nmdc:mga0sz30_526248_c1 3300050516 Bacteria 533
416 Ga0495601_0109903 3300053077 Bacteria 1785
417 Ga0495601_0206977 3300053077 Bacteria 1282
418 Ga0495595_0301257 3300053084 Bacteria 806
419 Ga0495619_0359369 3300053085 Bacteria 1007
420 Ga0500578_0084930 3300053086 Bacteria 2011
421 Ga0500643_000060 3300053087 Bacteria 128090
422 Ga0500646_0187166 3300053090 Bacteria 704
423 Ga0500583_0087859 3300053092 Bacteria 1510
424 Ga0500583_0472885 3300053092 Bacteria 592
425 Ga0500651_0083571 3300053093 Bacteria 1975
426 Ga0500566_0000339 3300053094 Bacteria 25453
427 Ga0500641_0162311 3300053096 Bacteria 963
428 Ga0500654_070812 3300053099 Bacteria 1702
429 Ga0500555_029353 3300053103 Bacteria 1564
430 Ga0500555_044481 3300053103 Bacteria 1229
431 Ga0500556_0182718 3300053104 Bacteria 828
432 Ga0500557_000007 3300053105 Bacteria 136781
433 Ga0500562_002235 3300053108 Bacteria 4837
434 Ga0500569_001134 3300053109 Bacteria 4908
435 Ga0500592_075609 3300053116 Bacteria 557
436 Ga0500595_037489 3300053119 Bacteria 1581
437 Ga0500597_167453 3300053120 Bacteria 937
438 Ga0500618_052324 3300053125 Bacteria 924
439 Ga0500642_0031836 3300053130 Bacteria 2207
440 Ga0500642_0178045 3300053130 Bacteria 994
441 Ga0500655_046089 3300053133 Bacteria 862
442 Ga0500658_0025982 3300053134 Bacteria 2254
443 Ga0500658_0331780 3300053134 Bacteria 699
444 Ga0500577_0131255 3300053142 Bacteria 1050
445 Ga0500577_0168420 3300053142 Bacteria 936
446 Ga0500588_0006606 3300053146 Bacteria 2637
447 Ga0500588_0093263 3300053146 Bacteria 1027
448 Ga0500588_0306768 3300053146 Bacteria 601
449 Ga0500616_0030881 3300053153 Bacteria 2939
450 Ga0500622_0015521 3300053156 Bacteria 4077
451 Ga0500627_0132481 3300053158 Bacteria 1126
452 Ga0500638_247939 3300053162 Bacteria 719
453 Ga0500636_0079450 3300053177 Bacteria 1892
454 Ga0500636_0104702 3300053177 Bacteria 1604
455 Ga0500636_0127245 3300053177 Bacteria 1423
456 Ga0500649_220340 3300053722 Bacteria 588
457 Ga0500625_001595 3300053729 Bacteria 7914
458 Ga0500645_104784 3300053730 Bacteria 796
459 Ga0500609_000763 3300053731 Bacteria 4828
460 Ga0500599_005694 3300053736 Bacteria 1573
461 Ga0501084_0215615 3300054114 Bacteria 1619
462 Ga0500661_071869 3300055283 Bacteria 633
463 2508544286 2508501009 Bacteria 7784016
464 2508697775 2508501042 Bacteria 8719808
465 2513640337 2513237094 Bacteria 8789602
466 2513648726 2513237095 Bacteria 8976980
467 2513716001 2513237104 Bacteria 10034502
468 2515630532 2515154112 Bacteria 8294334
469 2617349855 2617270735 Bacteria 9163226
470 2617379209 2617270741 Bacteria 8201522
471 2728749593 2728368998 Bacteria 8720350
472 2818241859 2816332527 Bacteria 8933356
473 2824656842 2824653114 Bacteria 8493680
474 2824735370 2824732956 Bacteria 7810675
475 2824778393 2824773399 Bacteria 8360218
476 2874594890 2874590934 Bacteria 8299676
477 2874646659 2874645413 Bacteria 8214782
478 2876769535 2876761206 Bacteria 10111113
479 2876774268 2876771140 Bacteria 8287509
480 2876822942 2876818435 Bacteria 8274608
481 2879078423 2879074833 Bacteria 8279565
482 2879128879 2879127579 Bacteria 8294491
483 2879144234 2879142872 Bacteria 8267021
