F456991

General Info

Members Datasets Scaffolds Average Seq Length
509 231 1018 86

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10415813|Ga0207681_104158132
Length 103
Sequence VRFPILLPIGLFSLVGILLAQQPAEDAERKKAFLNAREQMRIVPPTTIDFTADALDFKNINLLKQFVTDQGRILPRKYTGLPAHYQRRLNRAIKRARQMLLMR

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
156 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
217 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
220 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 1.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 43.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10415813 3300025923 Bacteria 1089
2 rootH2_10078033 3300003320 Bacteria 10986
3 rootH1_10284720 3300003323 Bacteria 4296
4 Ga0058863_10506688 3300004799 Unclassified 865
5 Ga0058863_11036164 3300004799 Unclassified 601
6 Ga0065707_11035292 3300005295 Bacteria 530
7 Ga0070658_11356718 3300005327 Unclassified 617
8 Ga0070683_102418848 3300005329 Unclassified 503
9 Ga0070690_100103079 3300005330 Bacteria 1894
10 Ga0070690_101194001 3300005330 Unclassified 606
11 Ga0068869_101458336 3300005334 Unclassified 607
12 Ga0068868_100487880 3300005338 Bacteria 1077
13 Ga0070660_101399316 3300005339 Unclassified 594
14 Ga0070689_100013962 3300005340 Bacteria 5826
15 Ga0070689_100034962 3300005340 Bacteria 3836
16 Ga0070689_100597075 3300005340 Unclassified 956
17 Ga0070689_101551889 3300005340 Bacteria 600
18 Ga0070668_100281429 3300005347 Bacteria 1389
19 Ga0070675_100146070 3300005354 Bacteria 2025
20 Ga0070688_100138713 3300005365 Unclassified 1649
21 Ga0070688_100210106 3300005365 Bacteria 1366
22 Ga0070688_101723386 3300005365 Unclassified 513
23 Ga0070659_102148475 3300005366 Unclassified 502
24 Ga0070667_101163991 3300005367 Bacteria 721
25 Ga0070713_100324022 3300005436 Bacteria 1424
26 Ga0070701_10236741 3300005438 Unclassified 1096
27 Ga0070701_10269585 3300005438 Bacteria 1035
28 Ga0070711_100074099 3300005439 Bacteria 2407
29 Ga0070711_100731193 3300005439 Bacteria 835
30 Ga0070711_100861482 3300005439 Unclassified 771
31 Ga0070700_100831765 3300005441 Bacteria 746
32 Ga0070694_100279058 3300005444 Unclassified 1273
33 Ga0070708_101045983 3300005445 Bacteria 765
34 Ga0070678_100762185 3300005456 Unclassified 876
35 Ga0070681_10669038 3300005458 Unclassified 953
36 Ga0070707_100808542 3300005468 Unclassified 901
37 Ga0070697_101400015 3300005536 Unclassified 624
38 Ga0070686_100052531 3300005544 Bacteria 2599
39 Ga0070686_100086404 3300005544 Bacteria 2088
40 Ga0070665_102117671 3300005548 Unclassified 567
41 Ga0070665_102559153 3300005548 Unclassified 511
42 Ga0070704_101168423 3300005549 Unclassified 701
43 Ga0070704_101690845 3300005549 Unclassified 584
44 Ga0068855_100383833 3300005563 Bacteria 1542
45 Ga0068855_101007109 3300005563 Unclassified 875
46 Ga0068857_102124658 3300005577 Unclassified 551
47 Ga0068856_100078427 3300005614 Unclassified 3274
48 Ga0068856_101325210 3300005614 Bacteria 735
49 Ga0068856_102220559 3300005614 Bacteria 558
50 Ga0070702_100306869 3300005615 Bacteria 1100
