F457039

General Info

Members Datasets Scaffolds Average Seq Length
509 328 1018 311

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0108580|Ga0495600_0108580_684_1703
Length 339
Sequence MSSAAEIGLTPATTSKKSKPGRAEKLPVPPALRKRRRRDLRVALAFLSPWLIGFGVFFLYPLVSTLYFSFMHYDGFNPPNFVGGKNWSYVFTTFPYFWPAVRNTIWLTVVMVILRTVFGLGIGMLITKIKSGAGFFRTAFYLPYLAPPVAATIGFAFLLNPGTGPVNHILGSLGLPQPGWFNDPNWSKPSLVLLGIWGIGDLMVIFMASLLDVPADQYEAASLDGAGPFQKFRHITLPNIRPIIMFAVITGVINMLQYYTPAIVAGQVASGTIGGSGQTYLPGYPADSTWTLPQLIYNLGFQTNDDLGSACVVSIILFVIAMAFTSLLMRRNSGLVGED

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
114 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
115 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
116 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
117 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
254 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
255 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
260 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
261 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
262 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
265 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
266 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
271 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
272 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
273 2643221548 Streptomyces sp. Root55 Isolate Unclassified
274 2643221578 Streptomyces sp. Root63 Isolate Unclassified
275 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
276 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
277 2643221647 Streptomyces sp. Root369 Isolate Unclassified
278 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
279 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
280 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
281 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
282 2643221714 Streptomyces sp. Root264 Isolate Unclassified
283 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
284 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
285 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
286 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
287 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
288 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
289 2808606448 Streptomyces sp. 193411 Isolate Unclassified
290 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
291 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
292 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
293 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
294 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
295 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
296 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
297 2862574272 Streptomyces sp. AcE210 Isolate Nodule
298 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
299 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
300 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
301 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
302 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
303 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
304 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
305 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
306 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
307 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
308 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
309 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
310 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
311 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
312 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
313 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
314 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
315 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
316 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
317 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
318 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
319 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
320 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
321 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
322 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
323 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
324 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
325 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
326 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
327 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
328 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.21
Metatranscriptomes 0.2
Isolates 11.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 0.79
Rhizoplane 5.5
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0108580 3300046809 Bacteria 1807
2 JGI24740J21852_10002234 3300001979 Bacteria 8842
3 JGI24739J22299_10013920 3300001989 Bacteria 2931
4 JGI24737J22298_10021260 3300001990 Bacteria 2069
5 JGI25153J46596_10032280 3300003215 Bacteria 1748
6 rootH2_10005045 3300003320 Bacteria 4190
7 Ga0006562J51391_1063367 3300003578 Bacteria 1698
8 Ga0070658_10035341 3300005327 Bacteria 4025