484 2885414098 2885409591 Bacteria 9235467
485 2888382165 2888378607 Bacteria 9652610
486 2935663489 2935656913 Bacteria 8965014
487 2935774446 2935769743 Bacteria 7878163
488 2935790535 2935785616 Bacteria 7962367
489 2935799057 2935793552 Bacteria 8012592
490 2935820293 2935819856 Bacteria 8261050
491 2935849697 2935847175 Bacteria 8228321
492 2935916017 2935908558 Bacteria 8568796
493 2935933364 2935926038 Bacteria 8601059
494 2935941905 2935934488 Bacteria 8602579
495 2935950295 2935942939 Bacteria 8599779
496 2935958855 2935951376 Bacteria 8602333
497 2935970336 2935967501 Bacteria 8603075
498 2935979841 2935975950 Bacteria 8347125
499 2935987601 2935984226 Bacteria 8302647
500 2936017578 2936011229 Bacteria 8801034
501 2936026081 2936019824 Bacteria 8804134
502 2936034989 2936028420 Bacteria 8965941
503 2936052980 2936046547 Bacteria 8903709
504 2941535279 2941531003 Bacteria 7653939
505 8016632855 8016630954 Bacteria 9217207
506 8019580485 8019576017 Bacteria 10049540
507 8019588206 8019586578 Bacteria 10212056
508 8019615400 8019608314 Bacteria 10042931
509 8019636255 8019629233 Bacteria 8687553
510 8019643413 8019638758 Bacteria 9062356
511 8019688118 8019687851 Bacteria 8712826
512 Ga0207663_10001185
513 rootL2_10227347
514 JGI25160J50197_1009302
515 Ga0065165_1001022
516 Ga0065165_1026342
517 Ga0065712_10219305
518 Ga0065712_10476323
519 Ga0065715_10018193
520 Ga0065715_10093714
521 Ga0070690_100876809
522 Ga0070670_100105616
523 Ga0070670_100685551
524 Ga0070677_10009895
525 Ga0068869_100415618
526 Ga0068869_100695581
527 Ga0068869_100890914
528 Ga0070666_10290816
529 Ga0070680_100517676
530 Ga0068868_101324316
531 Ga0068868_102293668
532 Ga0070689_100690347
533 Ga0070689_100907821
534 Ga0070689_101151241
535 Ga0070668_100271729
536 Ga0070669_100351479
537 Ga0070675_100777615
538 Ga0070671_100147606
539 Ga0070671_100455711
540 Ga0070671_100818117
541 Ga0070674_100029043
542 Ga0070674_100566843
543 Ga0070674_101126908
544 Ga0070674_101499601
545 Ga0070673_100058429
546 Ga0070688_100114426
547 Ga0070688_100733842
548 Ga0070667_100221203
549 Ga0070667_100425706
550 Ga0070667_100824695
551 Ga0070714_100143682
552 Ga0070713_100015210
553 Ga0070710_10007908
554 Ga0070711_100280538
555 Ga0070678_101505229
556 Ga0070681_10051888
557 Ga0068867_100159988
558 Ga0070706_100205050
559 Ga0070707_101099891
560 Ga0070699_100868911
561 Ga0070679_100376111
562 Ga0070684_101090925
563 Ga0068853_100110205
564 Ga0068853_100534144
565 Ga0068853_100632057
566 Ga0068853_100837935
567 Ga0068853_101705398
568 Ga0070672_100491627
569 Ga0070686_100174999
570 Ga0070686_100692493
571 Ga0070686_100766348
572 Ga0070665_100942845
573 Ga0070665_102160251
574 Ga0068857_100015806
575 Ga0068857_100332418
576 Ga0068857_101168088
577 Ga0068854_100815554
578 Ga0068856_100932510
579 Ga0068856_100942301
580 Ga0068859_100137217
581 Ga0068864_100116868
582 Ga0068870_10414716
583 Ga0068858_100448801
584 Ga0068858_100750228
585 Ga0068860_100000548
586 Ga0068862_100390970
587 Ga0070717_10843480
588 Ga0075365_10722775
589 Ga0075368_10028564
590 Ga0075368_10077777
591 Ga0075364_10010663
592 Ga0075364_10230285
593 Ga0070715_10044369