51 Ga0070702_101347881 3300005615 Unclassified 581
52 Ga0068859_100054411 3300005617 Unclassified 4025
53 Ga0068859_100082799 3300005617 Unclassified 3251
54 Ga0068859_100091750 3300005617 Bacteria 3088
55 Ga0068864_100146879 3300005618 Bacteria 2133
56 Ga0068864_100901289 3300005618 Bacteria 873
57 Ga0068864_102386748 3300005618 Unclassified 535
58 Ga0068861_101466646 3300005719 Unclassified 668
59 Ga0068861_101625523 3300005719 Unclassified 637
60 Ga0068863_100087341 3300005841 Bacteria 2955
61 Ga0068863_100130965 3300005841 Unclassified 2395
62 Ga0068863_100261879 3300005841 Bacteria 1672
63 Ga0068863_100465936 3300005841 Unclassified 1241
64 Ga0068863_102088018 3300005841 Unclassified 577
65 Ga0068858_100122398 3300005842 Unclassified 2434
66 Ga0068858_100733030 3300005842 Bacteria 962
67 Ga0068858_100806699 3300005842 Bacteria 916
68 Ga0068858_100811014 3300005842 Bacteria 913
69 Ga0068858_101335163 3300005842 Bacteria 706
70 Ga0068860_101076206 3300005843 Bacteria 823
71 Ga0081455_10073748 3300005937 Bacteria 2820
72 Ga0081455_10303862 3300005937 Viruses 1143
73 Ga0070716_100929180 3300006173 Bacteria 683
74 Ga0097621_100262113 3300006237 Bacteria 1516
75 Ga0097621_100358186 3300006237 Bacteria 1299
76 Ga0097621_100943349 3300006237 Unclassified 805
77 Ga0068871_100043629 3300006358 Bacteria 3603
78 Ga0068871_100730932 3300006358 Unclassified 909
79 Ga0075428_101114561 3300006844 Unclassified 833
80 Ga0075431_100052238 3300006847 Bacteria 4214
81 Ga0075431_101343522 3300006847 Unclassified 675
82 Ga0075434_100047744 3300006871 Bacteria 4248
83 Ga0075434_101718057 3300006871 Unclassified 635
84 Ga0075434_102166761 3300006871 Unclassified 560
85 Ga0068865_100122626 3300006881 Bacteria 1935
86 Ga0068865_102138319 3300006881 Unclassified 509
87 Ga0075436_100366361 3300006914 Bacteria 1040
88 Ga0075436_101485829 3300006914 Unclassified 514
89 Ga0097620_100054412 3300006931 Unclassified 4025
90 Ga0097620_100082802 3300006931 Unclassified 3251
91 Ga0097620_100091751 3300006931 Bacteria 3088
92 Ga0097620_100363154 3300006931 Bacteria 1543
93 Ga0075435_101555938 3300007076 Unclassified 580
94 Ga0099794_10659579 3300007265 Unclassified 556
95 Ga0105250_10391727 3300009092 Bacteria 615
96 Ga0105240_10006286 3300009093 Bacteria 17474
97 Ga0105240_10379767 3300009093 Unclassified 1596
98 Ga0111539_10014480 3300009094 Bacteria 9845
99 Ga0111539_10146975 3300009094 Bacteria 2760
100 Ga0111539_10194630 3300009094 Bacteria 2365
101 Ga0111539_11064901 3300009094 Unclassified 940
102 Ga0111539_12503272 3300009094 Bacteria 599
103 Ga0105245_11770428 3300009098 Bacteria 670
104 Ga0105241_10848324 3300009174 Unclassified 845
105 Ga0105242_13042246 3300009176 Unclassified 519
106 Ga0105248_10375790 3300009177 Bacteria 1600
107 Ga0105248_11203585 3300009177 Bacteria 857
108 Ga0105248_12521602 3300009177 Unclassified 586
109 Ga0105238_10003252 3300009551 Bacteria 16217
110 Ga0105238_10328298 3300009551 Bacteria 1516
111 Ga0105238_10657445 3300009551 Bacteria 1058
112 Ga0105249_13489213 3300009553 Unclassified 506