9 Ga0070683_100005065 3300005329 Bacteria 10944
10 Ga0070682_100014699 3300005337 Bacteria 4527
11 Ga0070660_100114311 3300005339 Bacteria 2150
12 Ga0070659_100039697 3300005366 Bacteria 3676
13 Ga0070667_100013334 3300005367 Bacteria 6791
14 Ga0070685_10117197 3300005466 Bacteria 1649
15 Ga0070684_100004461 3300005535 Bacteria 10661
16 Ga0068853_100244889 3300005539 Bacteria 1644
17 Ga0070665_100000151 3300005548 Bacteria 127579
18 Ga0070665_100160142 3300005548 Bacteria 2252
19 Ga0070664_100137081 3300005564 Bacteria 2153
20 Ga0068857_100006401 3300005577 Bacteria 10094
21 Ga0068857_100130637 3300005577 Bacteria 2265
22 Ga0068856_100074971 3300005614 Bacteria 3351
23 Ga0070702_100185362 3300005615 Bacteria 1365
24 Ga0068864_100148697 3300005618 Bacteria 2120
25 Ga0068858_100061222 3300005842 Bacteria 3480
26 Ga0068860_100000795 3300005843 Bacteria 35417
27 Ga0068860_100061674 3300005843 Bacteria 3563
28 Ga0081455_10006216 3300005937 Bacteria 12868
29 Ga0075365_10028941 3300006038 Bacteria 3536
30 Ga0075365_10075818 3300006038 Bacteria 2270
31 Ga0075368_10000881 3300006042 Bacteria 9308
32 Ga0075363_100026590 3300006048 Bacteria 2961
33 Ga0075363_100119598 3300006048 Bacteria 1470
34 Ga0075364_10011663 3300006051 Bacteria 5345
35 Ga0075364_10024680 3300006051 Bacteria 3820
36 Ga0075367_10006787 3300006178 Bacteria 5814
37 Ga0075367_10012986 3300006178 Bacteria 4464
38 Ga0075370_10012953 3300006353 Bacteria 4422
39 Ga0075370_10051362 3300006353 Bacteria 2339
40 Ga0075370_10063055 3300006353 Bacteria 2112
41 Ga0075428_100019244 3300006844 Bacteria 7552
42 Ga0075430_100005475 3300006846 Bacteria 10725
43 Ga0075431_100013802 3300006847 Bacteria 8157
44 Ga0075433_10044927 3300006852 Bacteria 3839
45 Ga0099826_10112131 3300006948 Bacteria 1623
46 Ga0105251_10018867 3300009011 Bacteria 3656
47 Ga0105244_10108047 3300009036 Bacteria 1356
48 Ga0105250_10043929 3300009092 Bacteria 1792
49 Ga0111539_10068600 3300009094 Bacteria 4186
50 Ga0111539_10666406 3300009094 Bacteria 1211
51 Ga0105245_10003056 3300009098 Bacteria 14977
52 Ga0105245_10108318 3300009098 Bacteria 2580
53 Ga0105245_10273732 3300009098 Bacteria 1648
54 Ga0114129_10014747 3300009147 Bacteria 11133
55 Ga0105243_10002696 3300009148 Bacteria 14749
56 Ga0105243_10023331 3300009148 Bacteria 4710
57 Ga0105243_10028146 3300009148 Bacteria 4312
58 Ga0105248_10024289 3300009177 Bacteria 6739
59 Ga0105248_10355703 3300009177 Bacteria 1649
60 Ga0105238_10292196 3300009551 Bacteria 1612
61 Ga0105249_10023134 3300009553 Bacteria 5573
62 Ga0105239_10001349 3300010375 Bacteria 33078
63 Ga0105239_10082580 3300010375 Bacteria 3539
64 Ga0105239_10609353 3300010375 Bacteria 1246
65 Ga0105246_10001504 3300011119 Bacteria 13823
66 Ga0105246_10344376 3300011119 Bacteria 1219
67 Ga0157369_10228430 3300013105 Bacteria 1946
68 Ga0157374_10154846 3300013296 Bacteria 2230
69 Ga0163162_10014485 3300013306 Bacteria 7705
70 Ga0157372_10005173 3300013307 Bacteria 13875
71 Ga0157372_10104945 3300013307 Bacteria 3232
72 Ga0157375_10013818 3300013308 Bacteria 7196
73 Ga0157375_10095823 3300013308 Bacteria 3039
74 Ga0157375_10456885 3300013308 Bacteria 1443
75 Ga0163163_10030711 3300014325 Bacteria 5180
76 Ga0182008_10003279 3300014497 Bacteria 9846
77 Ga0157377_10002136 3300014745 Bacteria 8690
78 Ga0157376_10110524 3300014969 Bacteria 2418
79 Ga0182007_10000888 3300015262 Bacteria 16595
80 Ga0183367_1006 3300015688 Bacteria 648044
81 Ga0209758_1001567 3300025297 Bacteria 26210
82 Ga0207713_1018549 3300025735 Bacteria 3440
83 Ga0207688_10057888 3300025901 Bacteria 2180
84 Ga0207688_10062871 3300025901 Bacteria 2093
85 Ga0207647_10023765 3300025904 Bacteria 4050
86 Ga0207647_10039789 3300025904 Bacteria 2964
87 Ga0207705_10066580 3300025909 Bacteria 2606
88 Ga0207662_10013392 3300025918 Bacteria 4586
89 Ga0207657_10105976 3300025919 Bacteria 2326
90 Ga0207659_10132163 3300025926 Bacteria 1928
91 Ga0207687_10023120 3300025927 Bacteria 4141
92 Ga0207690_10248325 3300025932 Bacteria 1373
93 Ga0207709_10014363 3300025935 Bacteria 4372
94 Ga0207709_10048787 3300025935 Bacteria 2581
95 Ga0207691_10282666 3300025940 Bacteria 1427
96 Ga0207711_10235326 3300025941 Bacteria 1678
97 Ga0207689_10126109 3300025942 Bacteria 2106
98 Ga0207661_10044569 3300025944 Bacteria 3506
99 Ga0207679_10112080 3300025945 Bacteria 2155
100 Ga0207712_10021338 3300025961 Bacteria 4252
101 Ga0207668_10036415 3300025972 Bacteria 3284
102 Ga0207668_10434762 3300025972 Bacteria 1117
103 Ga0207658_10080718 3300025986 Bacteria 2492
104 Ga0207703_10073040 3300026035 Bacteria 2837
105 Ga0207639_10018523 3300026041 Bacteria 4949
106 Ga0207702_10104609 3300026078 Bacteria 2505
107 Ga0207702_10159639 3300026078 Bacteria 2058
108 Ga0207676_10199822 3300026095 Bacteria 1765
109 Ga0207674_10021853 3300026116 Bacteria 6884
110 Ga0207674_10052969 3300026116 Bacteria 4137
111 Ga0209813_10001014 3300027866 Bacteria 6313
112 Ga0209813_10007534 3300027866 Bacteria 2713
113 Ga0207428_10007670 3300027907 Bacteria 9821
114 Ga0268266_10004841 3300028379 Bacteria 12786
115 Ga0268266_10048263 3300028379 Bacteria 3649
116 Ga0268266_10280951 3300028379 Bacteria 1548