594 Ga0070712_100102528
595 Ga0070712_100728215
596 Ga0075362_10016632
597 Ga0075369_10023328
598 Ga0075369_10081226
599 Ga0075366_10018298
600 Ga0075366_10039281
601 Ga0075366_10365000
602 Ga0075366_10570286
603 Ga0075370_10350691
604 Ga0068871_100348135
605 Ga0068865_100228275
606 Ga0068865_100479461
607 Ga0068865_102056930
608 Ga0097620_100137229
609 Ga0105250_10125538
610 Ga0105240_10744045
611 Ga0105240_11184493
612 Ga0111539_12052244
613 Ga0105245_10199054
614 Ga0105245_10286761
615 Ga0105245_11208510
616 Ga0105245_11373646
617 Ga0105247_10021465
618 Ga0105247_10175153
619 Ga0105247_10186451
620 Ga0105247_10268470
621 Ga0105247_10336704
622 Ga0105247_10899751
623 Ga0105243_10130378
624 Ga0105241_10077921
625 Ga0105241_10345168
626 Ga0105242_10026396
627 Ga0105248_10199949
628 Ga0105248_12194910
629 Ga0105237_10108758
630 Ga0105237_10747335
631 Ga0105237_11005436
632 Ga0105238_10214753
633 Ga0105238_10345737
634 Ga0105249_10494984
635 Ga0105239_10017591
636 Ga0105239_11543075
637 Ga0105239_12328277
638 Ga0105239_12882644
639 Ga0105246_10369104
640 Ga0105246_10387515
641 Ga0105246_10429139
642 Ga0105246_10632387
643 Ga0157374_10026942
644 Ga0157374_10450724
645 Ga0157374_10703327
646 Ga0157374_11181249
647 Ga0157378_10254814
648 Ga0157378_10593264
649 Ga0157378_10894881
650 Ga0157378_11105522
651 Ga0163162_10156622
652 Ga0163162_10474989
653 Ga0163162_10766660
654 Ga0163162_10814403
655 Ga0157372_11510336
656 Ga0157375_10098968
657 Ga0157375_12313376
658 Ga0163163_10213423
659 Ga0163163_10512784
660 Ga0163163_10737090
661 Ga0157380_10104179
662 Ga0157377_10357355
663 Ga0157379_10346823
664 Ga0157376_10059212
665 Ga0163161_11068520
666 Ga0214544_1005918
667 Ga0214542_1000185
668 Ga0214545_1000102
669 Ga0214543_1022238
670 Ga0209455_1001783
671 Ga0209564_1004297
672 Ga0209758_1001698
673 Ga0209758_1015291
674 Ga0209256_1031299
675 Ga0207426_1075759
676 Ga0207682_10000252
677 Ga0207642_10050614
678 Ga0207688_10025858
679 Ga0207688_10121003
680 Ga0207647_10043017
681 Ga0207685_10008965
682 Ga0207699_10057215
683 Ga0207645_10034528
684 Ga0207643_10366254
685 Ga0207684_10089940
686 Ga0207654_10125115
687 Ga0207707_10386043
688 Ga0207671_10078782
689 Ga0207663_10507113
690 Ga0207660_10737480
691 Ga0207662_10045514
692 Ga0207662_10387162
693 Ga0207652_11397958
694 Ga0207646_10274216
695 Ga0207694_10081722
696 Ga0207694_10309061
697 Ga0207650_10330228
698 Ga0207650_10368374
699 Ga0207650_10473623
700 Ga0207687_10186243
701 Ga0207687_10687750
702 Ga0207664_10025147
703 Ga0207664_10510732
704 Ga0207644_10353811
705 Ga0207644_10803597
706 Ga0207706_10389877
707 Ga0207706_10408780
708 Ga0207709_11244542
709 Ga0207670_10613758
710 Ga0207669_10025229
711 Ga0207669_10522436
712 Ga0207669_11049678
713 Ga0207691_10017733
714 Ga0207691_10781692
715 Ga0207711_10086437
716 Ga0207651_10338870
717 Ga0207640_10536731
718 Ga0207658_11248684
719 Ga0207677_10287883
720 Ga0207677_10721598
721 Ga0207677_11301810
722 Ga0207703_10163824
723 Ga0207703_11970011
724 Ga0207639_10070080
725 Ga0207639_10372701
726 Ga0207639_10412414
727 Ga0207639_10689125
728 Ga0207678_10219135
729 Ga0207702_10294459
730 Ga0207702_10711908