113 Ga0105239_11582421 3300010375 Unclassified 758
114 Ga0105246_11187581 3300011119 Unclassified 701
115 Ga0157371_10083150 3300013102 Unclassified 2267
116 Ga0157370_11364175 3300013104 Unclassified 638
117 Ga0157374_10655133 3300013296 Bacteria 1062
118 Ga0157374_10739342 3300013296 Bacteria 998
119 Ga0157374_11212005 3300013296 Unclassified 776
120 Ga0157374_11908815 3300013296 Unclassified 620
121 Ga0157378_10321688 3300013297 Bacteria 1503
122 Ga0157378_10515823 3300013297 Bacteria 1196
123 Ga0157378_11353905 3300013297 Unclassified 754
124 Ga0163162_10789364 3300013306 Bacteria 1067
125 Ga0163162_12293373 3300013306 Bacteria 620
126 Ga0157372_10261309 3300013307 Unclassified 2010
127 Ga0157372_10707563 3300013307 Unclassified 1172
128 Ga0157372_12641303 3300013307 Unclassified 576
129 Ga0157375_10069987 3300013308 Unclassified 3517
130 Ga0157375_11585792 3300013308 Bacteria 774
131 Ga0163163_10038999 3300014325 Unclassified 4634
132 Ga0163163_10072386 3300014325 Bacteria 3436
133 Ga0157377_11675321 3300014745 Unclassified 512
134 Ga0157376_10343618 3300014969 Bacteria 1426
135 Ga0157376_11667410 3300014969 Unclassified 672
136 Ga0182007_10371618 3300015262 Unclassified 541
137 Ga0206356_10931428 3300020070 Bacteria 837
138 Ga0207653_10163051 3300025885 Unclassified 826
139 Ga0207695_10042071 3300025913 Bacteria 4885
140 Ga0207695_10282618 3300025913 Bacteria 1553
141 Ga0207695_10746039 3300025913 Bacteria 859
142 Ga0207695_10785229 3300025913 Unclassified 832
143 Ga0207663_10061903 3300025916 Bacteria 2376
144 Ga0207663_11362251 3300025916 Unclassified 571
145 Ga0207663_11419874 3300025916 Unclassified 559
146 Ga0207646_10613706 3300025922 Unclassified 976
147 Ga0207681_11836693 3300025923 Unclassified 505
148 Ga0207694_10011188 3300025924 Bacteria 6773
149 Ga0207694_10433070 3300025924 Bacteria 1096
150 Ga0207694_11142098 3300025924 Unclassified 659
151 Ga0207659_10393009 3300025926 Unclassified 1158
152 Ga0207659_11543243 3300025926 Bacteria 568
153 Ga0207700_10431465 3300025928 Bacteria 1159
154 Ga0207700_11851537 3300025928 Unclassified 530
155 Ga0207690_11864557 3300025932 Unclassified 502
156 Ga0207686_10526383 3300025934 Bacteria 921
157 Ga0207670_10004396 3300025936 Bacteria 7585
158 Ga0207670_10009706 3300025936 Bacteria 5506
159 Ga0207670_10143462 3300025936 Bacteria 1763
160 Ga0207704_10098906 3300025938 Bacteria 1939
161 Ga0207704_11673606 3300025938 Bacteria 547
162 Ga0207711_10478539 3300025941 Bacteria 1160
163 Ga0207689_10705218 3300025942 Bacteria 851
164 Ga0207661_10269660 3300025944 Bacteria 1519
165 Ga0207667_10161631 3300025949 Bacteria 2303
166 Ga0207667_10894638 3300025949 Unclassified 880
167 Ga0207651_10813074 3300025960 Unclassified 829
168 Ga0207677_10343524 3300026023 Bacteria 1248
169 Ga0207703_10223478 3300026035 Unclassified 1685
170 Ga0207703_10575199 3300026035 Unclassified 1064
171 Ga0207703_11620460 3300026035 Bacteria 623
172 Ga0207708_10384956 3300026075 Bacteria 1157
173 Ga0207708_10650999 3300026075 Unclassified 897
174 Ga0207702_11100892 3300026078 Bacteria 788