117 Ga0268265_10122132 3300028380 Bacteria 2148
118 Ga0268264_10000797 3300028381 Bacteria 34094
119 Ga0268264_10045893 3300028381 Bacteria 3629
120 Ga0307515_10005352 3300028794 Bacteria 26060
121 Ga0307515_10073674 3300028794 Bacteria 4584
122 Ga0307515_10113572 3300028794 Bacteria 3139
123 Ga0307515_10192855 3300028794 Bacteria 1941
124 Ga0307511_10019477 3300030521 Bacteria 6454
125 Ga0307511_10047441 3300030521 Bacteria 3514
126 Ga0307512_10005438 3300030522 Bacteria 13304
127 Ga0307512_10011563 3300030522 Bacteria 8357
128 Ga0307513_10054341 3300031456 Bacteria 4295
129 Ga0307513_10159112 3300031456 Bacteria 2153
130 Ga0307508_10004993 3300031616 Bacteria 12752
131 Ga0307508_10038184 3300031616 Bacteria 4317
132 Ga0307508_10039235 3300031616 Bacteria 4255
133 Ga0307508_10065233 3300031616 Bacteria 3208
134 Ga0307514_10098629 3300031649 Bacteria 2104
135 Ga0307516_10006221 3300031730 Bacteria 14044
136 Ga0307516_10023269 3300031730 Bacteria 6355
137 Ga0307516_10111851 3300031730 Bacteria 2532
138 Ga0307518_10146063 3300031838 Bacteria 1642
139 Ga0307416_100457006 3300032002 Bacteria 1331
140 Ga0307507_10016866 3300033179 Bacteria 8448
141 Ga0307507_10107435 3300033179 Bacteria 2299
142 Ga0307507_10133086 3300033179 Bacteria 1937
143 Ga0307507_10163071 3300033179 Bacteria 1641
144 Ga0307510_10223902 3300033180 Bacteria 1390
145 Ga0395898_0002396 3300037466 Bacteria 22266
146 Ga0395898_0009317 3300037466 Bacteria 10323
147 Ga0395905_0166687 3300037471 Bacteria 2070
148 Ga0395901_0193586 3300038443 Bacteria 2132
149 Ga0439436_0005597 3300041404 Bacteria 3852
150 Ga0439439_0001402 3300041406 Bacteria 4778
151 Ga0439439_0024533 3300041406 Bacteria 1514
152 Ga0451807_2118974 3300041486 Bacteria 1449
153 Ga0451837_0983998 3300041494 Bacteria 3287
154 Ga0451845_0425020 3300041501 Bacteria 1550
155 Ga0451853_0051358 3300041512 Bacteria 981
156 Ga0439442_006984 3300042002 Bacteria 2268
157 Ga0439449_0010470 3300042007 Bacteria 3503
158 Ga0439450_026622 3300042008 Bacteria 1276
159 Ga0439457_000770 3300042014 Bacteria 9538
160 Ga0439457_002044 3300042014 Bacteria 5917
161 Ga0450894_000253 3300042131 Bacteria 9576
162 Ga0450896_000975 3300042133 Bacteria 3327
163 Ga0450899_002519 3300042135 Bacteria 1975
164 Ga0450903_000246 3300042138 Bacteria 12033
165 Ga0450903_011245 3300042138 Bacteria 1444
166 Ga0450906_009335 3300042145 Bacteria 1872
167 Ga0439458_0000486 3300042157 Bacteria 10175
168 Ga0450908_011620 3300042184 Bacteria 1610
169 Ga0466969_0003675 3300044656 Bacteria 8168
170 Ga0466972_0025869 3300044658 Bacteria 2907
171 Ga0466965_0000656 3300044683 Bacteria 12690
172 Ga0466966_0006760 3300044684 Bacteria 7595
173 Ga0466966_0009698 3300044684 Bacteria 6378
174 Ga0466966_0221503 3300044684 Bacteria 1142
175 Ga0466961_0000881 3300044693 Bacteria 18671
176 Ga0466963_0000789 3300044694 Bacteria 15768
177 Ga0466963_0026474 3300044694 Bacteria 3710
178 Ga0466963_0036584 3300044694 Bacteria 3202
179 Ga0466963_0058565 3300044694 Bacteria 2569
180 Ga0466971_0001086 3300044719 Bacteria 11298
181 Ga0466971_0032904 3300044719 Bacteria 2323
182 Ga0466971_0138204 3300044719 Bacteria 1134
183 Ga0466968_0030581 3300044735 Bacteria 2231
184 Ga0466970_0000747 3300044765 Bacteria 15820
185 Ga0466970_0000937 3300044765 Bacteria 14078
186 Ga0466957_0001050 3300044842 Bacteria 14251
187 Ga0466960_0029110 3300044901 Bacteria 2532
188 Ga0466959_0001293 3300045049 Bacteria 15152
189 Ga0466959_0280124 3300045049 Bacteria 1144
190 Ga0451576_0192072 3300045051 Bacteria 2133
191 Ga0466958_0008393 3300045836 Bacteria 5727
192 Ga0466967_0004713 3300045976 Bacteria 9268
193 Ga0466967_0043238 3300045976 Bacteria 3899
194 Ga0466967_0076140 3300045976 Bacteria 3017
195 Ga0466967_0128765 3300045976 Bacteria 2347
196 Ga0466967_0517869 3300045976 Bacteria 1172
197 Ga0495617_012159 3300046452 Bacteria 2933
198 Ga0495592_0009824 3300046454 Bacteria 7201
199 Ga0495603_0001566 3300046455 Bacteria 13377
200 Ga0495603_0003478 3300046455 Bacteria 9367
201 Ga0495603_0031776 3300046455 Bacteria 3178
202 Ga0495603_0101217 3300046455 Bacteria 1682
203 Ga0495590_0013166 3300046457 Bacteria 3048
204 Ga0495590_0059461 3300046457 Bacteria 1337
205 Ga0495629_0003260 3300046459 Bacteria 12281
206 Ga0495629_0048984 3300046459 Bacteria 2962
207 Ga0495629_0057393 3300046459 Bacteria 2722
208 Ga0495629_0078955 3300046459 Bacteria 2298
209 Ga0495638_0023740 3300046460 Bacteria 4006
210 Ga0495638_0030299 3300046460 Bacteria 3484
211 Ga0495651_0001129 3300046462 Bacteria 20653
212 Ga0495651_0021888 3300046462 Bacteria 4971
213 Ga0495653_0124980 3300046463 Bacteria 1828
214 Ga0495653_0157276 3300046463 Bacteria 1581
215 Ga0495580_0013055 3300046472 Bacteria 6358
216 Ga0495605_0055245 3300046474 Bacteria 1919
217 Ga0495605_0132922 3300046474 Bacteria 1121
218 Ga0495639_0009148 3300046475 Bacteria 4245
219 Ga0495662_0000218 3300046476 Bacteria 23951
220 Ga0495662_0000973 3300046476 Bacteria 14015
221 Ga0495664_0000592 3300046477 Bacteria 18337
222 Ga0495664_0006534 3300046477 Bacteria 6442
223 Ga0495664_0013265 3300046477 Bacteria 4673
224 Ga0495585_0023000 3300046492 Bacteria 3577
225 Ga0495594_0010345 3300046499 Bacteria 4837