731 Ga0207702_10872317
732 Ga0207641_10048738
733 Ga0207648_10105372
734 Ga0207648_10244490
735 Ga0207676_10121794
736 Ga0207674_10046802
737 Ga0207674_10194413
738 Ga0207683_10073851
739 Ga0265318_10019387
740 Ga0265338_10007347
741 Ga0265332_10009459
742 Ga0265328_10067328
743 Ga0265320_10100604
744 Ga0265325_10120490
745 Ga0265340_10011287
746 Ga0265339_10042173
747 Ga0265339_10049240
748 Ga0265331_10051817
749 Ga0265316_10102942
750 Ga0307513_10068555
751 Ga0307513_10303142
752 Ga0265313_10054856
753 Ga0307508_10078440
754 Ga0307508_10083279
755 Ga0307508_10173128
756 Ga0265314_10039745
757 Ga0265342_10026342
758 Ga0265342_10043748
759 Ga0307516_10014947
760 Ga0307516_10035237
761 Ga0307507_10453351
762 Ga0307510_10157513
763 Ga0373948_0082572
764 Ga0373958_0096534
765 Ga0373938_0052899
766 Ga0373928_0108359
767 Ga0373928_0265825
768 Ga0373929_0096036
769 Ga0373939_0100947
770 Ga0373941_0045142
771 Ga0373943_0442026
772 Ga0373942_0138006
773 Ga0373931_0033068
774 Ga0373931_0342762
775 Ga0373935_0124628
776 Ga0373927_0183360
777 Ga0373927_0960721
778 Ga0395900_0966924
779 Ga0395905_0142011
780 Ga0395905_0533387
781 Ga0436364_1387003
782 Ga0436364_1482992
783 Ga0436365_0314488
784 Ga0436365_0399061
785 Ga0436361_1004982
786 Ga0436361_1217669
787 Ga0436363_1131308
788 Ga0439453_0005581
789 Ga0451797_0564693
790 Ga0451807_2742087
791 Ga0451835_0627357
792 Ga0451841_1414325
793 Ga0451849_0748322
794 Ga0451855_1291161
795 Ga0451853_1061493
796 Ga0439443_004993
797 Ga0439446_0331559
798 Ga0439464_0044807
799 Ga0466972_0004957
800 Ga0466965_0040397
801 Ga0466966_0000734
802 Ga0466961_0000084
803 Ga0466968_0054827
804 Ga0466960_0017444
805 Ga0466959_0001520
806 Ga0451576_0821742
807 Ga0495651_0016139
808 Ga0495651_0216447
809 Ga0495653_0099673
810 Ga0495580_0119527
811 Ga0495605_0222251
812 Ga0495662_0242262
813 Ga0495606_0044078
814 Ga0495606_0276539
815 Ga0495606_0280167
816 Ga0495608_0450037
817 Ga0495618_0150519
818 Ga0495618_0746532
819 Ga0495620_0117556
820 Ga0495630_0643918
821 Ga0495643_0121280
822 Ga0495648_0047517
823 Ga0495665_0254597
824 Ga0495640_0171234
825 Ga0495587_0280094
826 Ga0495598_0058048
827 Ga0495621_0027661
828 Ga0495597_0245529
829 Ga0495645_0398756
830 Ga0495667_0666731
831 Ga0495668_0097615
832 Ga0495625_0104485
833 Ga0495635_0142971
834 Ga0495661_0272988
835 Ga0495588_0149382
836 Ga0495588_0681424
837 Ga0495657_0339755
838 Ga0495599_0599843
839 Ga0495646_0179181
840 Ga0495613_0717270
841 Ga0495649_0014605
842 Ga0495600_0251377
843 Ga0495581_0110007
844 Ga0495604_0060294
845 Ga0495674_0227208
846 Ga0495674_0616720
847 Ga0495680_0249479
848 Ga0495687_064491
849 Ga0495673_0116831
850 Ga0495686_0322713
851 Ga0495602_0092835
852 Ga0496100_0552906
853 Ga0496101_0164894
854 Ga0496101_0456264
855 Ga0496102_0009946
856 Ga0496102_0544820
857 Ga0496103_0024648
858 Ga0496104_0037242
859 Ga0496104_0296938
860 Ga0496104_0540145
861 Ga0496105_0167852
862 Ga0496106_0009323
863 Ga0496106_0430346
864 Ga0496107_0029633
865 Ga0496107_0977736
866 Ga0496108_0009837
867 Ga0496108_0246146
868 Ga0496108_0766455
869 Ga0496108_0833343
870 Ga0496110_0061113
871 Ga0496110_0613820