175 Ga0207702_11394997 3300026078 Bacteria 694
176 Ga0207641_10133228 3300026088 Unclassified 2234
177 Ga0207641_10330123 3300026088 Unclassified 1448
178 Ga0207641_10461189 3300026088 Bacteria 1229
179 Ga0207641_10637236 3300026088 Unclassified 1046
180 Ga0207641_10791525 3300026088 Bacteria 938
181 Ga0207676_12357556 3300026095 Unclassified 529
182 Ga0207674_11487453 3300026116 Unclassified 646
183 Ga0207675_102067395 3300026118 Bacteria 586
184 Ga0207428_10329422 3300027907 Bacteria 1126
185 Ga0268266_10510792 3300028379 Bacteria 1148
186 Ga0268264_11414169 3300028381 Bacteria 706
187 Ga0265337_1000019 3300028556 Bacteria 74250
188 Ga0265337_1001311 3300028556 Bacteria 12405
189 Ga0265337_1002078 3300028556 Bacteria 9464
190 Ga0265337_1008953 3300028556 Bacteria 3606
191 Ga0265337_1009934 3300028556 Bacteria 3361
192 Ga0265337_1029630 3300028556 Unclassified 1636
193 Ga0265337_1037600 3300028556 Unclassified 1407
194 Ga0265337_1050572 3300028556 Bacteria 1171
195 Ga0265326_10004954 3300028558 Bacteria 4219
196 Ga0265326_10039182 3300028558 Bacteria 1346
197 Ga0265319_1000019 3300028563 Bacteria 154537
198 Ga0265319_1005132 3300028563 Bacteria 6337
199 Ga0265319_1226213 3300028563 Unclassified 572
200 Ga0265334_10129540 3300028573 Unclassified 898
201 Ga0265334_10178774 3300028573 Unclassified 741
202 Ga0265318_10100002 3300028577 Bacteria 1067
203 Ga0265318_10300600 3300028577 Unclassified 585
204 Ga0265323_10023002 3300028653 Bacteria 2378
205 Ga0265323_10043821 3300028653 Bacteria 1614
206 Ga0265323_10172206 3300028653 Bacteria 687
207 Ga0265323_10183523 3300028653 Bacteria 662
208 Ga0265323_10218818 3300028653 Bacteria 597
209 Ga0265323_10262764 3300028653 Bacteria 536
210 Ga0265322_10027131 3300028654 Bacteria 1637
211 Ga0265322_10070601 3300028654 Bacteria 991
212 Ga0265336_10003147 3300028666 Bacteria 6570
213 Ga0265336_10029294 3300028666 Unclassified 1718
214 Ga0265336_10063315 3300028666 Unclassified 1108
215 Ga0265338_10000016 3300028800 Bacteria 347424
216 Ga0265338_10000036 3300028800 Bacteria 238689
217 Ga0265338_10000145 3300028800 Bacteria 130629
218 Ga0265338_10000214 3300028800 Bacteria 106870
219 Ga0265338_10000276 3300028800 Bacteria 93585
220 Ga0265338_10001186 3300028800 Bacteria 43013
221 Ga0265338_10001578 3300028800 Bacteria 36726
222 Ga0265338_10002314 3300028800 Bacteria 28889
223 Ga0265338_10009538 3300028800 Bacteria 11551
224 Ga0265338_10011463 3300028800 Bacteria 10236
225 Ga0265338_10017479 3300028800 Bacteria 7728
226 Ga0265338_10035880 3300028800 Unclassified 4755
227 Ga0265338_10040849 3300028800 Bacteria 4350
228 Ga0265338_10046320 3300028800 Bacteria 3986
229 Ga0265338_10075728 3300028800 Bacteria 2854
230 Ga0265338_10087685 3300028800 Bacteria 2584
231 Ga0265338_10096683 3300028800 Bacteria 2422
232 Ga0265338_10117039 3300028800 Bacteria 2133
233 Ga0265338_10144880 3300028800 Bacteria 1855
234 Ga0265338_10188790 3300028800 Unclassified 1564
235 Ga0265338_10556105 3300028800 Unclassified 803
236 Ga0265338_10593767 3300028800 Bacteria 772
237 Ga0265338_11199594 3300028800 Unclassified 509