226 Ga0495594_0037420 3300046499 Bacteria 2647
227 Ga0495594_0051120 3300046499 Bacteria 2274
228 Ga0495608_0004358 3300046511 Bacteria 10144
229 Ga0495608_0029325 3300046511 Bacteria 3733
230 Ga0495618_0105479 3300046514 Bacteria 1804
231 Ga0495620_0003588 3300046515 Bacteria 8869
232 Ga0495620_0044845 3300046515 Bacteria 1919
233 Ga0495628_0000688 3300046516 Bacteria 31177
234 Ga0495628_0051847 3300046516 Bacteria 3242
235 Ga0495630_0013530 3300046517 Bacteria 5933
236 Ga0495630_0362146 3300046517 Bacteria 1110
237 Ga0495631_0031050 3300046518 Bacteria 2420
238 Ga0495631_0083888 3300046518 Bacteria 1373
239 Ga0495643_0001384 3300046522 Bacteria 22642
240 Ga0495643_0018032 3300046522 Bacteria 4111
241 Ga0495644_0022309 3300046523 Bacteria 2413
242 Ga0495666_0025535 3300046526 Bacteria 2917
243 Ga0495666_0080155 3300046526 Bacteria 1545
244 Ga0495642_0080319 3300046528 Bacteria 1372
245 Ga0495652_0032106 3300046529 Bacteria 4593
246 Ga0495652_0127207 3300046529 Bacteria 2022
247 Ga0495652_0145216 3300046529 Bacteria 1861
248 Ga0495654_0068841 3300046530 Bacteria 1681
249 Ga0495665_0019800 3300046531 Bacteria 3618
250 Ga0495640_0018665 3300046533 Bacteria 5135
251 Ga0495640_0033453 3300046533 Bacteria 3650
252 Ga0495640_0065951 3300046533 Bacteria 2442
253 Ga0495586_0008403 3300046535 Bacteria 5494
254 Ga0495587_0001092 3300046536 Bacteria 17838
255 Ga0495609_0034645 3300046538 Bacteria 2288
256 Ga0495645_0020054 3300046543 Bacteria 4819
257 Ga0495622_0002179 3300046557 Bacteria 9555
258 Ga0495633_0032272 3300046558 Bacteria 2531
259 Ga0495667_0002553 3300046559 Bacteria 12152
260 Ga0495667_0084283 3300046559 Bacteria 2064
261 Ga0495668_0030824 3300046616 Bacteria 3025
262 Ga0495634_0011341 3300046642 Bacteria 6491
263 Ga0495634_0043586 3300046642 Bacteria 3040
264 Ga0495611_0002971 3300046648 Bacteria 7562
265 Ga0495625_0007646 3300046660 Bacteria 9372
266 Ga0495625_0045306 3300046660 Bacteria 3180
267 Ga0495625_0211386 3300046660 Bacteria 1275
268 Ga0495635_0005140 3300046663 Bacteria 9107
269 Ga0495635_0011239 3300046663 Bacteria 6277
270 Ga0495588_0004806 3300046674 Bacteria 5978
271 Ga0495588_0024643 3300046674 Bacteria 2990
272 Ga0495588_0032818 3300046674 Bacteria 2618
273 Ga0495657_0008610 3300046675 Bacteria 7785
274 Ga0495657_0015527 3300046675 Bacteria 5570
275 Ga0495657_0023827 3300046675 Bacteria 4368
276 Ga0495657_0065398 3300046675 Bacteria 2391
277 Ga0495599_0024173 3300046678 Bacteria 3800
278 Ga0495623_0014544 3300046679 Bacteria 5091
279 Ga0495623_0016194 3300046679 Bacteria 4815
280 Ga0495623_0024858 3300046679 Bacteria 3858
281 Ga0495646_0022614 3300046680 Bacteria 3964
282 Ga0495658_0053664 3300046683 Bacteria 2290
283 Ga0495613_0006539 3300046689 Bacteria 8712
284 Ga0495613_0014959 3300046689 Bacteria 5758
285 Ga0495613_0027435 3300046689 Bacteria 4237
286 Ga0495613_0031545 3300046689 Bacteria 3936
287 Ga0495613_0056003 3300046689 Bacteria 2895
288 Ga0495624_0019189 3300046690 Bacteria 4568
289 Ga0495589_0036847 3300046794 Bacteria 2451
290 Ga0495600_0009282 3300046809 Bacteria 6071
291 Ga0495600_0021286 3300046809 Bacteria 4151
292 Ga0495600_0104196 3300046809 Bacteria 1848
293 Ga0495660_0199699 3300046810 Bacteria 955
294 Ga0495581_0007378 3300047315 Bacteria 6356
295 Ga0495581_0076418 3300047315 Bacteria 1937
296 Ga0495581_0217053 3300047315 Bacteria 1118
297 Ga0495604_0002899 3300047317 Bacteria 13746
298 Ga0495604_0003642 3300047317 Bacteria 12286
299 Ga0495604_0154572 3300047317 Bacteria 1626
300 Ga0495636_0001155 3300047318 Bacteria 9965
301 Ga0495636_0013470 3300047318 Bacteria 3246
302 Ga0495636_0038267 3300047318 Bacteria 1984
303 Ga0495674_0029931 3300047319 Bacteria 4953
304 Ga0495674_0068926 3300047319 Bacteria 3060
305 Ga0495672_0028418 3300047320 Bacteria 3540
306 Ga0495676_0001432 3300047321 Bacteria 20571
307 Ga0495676_0001998 3300047321 Bacteria 17957
308 Ga0495676_0002346 3300047321 Bacteria 16780
309 Ga0495676_0030121 3300047321 Bacteria 4611
310 Ga0495676_0091877 3300047321 Bacteria 2266
311 Ga0495680_0032407 3300047322 Bacteria 4242
312 Ga0495683_0022359 3300047323 Bacteria 3252
313 Ga0495687_001760 3300047443 Bacteria 19147
314 Ga0495687_012373 3300047443 Bacteria 4516
315 Ga0495675_0010323 3300047444 Bacteria 5838
316 Ga0495675_0025857 3300047444 Bacteria 3741
317 Ga0495675_0064367 3300047444 Bacteria 2319
318 Ga0495685_004264 3300047447 Bacteria 4603
319 Ga0495685_004926 3300047447 Bacteria 4336
320 Ga0495685_014635 3300047447 Bacteria 2667
321 Ga0495681_0000931 3300047470 Bacteria 22534
322 Ga0495686_0029763 3300047472 Bacteria 3551
323 Ga0495593_0050235 3300047673 Bacteria 2210
324 Ga0495602_0038921 3300048088 Bacteria 4387
325 Ga0495602_0050509 3300048088 Bacteria 3715
326 Ga0495614_0000115 3300048089 Bacteria 27505
327 Ga0496101_0038178 3300048904 Bacteria 3410
328 Ga0496101_0111056 3300048904 Bacteria 2063
329 Ga0496102_0022784 3300048905 Bacteria 5551
330 Ga0496102_0026973 3300048905 Bacteria 5129
331 Ga0496103_0097609 3300048906 Bacteria 1857
332 Ga0496103_0262104 3300048906 Bacteria 1112
333 Ga0496104_0006765 3300048907 Bacteria 10099
334 Ga0496104_0096522 3300048907 Bacteria 2828