872 Ga0496110_0630733
873 Ga0496111_0101812
874 Ga0496112_0307124
875 Ga0496112_0368179
876 Ga0496112_0406337
877 Ga0496113_0001431
878 Ga0496113_0174634
879 Ga0496113_0965644
880 Ga0496114_0036386
881 Ga0496114_0579580
882 Ga0496114_0923254
883 Ga0496115_0019589
884 Ga0496115_0152082
885 Ga0496115_0210472
886 Ga0496117_0092743
887 Ga0496117_0238225
888 Ga0496118_0155033
889 Ga0496118_0180278
890 Ga0496118_0278410
891 Ga0496119_0294318
892 Ga0496121_0024165
893 Ga0496121_0053855
894 Ga0496121_0101624
895 Ga0496121_0164034
896 Ga0496121_0356940
897 Ga0496125_0121510
898 Ga0496125_0395676
899 Ga0496126_0045727
900 Ga0496126_0062336
901 Ga0496126_0150326
902 Ga0496126_0177620
903 Ga0496126_0187578
904 Ga0496126_0585028
905 Ga0495682_0009840
906 Ga0495682_0126651
907 Ga0501072_0001640
908 nmdc:mga03683_378378_c1
909 nmdc:mga03n38_157703_c1
910 nmdc:mga00v17_44554_c1
911 nmdc:mga00v17_520285_c1
912 nmdc:mga00v17_81249_c1
913 nmdc:mga0yw44_396675_c1
914 nmdc:mga0k408_35525_c1
915 nmdc:mga0k408_51067_c1
916 nmdc:mga0k408_515057_c1
917 nmdc:mga06z11_117596_c1
918 nmdc:mga04h51_198701_c1
919 nmdc:mga07m45_161073_c1
920 nmdc:mga07m45_365942_c1
921 nmdc:mga07m45_377372_c1
922 nmdc:mga07m45_497678_c1
923 nmdc:mga0sz30_101991_c2
924 nmdc:mga0sz30_11330_c1
925 nmdc:mga0sz30_288886_c1
926 nmdc:mga0sz30_526248_c1
927 Ga0495601_0109903
928 Ga0495601_0206977
929 Ga0495595_0301257
930 Ga0495619_0359369
931 Ga0500578_0084930
932 Ga0500643_000060
933 Ga0500646_0187166
934 Ga0500583_0087859
935 Ga0500583_0472885
936 Ga0500651_0083571
937 Ga0500566_0000339
938 Ga0500641_0162311
939 Ga0500654_070812
940 Ga0500555_029353
941 Ga0500555_044481
942 Ga0500556_0182718
943 Ga0500557_000007
944 Ga0500562_002235
945 Ga0500569_001134
946 Ga0500592_075609
947 Ga0500595_037489
948 Ga0500597_167453
949 Ga0500618_052324
950 Ga0500642_0031836
951 Ga0500642_0178045
952 Ga0500655_046089
953 Ga0500658_0025982
954 Ga0500658_0331780
955 Ga0500577_0131255
956 Ga0500577_0168420
957 Ga0500588_0006606
958 Ga0500588_0093263
959 Ga0500588_0306768
960 Ga0500616_0030881
961 Ga0500622_0015521
962 Ga0500627_0132481
963 Ga0500638_247939
964 Ga0500636_0079450
965 Ga0500636_0104702
966 Ga0500636_0127245
967 Ga0500649_220340
968 Ga0500625_001595
969 Ga0500645_104784
970 Ga0500609_000763
971 Ga0500599_005694
972 Ga0501084_0215615
973 Ga0500661_071869
974 2508544286
975 2508697775
976 2513640337
977 2513648726
978 2513716001
979 2515630532
980 2617349855
981 2617379209
982 2728749593
983 2818241859
984 2824656842
985 2824735370
986 2824778393
987 2874594890
988 2874646659
989 2876769535
990 2876774268
991 2876822942
992 2879078423
993 2879128879
994 2879144234
995 2885414098
996 2888382165
997 2935663489
998 2935774446
999 2935790535
1000 2935799057
1001 2935820293
1002 2935849697
1003 2935916017
1004 2935933364
1005 2935941905
1006 2935950295
1007 2935958855
1008 2935970336
1009 2935979841
1010 2935987601
1011 2936017578
1012 2936026081
1013 2936034989
1014 2936052980
1015 2941535279
1016 8016632855
1017 8019580485
1018 8019588206
1019 8019615400
1020 8019636255
1021 8019643413
1022 8019688118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13474