238 Ga0265324_10001693 3300029957 Bacteria 12155
239 Ga0265324_10006387 3300029957 Bacteria 4923
240 Ga0265324_10011711 3300029957 Bacteria 3335
241 Ga0265324_10030054 3300029957 Bacteria 1908
242 Ga0265324_10049164 3300029957 Bacteria 1450
243 Ga0265324_10068051 3300029957 Bacteria 1214
244 Ga0265324_10071285 3300029957 Bacteria 1184
245 Ga0265324_10265832 3300029957 Unclassified 583
246 Ga0265330_10072225 3300031235 Bacteria 1492
247 Ga0265330_10124512 3300031235 Unclassified 1098
248 Ga0265330_10154031 3300031235 Bacteria 977
249 Ga0265332_10051666 3300031238 Bacteria 1765
250 Ga0265332_10185356 3300031238 Unclassified 866
251 Ga0265332_10230636 3300031238 Unclassified 767
252 Ga0265332_10319684 3300031238 Bacteria 641
253 Ga0265328_10016230 3300031239 Bacteria 2901
254 Ga0265328_10100832 3300031239 Bacteria 1069
255 Ga0265320_10000536 3300031240 Bacteria 29339
256 Ga0265320_10003039 3300031240 Bacteria 11388
257 Ga0265320_10008245 3300031240 Bacteria 6388
258 Ga0265320_10011918 3300031240 Bacteria 5091
259 Ga0265320_10036788 3300031240 Bacteria 2471
260 Ga0265320_10072481 3300031240 Bacteria 1621
261 Ga0265320_10191935 3300031240 Unclassified 913
262 Ga0265320_10248463 3300031240 Bacteria 789
263 Ga0265320_10364202 3300031240 Unclassified 639
264 Ga0265320_10383240 3300031240 Unclassified 621
265 Ga0265320_10388470 3300031240 Bacteria 616
266 Ga0265325_10017236 3300031241 Bacteria 4016
267 Ga0265325_10020886 3300031241 Bacteria 3604
268 Ga0265325_10082163 3300031241 Unclassified 1599
269 Ga0265325_10433095 3300031241 Unclassified 574
270 Ga0265329_10005622 3300031242 Bacteria 5045
271 Ga0265340_10014990 3300031247 Bacteria 4036
272 Ga0265340_10023583 3300031247 Bacteria 3135
273 Ga0265340_10032889 3300031247 Bacteria 2586
274 Ga0265340_10137631 3300031247 Unclassified 1118
275 Ga0265340_10197176 3300031247 Bacteria 906
276 Ga0265339_10007758 3300031249 Bacteria 6900
277 Ga0265339_10020223 3300031249 Unclassified 3892
278 Ga0265339_10132349 3300031249 Bacteria 1274
279 Ga0265339_10219044 3300031249 Unclassified 932
280 Ga0265339_10220448 3300031249 Bacteria 928
281 Ga0265339_10260989 3300031249 Unclassified 836
282 Ga0265339_10297831 3300031249 Bacteria 770
283 Ga0265339_10451815 3300031249 Bacteria 596
284 Ga0265339_10505439 3300031249 Unclassified 558
285 Ga0265331_10065177 3300031250 Unclassified 1714
286 Ga0265331_10282163 3300031250 Unclassified 744
287 Ga0265327_10002194 3300031251 Bacteria 21435
288 Ga0265316_10000812 3300031344 Bacteria 34512
289 Ga0265316_10013762 3300031344 Bacteria 7167
290 Ga0265316_10032642 3300031344 Bacteria 4247
291 Ga0265316_10064382 3300031344 Bacteria 2840
292 Ga0265316_10097968 3300031344 Unclassified 2231
293 Ga0265316_10099765 3300031344 Unclassified 2208
294 Ga0265316_10191613 3300031344 Unclassified 1518
295 Ga0265316_10228770 3300031344 Bacteria 1370
296 Ga0265316_10669111 3300031344 Bacteria 733
297 Ga0265316_10716844 3300031344 Unclassified 704
298 Ga0265316_10853267 3300031344 Bacteria 637
299 Ga0307408_101649734 3300031548 Unclassified 610