335 Ga0496106_0658281 3300048909 Bacteria 836
336 Ga0496108_0020393 3300048911 Bacteria 5449
337 Ga0496108_0061461 3300048911 Bacteria 3161
338 Ga0496108_0371564 3300048911 Bacteria 1248
339 Ga0496108_0643307 3300048911 Bacteria 922
340 Ga0496109_0006026 3300048912 Bacteria 10187
341 Ga0496109_0041761 3300048912 Bacteria 4154
342 Ga0496109_0070422 3300048912 Bacteria 3209
343 Ga0496109_0074273 3300048912 Bacteria 3125
344 Ga0496109_0084023 3300048912 Bacteria 2936
345 Ga0496110_0011337 3300048913 Bacteria 7291
346 Ga0496110_0044543 3300048913 Bacteria 3875
347 Ga0496110_0181036 3300048913 Bacteria 1914
348 Ga0496110_0198209 3300048913 Bacteria 1824
349 Ga0496114_0004597 3300048917 Bacteria 10719
350 Ga0496114_0026941 3300048917 Bacteria 4708
351 Ga0496114_0055952 3300048917 Bacteria 3290
352 Ga0496114_0094872 3300048917 Bacteria 2538
353 Ga0496115_0318371 3300048918 Bacteria 1273
354 Ga0496124_0068143 3300048927 Bacteria 2959
355 Ga0496125_0077288 3300048928 Bacteria 2567
356 Ga0501032_0006553 3300049569 Bacteria 8548
357 Ga0501032_0016345 3300049569 Bacteria 5221
358 Ga0501033_0001718 3300049570 Bacteria 19163
359 Ga0501033_0006722 3300049570 Bacteria 8985
360 Ga0501034_0015037 3300049571 Bacteria 7958
361 Ga0501034_0113283 3300049571 Bacteria 2702
362 Ga0501036_0043722 3300049572 Bacteria 3794
363 Ga0501036_0109587 3300049572 Bacteria 2333
364 Ga0501037_0264920 3300049573 Bacteria 1200
365 Ga0501038_0005355 3300049574 Bacteria 11915
366 Ga0501038_0134549 3300049574 Bacteria 2026
367 Ga0501039_0234932 3300049575 Bacteria 1441
368 Ga0501043_0028098 3300049579 Bacteria 4415
369 Ga0501043_0056695 3300049579 Bacteria 3077
370 Ga0501046_0140998 3300049580 Bacteria 1824
371 Ga0501047_0141575 3300049581 Bacteria 2283
372 Ga0501047_0270822 3300049581 Bacteria 1544
373 Ga0501048_0152284 3300049582 Bacteria 1636
374 Ga0501067_0000379 3300049583 Bacteria 24195
375 Ga0501067_0005734 3300049583 Bacteria 6892
376 Ga0501067_0013875 3300049583 Bacteria 4461
377 Ga0501067_0026495 3300049583 Bacteria 3211
378 Ga0501067_0094046 3300049583 Bacteria 1664
379 Ga0501068_0006220 3300049584 Bacteria 6566
380 Ga0501068_0068427 3300049584 Bacteria 2164
381 Ga0501069_0132932 3300049585 Bacteria 1425
382 Ga0501070_0001381 3300049586 Bacteria 21726
383 Ga0501070_0014284 3300049586 Bacteria 6682
384 Ga0501070_0038066 3300049586 Bacteria 4014
385 Ga0501070_0072061 3300049586 Bacteria 2860
386 Ga0501073_0004566 3300049589 Bacteria 10410
387 Ga0501073_0020668 3300049589 Bacteria 4748
388 Ga0501074_0003537 3300049590 Bacteria 11082
389 Ga0501079_0041143 3300049741 Bacteria 3566
390 Ga0501080_0001799 3300049742 Bacteria 18366
391 Ga0501080_0023972 3300049742 Bacteria 5657
392 Ga0501080_0188908 3300049742 Bacteria 1893
393 Ga0501083_0004036 3300049744 Bacteria 10323
394 Ga0501035_0025754 3300049822 Bacteria 5391
395 Ga0501035_0074588 3300049822 Bacteria 3001
396 Ga0501035_0080951 3300049822 Bacteria 2866
397 Ga0501035_0127680 3300049822 Bacteria 2219
398 Ga0501035_0145401 3300049822 Bacteria 2059
399 Ga0501044_0000330 3300049823 Bacteria 59751
400 Ga0501044_0008865 3300049823 Bacteria 10997
401 Ga0501044_0015122 3300049823 Bacteria 8316
402 Ga0501044_0071025 3300049823 Bacteria 3541
403 Ga0501044_0106527 3300049823 Bacteria 2815
404 Ga0501044_0120390 3300049823 Bacteria 2626
405 Ga0501044_0253778 3300049823 Bacteria 1699
406 nmdc:mga03683_8704_c1 3300050489 Bacteria 3578
407 nmdc:mga03n38_15058_c1 3300050490 Bacteria 2979
408 nmdc:mga00v17_68293_c1 3300050491 Bacteria 2197
409 nmdc:mga00v17_69830_c1 3300050491 Bacteria 2175
410 nmdc:mga00v17_7860_c1 3300050491 Bacteria 5720
411 nmdc:mga0yw44_111191_c1 3300050492 Bacteria 1755
412 nmdc:mga0yw44_131799_c1 3300050492 Bacteria 1619
413 nmdc:mga0yw44_158708_c1 3300050492 Bacteria 1480
414 nmdc:mga0yw44_7366_c1 3300050492 Bacteria 5408
415 nmdc:mga06z11_16166_c1 3300050494 Bacteria 3354
416 nmdc:mga06z11_8266_c1 3300050494 Bacteria 4329
417 nmdc:mga04h51_1743_c1 3300050495 Bacteria 5095
418 nmdc:mga04h51_8086_c1 3300050495 Bacteria 2804
419 nmdc:mga07m45_14293_c1 3300050496 Bacteria 4225
420 nmdc:mga07m45_73794_c1 3300050496 Bacteria 1943
421 nmdc:mga05p37_2307_c1 3300050507 Bacteria 22250
422 nmdc:mga09592_6171_c1 3300050508 Bacteria 9757
423 nmdc:mga0qj67_4071_c1 3300050509 Bacteria 10606
424 nmdc:mga06r32_382_c1 3300050510 Bacteria 37363
425 nmdc:mga08y16_15987_c1 3300050511 Bacteria 7888
426 nmdc:mga08y16_7501_c1 3300050511 Bacteria 11422
427 nmdc:mga0a205_54531_c1 3300050515 Bacteria 3860
428 Ga0500578_0050449 3300053086 Bacteria 2668
429 Ga0500643_046836 3300053087 Bacteria 1248
430 Ga0500644_0011435 3300053088 Bacteria 2426
431 Ga0500583_0079308 3300053092 Bacteria 1584
432 Ga0500654_062582 3300053099 Bacteria 1890
433 Ga0500553_031626 3300053101 Bacteria 2639
434 Ga0500560_006663 3300053107 Bacteria 2662
435 Ga0500569_001146 3300053109 Bacteria 4886
436 Ga0500652_002275 3300053131 Bacteria 5773
437 Ga0500658_0046386 3300053134 Bacteria 1759
438 Ga0500561_0005104 3300053137 Bacteria 2414
439 Ga0500573_0056652 3300053140 Bacteria 2250
440 Ga0500579_047237 3300053143 Bacteria 2658
441 Ga0500600_0016254 3300053149 Bacteria 4505