SnoaL_3

SnoaL-like domain

33

166

0.87

PF14534

DUF4440

Domain of unknown function (DUF4440)

38

157

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ig3-assembly1.cif.gz_E crystal structure of the human camkii-alpha hub 0.868 73 134
3gve-assembly1.cif.gz_A crystal structure of calcineurin-like phosphoesterase yfkn from bacillus subtilis 0.8232 111 135
2j4r-assembly2.cif.gz_B structural study of the aquifex aeolicus ppx-gppa enzyme 0.8005 113 135
1t6c-assembly1.cif.gz_A structural characterization of the ppx/gppa protein family: crystal structure of the aquifex aeolicus family member 0.7937 113 135
6d63-assembly6.cif.gz_K the structure of atzh: a little known member of the atrazine breakdown pathway 0.7702 80 135
ID Description Score Start End Superfamily
af_F1QD15_150_286_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8264 111 136 2.60.40.10
af_Q21735_1_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8238 69 136 3.10.450.50
3gveA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8232 111 135 3.60.21.10
4gniB03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.809 113 136 3.30.420.40
1t6dB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8003 113 135 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2V5SQC5-F1-model_v4 Nuclear transport factor 2 family protein 0.8991 70 135
AF-A0A2W0AJX4-F1-model_v4 Uncharacterized protein 0.8842 73 137
AF-A0A2V6JG41-F1-model_v4 Nuclear transport factor 2 family protein 0.8726 70 140
AF-A0A0U3A6T6-F1-model_v4 SnoaL-like domain protein 0.8665 69 135
AF-A0A7J8FEG5-F1-model_v4 Calcium/calmodulin dependent protein kinase II alpha 0.8646 73 135 GO:0004683
GO:0005516

Map