300 Ga0265313_10001645 3300031595 Bacteria 20708
301 Ga0265313_10004745 3300031595 Bacteria 10246
302 Ga0265314_10001100 3300031711 Bacteria 31213
303 Ga0265314_10066550 3300031711 Bacteria 2430
304 Ga0265314_10086692 3300031711 Bacteria 2049
305 Ga0265314_10099832 3300031711 Bacteria 1868
306 Ga0265314_10341282 3300031711 Bacteria 827
307 Ga0265342_10018887 3300031712 Bacteria 4456
308 Ga0265342_10079647 3300031712 Bacteria 1894
309 Ga0265342_10536497 3300031712 Unclassified 594
310 Ga0265342_10651414 3300031712 Bacteria 529
311 Ga0307412_11072696 3300031911 Unclassified 715
312 Ga0316596_1047164 3300033541 Unclassified 1138
313 Ga0373948_0096241 3300034817 Unclassified 692
314 Ga0373958_0031505 3300034819 Bacteria 1043
315 Ga0373938_0005398 3300034957 Bacteria 2173
316 Ga0373926_0009731 3300035083 Unclassified 3211
317 Ga0373944_0008967 3300035089 Unclassified 2705
318 Ga0373945_0064518 3300035116 Bacteria 1373
319 Ga0373954_0037526 3300035118 Unclassified 2252
320 Ga0373954_0259665 3300035118 Bacteria 855
321 Ga0373954_0357067 3300035118 Bacteria 722
322 Ga0373956_0047996 3300035119 Unclassified 1911
323 Ga0373956_0049370 3300035119 Unclassified 1887
324 Ga0373956_0398911 3300035119 Bacteria 656
325 Ga0373957_0095192 3300035120 Bacteria 1187
326 Ga0373943_0024060 3300035170 Bacteria 2838
327 Ga0373946_0029987 3300035171 Bacteria 2169
328 Ga0373955_0068029 3300035172 Unclassified 1984
329 Ga0373955_0260159 3300035172 Bacteria 1042
330 Ga0373942_0076938 3300035207 Bacteria 984
331 Ga0373961_0170359 3300035241 Bacteria 753
332 Ga0373962_0174117 3300035242 Bacteria 716
333 Ga0373924_0058822 3300035410 Bacteria 1604
334 Ga0373924_0149046 3300035410 Unclassified 1023
335 Ga0373931_0155577 3300035691 Bacteria 1336
336 Ga0373935_0034562 3300035692 Bacteria 3151
337 Ga0373927_0012646 3300035695 Bacteria 5615
338 Ga0373933_0100518 3300035724 Unclassified 1794
339 Ga0373933_0334451 3300035724 Unclassified 983
340 Ga0373933_0466936 3300035724 Bacteria 826
341 Ga0373947_1217189 3300035725 Unclassified 513
342 Ga0373937_0007459 3300036401 Bacteria 9463
343 Ga0373937_0009353 3300036401 Bacteria 8514
344 Ga0373937_0448170 3300036401 Unclassified 1226
345 Ga0373937_0616005 3300036401 Unclassified 1030
346 Ga0373937_0727095 3300036401 Unclassified 940
347 Ga0373937_1149846 3300036401 Bacteria 725
348 Ga0373937_1612469 3300036401 Unclassified 596
349 Ga0373925_0011712 3300037068 Bacteria 6342
350 Ga0373925_0219167 3300037068 Bacteria 1518
351 Ga0373925_1636909 3300037068 Unclassified 526
352 Ga0395905_0258934 3300037471 Bacteria 1624
353 Ga0395905_0650309 3300037471 Unclassified 956
354 Ga0395905_1739796 3300037471 Unclassified 529
355 Ga0395901_0803104 3300038443 Bacteria 930
356 Ga0451798_0295431 3300041458 Unclassified 708
357 Ga0451804_0698673 3300041463 Unclassified 1165
358 Ga0451807_1309338 3300041486 Unclassified 1144
359 Ga0451807_1961902 3300041486 Bacteria 594
360 Ga0451833_0032650 3300041491 Unclassified 501
361 Ga0451847_0157960 3300041503 Bacteria 503
362 Ga0451577_0023113 3300042876 Bacteria 5675
363 Ga0451577_0102652 3300042876 Unclassified 2555