442 Ga0500616_0022094 3300053153 Bacteria 3557
443 Ga0500633_0023816 3300053160 Bacteria 1894
444 Ga0500656_005291 3300053732 Bacteria 1271
445 Ga0500587_005356 3300053739 Bacteria 1728
446 Ga0501084_0002079 3300054114 Bacteria 15980
447 Ga0501082_0012868 3300060353 Bacteria 7192
448 Ga0466962_0001927 3300061719 Bacteria 9762
449 Ga0466962_0018278 3300061719 Bacteria 3372
450 Ga0466962_0033900 3300061719 Bacteria 2443
451 2585309137 2582581313 Bacteria 10042643
452 2616700826 2616644814 Bacteria 11555299
453 2616905616 2616644941 Bacteria 8510691
454 2643759808 2643221548 Bacteria 8053412
455 2643897944 2643221578 Bacteria 9213798
456 2644016614 2643221601 Bacteria 7493239
457 2644174989 2643221631 Bacteria 8168043
458 2644263130 2643221647 Bacteria 10741251
459 2644409090 2643221673 Bacteria 9196637
460 2644431527 2643221677 Bacteria 7584031
461 2644436453 2643221678 Bacteria 9540101
462 2644462773 2643221682 Bacteria 6743283
463 2644625706 2643221714 Bacteria 9015452
464 2784587923 2784132148 Bacteria 8627943
465 2785344214 2784746763 Bacteria 9783172
466 2785368661 2784746768 Bacteria 10036182
467 2786669774 2786546132 Bacteria 10419719
468 2808841341 2808606359 Bacteria 9866990
469 2808919874 2808606375 Bacteria 9466072
470 2809231519 2808606448 Bacteria 8656184
471 2811848338 2808606982 Bacteria 7791042
472 2812358910 2811994879 Bacteria 9313447
473 2819693615 2818991463 Bacteria 7948711
474 2852642154 2852635781 Bacteria 8251373
475 2862184836 2862178590 Bacteria 8583590
476 2862288069 2862281513 Bacteria 9621493
477 2862392167 2862382967 Bacteria 10317375
478 2862579933 2862574272 Bacteria 10567477
479 2863405465 2863404153 Bacteria 9672205
480 2873156495 2873151551 Bacteria 8625867
481 2875393852 2875391855 Bacteria 7600475
482 2877681842 2877676314 Bacteria 9512378
483 2912724948 2912723979 Bacteria 8557534
484 2912760003 2912757875 Bacteria 7940295
485 2918503876 2918501144 Bacteria 8668083
486 2919468735 2919468124 Bacteria 9133025
487 2935392336 2935390628 Bacteria 7043367
488 2946050797 2946045630 Bacteria 8527308
489 2946066974 2946064051 Bacteria 8957905
490 2946075279 2946072368 Bacteria 8999607
491 2954003590 2954002825 Bacteria 9173742
492 2954386986 2954380949 Bacteria 10050426
493 2954676200 2954673503 Bacteria 9685905
494 2954687968 2954682443 Bacteria 9862841
495 2954697814 2954691527 Bacteria 10720516
496 2954704402 2954701450 Bacteria 10834262
497 2954716935 2954711539 Bacteria 10867210
498 2954726885 2954721474 Bacteria 10456478
499 2954734912 2954731030 Bacteria 10243860
500 2954745805 2954740390 Bacteria 10229294
501 2954753783 2954749733 Bacteria 10366972
502 2954764780 2954759201 Bacteria 9358192
503 2995471174 2995463766 Bacteria 8577691
504 3006321787 3006321560 Bacteria 8247479
505 8008559606 8008558824 Bacteria 10610750
506 8008579538 8008574985 Bacteria 7815457
507 8023624514 8023623736 Bacteria 8593882
508 8025533561 8025530807 Bacteria 8495698
509 8056833973 8056829672 Bacteria 9045328
510 Ga0495600_0108580
511 JGI24740J21852_10002234
512 JGI24739J22299_10013920
513 JGI24737J22298_10021260
514 JGI25153J46596_10032280
515 rootH2_10005045
516 Ga0006562J51391_1063367
517 Ga0070658_10035341
518 Ga0070683_100005065
519 Ga0070682_100014699
520 Ga0070660_100114311
521 Ga0070659_100039697
522 Ga0070667_100013334
523 Ga0070685_10117197
524 Ga0070684_100004461
525 Ga0068853_100244889
526 Ga0070665_100000151
527 Ga0070665_100160142
528 Ga0070664_100137081
529 Ga0068857_100006401
530 Ga0068857_100130637
531 Ga0068856_100074971
532 Ga0070702_100185362
533 Ga0068864_100148697
534 Ga0068858_100061222
535 Ga0068860_100000795
536 Ga0068860_100061674
537 Ga0081455_10006216
538 Ga0075365_10028941
539 Ga0075365_10075818
540 Ga0075368_10000881
541 Ga0075363_100026590
542 Ga0075363_100119598
543 Ga0075364_10011663
544 Ga0075364_10024680
545 Ga0075367_10006787
546 Ga0075367_10012986
547 Ga0075370_10012953
548 Ga0075370_10051362
549 Ga0075370_10063055
550 Ga0075428_100019244
551 Ga0075430_100005475
552 Ga0075431_100013802
553 Ga0075433_10044927
554 Ga0099826_10112131
555 Ga0105251_10018867
556 Ga0105244_10108047
557 Ga0105250_10043929
558 Ga0111539_10068600
559 Ga0111539_10666406
560 Ga0105245_10003056
561 Ga0105245_10108318
562 Ga0105245_10273732
563 Ga0114129_10014747
564 Ga0105243_10002696
565 Ga0105243_10023331
566 Ga0105243_10028146
567 Ga0105248_10024289
568 Ga0105248_10355703
569 Ga0105238_10292196
570 Ga0105249_10023134
571 Ga0105239_10001349
572 Ga0105239_10082580
573 Ga0105239_10609353
574 Ga0105246_10001504
575 Ga0105246_10344376
576 Ga0157369_10228430
577 Ga0157374_10154846
578 Ga0163162_10014485
579 Ga0157372_10005173
580 Ga0157372_10104945
581 Ga0157375_10013818
582 Ga0157375_10095823
583 Ga0157375_10456885
584 Ga0163163_10030711
585 Ga0182008_10003279
586 Ga0157377_10002136
587 Ga0157376_10110524
588 Ga0182007_10000888
589 Ga0183367_1006
590 Ga0209758_1001567
591 Ga0207713_1018549
592 Ga0207688_10057888
593 Ga0207688_10062871
594 Ga0207647_10023765
595 Ga0207647_10039789
596 Ga0207705_10066580
597 Ga0207662_10013392
598 Ga0207657_10105976
599 Ga0207659_10132163
600 Ga0207687_10023120
601 Ga0207690_10248325
602 Ga0207709_10014363
603 Ga0207709_10048787
604 Ga0207691_10282666
605 Ga0207711_10235326
606 Ga0207689_10126109
607 Ga0207661_10044569
608 Ga0207679_10112080
609 Ga0207712_10021338
610 Ga0207668_10036415
611 Ga0207668_10434762
612 Ga0207658_10080718
613 Ga0207703_10073040
614 Ga0207639_10018523
615 Ga0207702_10104609
616 Ga0207702_10159639
617 Ga0207676_10199822
618 Ga0207674_10021853
619 Ga0207674_10052969
620 Ga0209813_10001014
621 Ga0209813_10007534
622 Ga0207428_10007670
623 Ga0268266_10004841
624 Ga0268266_10048263
625 Ga0268266_10280951
626 Ga0268265_10122132
627 Ga0268264_10000797
628 Ga0268264_10045893
629 Ga0307515_10005352
630 Ga0307515_10073674
631 Ga0307515_10113572
632 Ga0307515_10192855
633 Ga0307511_10019477
634 Ga0307511_10047441
635 Ga0307512_10005438
636 Ga0307512_10011563
637 Ga0307513_10054341
638 Ga0307513_10159112
639 Ga0307508_10004993
640 Ga0307508_10038184
641 Ga0307508_10039235
642 Ga0307508_10065233
643 Ga0307514_10098629
644 Ga0307516_10006221
645 Ga0307516_10023269
646 Ga0307516_10111851
647 Ga0307518_10146063
648 Ga0307416_100457006
649 Ga0307507_10016866
650 Ga0307507_10107435
651 Ga0307507_10133086
652 Ga0307507_10163071
653 Ga0307510_10223902
654 Ga0395898_0002396
655 Ga0395898_0009317
656 Ga0395905_0166687
657 Ga0395901_0193586
658 Ga0439436_0005597
659 Ga0439439_0001402
660 Ga0439439_0024533
661 Ga0451807_2118974
662 Ga0451837_0983998
663 Ga0451845_0425020
664 Ga0451853_0051358
665 Ga0439442_006984
666 Ga0439449_0010470
667 Ga0439450_026622
668 Ga0439457_000770
669 Ga0439457_002044
670 Ga0450894_000253
671 Ga0450896_000975
672 Ga0450899_002519
673 Ga0450903_000246
674 Ga0450903_011245
675 Ga0450906_009335
676 Ga0439458_0000486
677 Ga0450908_011620
678 Ga0466969_0003675
679 Ga0466972_0025869
680 Ga0466965_0000656
681 Ga0466966_0006760
682 Ga0466966_0009698
683 Ga0466966_0221503
684 Ga0466961_0000881
685 Ga0466963_0000789
686 Ga0466963_0026474
687 Ga0466963_0036584
688 Ga0466963_0058565
689 Ga0466971_0001086
690 Ga0466971_0032904
691 Ga0466971_0138204
692 Ga0466968_0030581
693 Ga0466970_0000747
694 Ga0466970_0000937
695 Ga0466957_0001050
696 Ga0466960_0029110
697 Ga0466959_0001293
698 Ga0466959_0280124
699 Ga0451576_0192072
700 Ga0466958_0008393
701 Ga0466967_0004713
702 Ga0466967_0043238
703 Ga0466967_0076140
704 Ga0466967_0128765
705 Ga0466967_0517869
706 Ga0495617_012159
707 Ga0495592_0009824
708 Ga0495603_0001566
709 Ga0495603_0003478
710 Ga0495603_0031776
711 Ga0495603_0101217
712 Ga0495590_0013166
713 Ga0495590_0059461
714 Ga0495629_0003260
715 Ga0495629_0048984
716 Ga0495629_0057393
717 Ga0495629_0078955
718 Ga0495638_0023740
719 Ga0495638_0030299
720 Ga0495651_0001129
721 Ga0495651_0021888
722 Ga0495653_0124980
723 Ga0495653_0157276
724 Ga0495580_0013055
725 Ga0495605_0055245
726 Ga0495605_0132922
727 Ga0495639_0009148
728 Ga0495662_0000218
729 Ga0495662_0000973
730 Ga0495664_0000592
731 Ga0495664_0006534
732 Ga0495664_0013265
733 Ga0495585_0023000
734 Ga0495594_0010345
735 Ga0495594_0037420
736 Ga0495594_0051120
737 Ga0495608_0004358
738 Ga0495608_0029325
739 Ga0495618_0105479
740 Ga0495620_0003588
741 Ga0495620_0044845
742 Ga0495628_0000688
743 Ga0495628_0051847
744 Ga0495630_0013530
745 Ga0495630_0362146
746 Ga0495631_0031050
747 Ga0495631_0083888
748 Ga0495643_0001384
749 Ga0495643_0018032
750 Ga0495644_0022309
751 Ga0495666_0025535
752 Ga0495666_0080155
753 Ga0495642_0080319
754 Ga0495652_0032106
755 Ga0495652_0127207
756 Ga0495652_0145216
757 Ga0495654_0068841
758 Ga0495665_0019800
759 Ga0495640_0018665
760 Ga0495640_0033453
761 Ga0495640_0065951
762 Ga0495586_0008403
763 Ga0495587_0001092
764 Ga0495609_0034645
765 Ga0495645_0020054
766 Ga0495622_0002179
767 Ga0495633_0032272
768 Ga0495667_0002553
769 Ga0495667_0084283
770 Ga0495668_0030824
771 Ga0495634_0011341
772 Ga0495634_0043586
773 Ga0495611_0002971
774 Ga0495625_0007646
775 Ga0495625_0045306
776 Ga0495625_0211386
777 Ga0495635_0005140
778 Ga0495635_0011239
779 Ga0495588_0004806
780 Ga0495588_0024643
781 Ga0495588_0032818
782 Ga0495657_0008610
783 Ga0495657_0015527
784 Ga0495657_0023827
785 Ga0495657_0065398
786 Ga0495599_0024173
787 Ga0495623_0014544
788 Ga0495623_0016194
789 Ga0495623_0024858
790 Ga0495646_0022614
791 Ga0495658_0053664
792 Ga0495613_0006539
793 Ga0495613_0014959
794 Ga0495613_0027435
795 Ga0495613_0031545
796 Ga0495613_0056003
797 Ga0495624_0019189
798 Ga0495589_0036847
799 Ga0495600_0009282
800 Ga0495600_0021286
801 Ga0495600_0104196
802 Ga0495660_0199699
803 Ga0495581_0007378
804 Ga0495581_0076418
805 Ga0495581_0217053
806 Ga0495604_0002899
807 Ga0495604_0003642
808 Ga0495604_0154572
809 Ga0495636_0001155
810 Ga0495636_0013470
811 Ga0495636_0038267
812 Ga0495674_0029931
813 Ga0495674_0068926
814 Ga0495672_0028418
815 Ga0495676_0001432
816 Ga0495676_0001998
817 Ga0495676_0002346
818 Ga0495676_0030121
819 Ga0495676_0091877
820 Ga0495680_0032407
821 Ga0495683_0022359
822 Ga0495687_001760
823 Ga0495687_012373
824 Ga0495675_0010323
825 Ga0495675_0025857
826 Ga0495675_0064367
827 Ga0495685_004264
828 Ga0495685_004926
829 Ga0495685_014635
830 Ga0495681_0000931
831 Ga0495686_0029763
832 Ga0495593_0050235
833 Ga0495602_0038921
834 Ga0495602_0050509
835 Ga0495614_0000115
836 Ga0496101_0038178
837 Ga0496101_0111056
838 Ga0496102_0022784
839 Ga0496102_0026973
840 Ga0496103_0097609
841 Ga0496103_0262104
842 Ga0496104_0006765
843 Ga0496104_0096522
844 Ga0496106_0658281
845 Ga0496108_0020393
846 Ga0496108_0061461
847 Ga0496108_0371564
848 Ga0496108_0643307
849 Ga0496109_0006026
850 Ga0496109_0041761
851 Ga0496109_0070422
852 Ga0496109_0074273
853 Ga0496109_0084023
854 Ga0496110_0011337
855 Ga0496110_0044543
856 Ga0496110_0181036
857 Ga0496110_0198209
858 Ga0496114_0004597
859 Ga0496114_0026941
860 Ga0496114_0055952
861 Ga0496114_0094872
862 Ga0496115_0318371
863 Ga0496124_0068143
864 Ga0496125_0077288
865 Ga0501032_0006553
866 Ga0501032_0016345
867 Ga0501033_0001718
868 Ga0501033_0006722
869 Ga0501034_0015037
870 Ga0501034_0113283
871 Ga0501036_0043722
872 Ga0501036_0109587
873 Ga0501037_0264920
874 Ga0501038_0005355
875 Ga0501038_0134549
876 Ga0501039_0234932
877 Ga0501043_0028098
878 Ga0501043_0056695
879 Ga0501046_0140998
880 Ga0501047_0141575
881 Ga0501047_0270822
882 Ga0501048_0152284
883 Ga0501067_0000379
884 Ga0501067_0005734
885 Ga0501067_0013875
886 Ga0501067_0026495
887 Ga0501067_0094046
888 Ga0501068_0006220
889 Ga0501068_0068427
890 Ga0501069_0132932
891 Ga0501070_0001381
892 Ga0501070_0014284
893 Ga0501070_0038066
894 Ga0501070_0072061
895 Ga0501073_0004566
896 Ga0501073_0020668
897 Ga0501074_0003537
898 Ga0501079_0041143
899 Ga0501080_0001799
900 Ga0501080_0023972
901 Ga0501080_0188908
902 Ga0501083_0004036
903 Ga0501035_0025754
904 Ga0501035_0074588
905 Ga0501035_0080951
906 Ga0501035_0127680
907 Ga0501035_0145401
908 Ga0501044_0000330
909 Ga0501044_0008865
910 Ga0501044_0015122
911 Ga0501044_0071025
912 Ga0501044_0106527
913 Ga0501044_0120390
914 Ga0501044_0253778
915 nmdc:mga03683_8704_c1
916 nmdc:mga03n38_15058_c1
917 nmdc:mga00v17_68293_c1
918 nmdc:mga00v17_69830_c1
919 nmdc:mga00v17_7860_c1
920 nmdc:mga0yw44_111191_c1
921 nmdc:mga0yw44_131799_c1
922 nmdc:mga0yw44_158708_c1
923 nmdc:mga0yw44_7366_c1
924 nmdc:mga06z11_16166_c1
925 nmdc:mga06z11_8266_c1
926 nmdc:mga04h51_1743_c1
927 nmdc:mga04h51_8086_c1
928 nmdc:mga07m45_14293_c1
929 nmdc:mga07m45_73794_c1
930 nmdc:mga05p37_2307_c1
931 nmdc:mga09592_6171_c1
932 nmdc:mga0qj67_4071_c1
933 nmdc:mga06r32_382_c1
934 nmdc:mga08y16_15987_c1
935 nmdc:mga08y16_7501_c1
936 nmdc:mga0a205_54531_c1
937 Ga0500578_0050449
938 Ga0500643_046836
939 Ga0500644_0011435
940 Ga0500583_0079308
941 Ga0500654_062582
942 Ga0500553_031626
943 Ga0500560_006663
944 Ga0500569_001146
945 Ga0500652_002275
946 Ga0500658_0046386
947 Ga0500561_0005104
948 Ga0500573_0056652
949 Ga0500579_047237
950 Ga0500600_0016254
951 Ga0500616_0022094
952 Ga0500633_0023816
953 Ga0500656_005291
954 Ga0500587_005356
955 Ga0501084_0002079
956 Ga0501082_0012868
957 Ga0466962_0001927
958 Ga0466962_0018278
959 Ga0466962_0033900
960 2585309137
961 2616700826
962 2616905616
963 2643759808
964 2643897944
965 2644016614
966 2644174989
967 2644263130
968 2644409090
969 2644431527
970 2644436453
971 2644462773
972 2644625706
973 2784587923
974 2785344214
975 2785368661
976 2786669774
977 2808841341
978 2808919874
979 2809231519
980 2811848338
981 2812358910
982 2819693615
983 2852642154
984 2862184836
985 2862288069
986 2862392167
987 2862579933
988 2863405465
989 2873156495
990 2875393852
991 2877681842
992 2912724948
993 2912760003
994 2918503876
995 2919468735
996 2935392336
997 2946050797
998 2946066974
999 2946075279
1000 2954003590
1001 2954386986
1002 2954676200
1003 2954687968
1004 2954697814
1005 2954704402
1006 2954716935
1007 2954726885
1008 2954734912
1009 2954745805
1010 2954753783
1011 2954764780
1012 2995471174
1013 3006321787
1014 8008559606
1015 8008579538
1016 8023624514
1017 8025533561
1018 8056833973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

79

333

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7395 9 301
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7375 9 303
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7348 9 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7251 9 301
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7206 9 303
ID Description Score Start End Superfamily
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7388 19 309 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7319 14 299 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7307 19 309 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7241 53 305 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7229 8 300 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V9HGZ0-F1-model_v4 Sugar ABC transporter permease 0.7646 6 305 GO:0005886
GO:0055085
AF-A0A7Y2LY90-F1-model_v4 Sugar ABC transporter permease 0.762 8 301 GO:0005886
GO:0055085
AF-A0A6J4J9F1-F1-model_v4 ABC transporter, permease protein 1 (Cluster 1, maltose/g3p/polyamine/iron) 0.7613 7 301 GO:0005886
GO:0055085
AF-A0A542ELL1-F1-model_v4 Carbohydrate ABC transporter membrane protein 1 (CUT1 family) 0.7606 9 301 GO:0005886
GO:0055085
AF-A0A2V3TWT8-F1-model_v4 Carbohydrate ABC transporter membrane protein 1 (CUT1 family) 0.7605 10 307 GO:0005886
GO:0055085

Map