364 Ga0451577_0285586 3300042876 Unclassified 1495
365 Ga0451577_0638809 3300042876 Unclassified 965
366 Ga0466966_0296830 3300044684 Bacteria 971
367 Ga0453684_0002169 3300044712 Bacteria 49058
368 Ga0453684_0248507 3300044712 Bacteria 2044
369 Ga0453684_0748526 3300044712 Unclassified 1058
370 Ga0453684_1531210 3300044712 Unclassified 687
371 Ga0453684_1535821 3300044712 Unclassified 686
372 Ga0453684_1826003 3300044712 Unclassified 617
373 Ga0451576_0157569 3300045051 Unclassified 2369
374 Ga0451576_0181156 3300045051 Unclassified 2200
375 Ga0451576_0202126 3300045051 Bacteria 2075
376 Ga0451576_0246755 3300045051 Unclassified 1866
377 Ga0451576_0273521 3300045051 Bacteria 1766
378 Ga0451576_0426008 3300045051 Bacteria 1392
379 Ga0451576_0555199 3300045051 Unclassified 1207
380 Ga0451576_0647409 3300045051 Bacteria 1110
381 Ga0451576_0692334 3300045051 Bacteria 1071
382 Ga0451576_0796550 3300045051 Bacteria 992
383 Ga0451576_0882586 3300045051 Bacteria 938
384 Ga0451576_0916204 3300045051 Unclassified 919
385 Ga0451576_1712837 3300045051 Unclassified 651
386 Ga0451576_1808713 3300045051 Unclassified 631
387 Ga0451576_2410914 3300045051 Unclassified 538
388 Ga0495592_0630625 3300046454 Bacteria 651
389 Ga0495629_0212912 3300046459 Bacteria 1334
390 Ga0495629_0223340 3300046459 Bacteria 1299
391 Ga0495629_0435243 3300046459 Unclassified 889
392 Ga0495641_0013178 3300046461 Bacteria 4564
393 Ga0495651_0815041 3300046462 Unclassified 575
394 Ga0495653_0661263 3300046463 Bacteria 637
395 Ga0495580_0463181 3300046472 Bacteria 850
396 Ga0495580_0661834 3300046472 Unclassified 686
397 Ga0495582_0133733 3300046473 Unclassified 1402
398 Ga0495662_0221628 3300046476 Unclassified 932
399 Ga0495664_0674214 3300046477 Unclassified 612
400 Ga0495608_0343718 3300046511 Unclassified 919
401 Ga0495608_0593719 3300046511 Bacteria 665
402 Ga0495608_0780672 3300046511 Unclassified 565
403 Ga0495618_0031274 3300046514 Unclassified 3329
404 Ga0495618_0669245 3300046514 Bacteria 613
405 Ga0495618_0675343 3300046514 Unclassified 609
406 Ga0495628_0394775 3300046516 Unclassified 1011
407 Ga0495628_0437097 3300046516 Unclassified 952
408 Ga0495628_0717949 3300046516 Unclassified 705
409 Ga0495628_0811443 3300046516 Bacteria 654
410 Ga0495630_0000309 3300046517 Bacteria 39171
411 Ga0495630_0069816 3300046517 Bacteria 2643
412 Ga0495630_0141098 3300046517 Bacteria 1832
413 Ga0495630_0163371 3300046517 Unclassified 1695
414 Ga0495630_0863200 3300046517 Bacteria 690
415 Ga0495630_1252475 3300046517 Bacteria 560
416 Ga0495666_0005212 3300046526 Bacteria 6563
417 Ga0495666_0022923 3300046526 Bacteria 3090
418 Ga0495652_0863743 3300046529 Unclassified 599
419 Ga0495665_0075999 3300046531 Bacteria 1768
420 Ga0495640_0062268 3300046533 Unclassified 2531
421 Ga0495640_0076871 3300046533 Bacteria 2227
422 Ga0495640_0130248 3300046533 Bacteria 1628
423 Ga0495640_0208958 3300046533 Bacteria 1235
424 Ga0495586_0000050 3300046535 Bacteria 70669
425 Ga0495586_0005090 3300046535 Bacteria 7035
426 Ga0495586_0006909 3300046535 Bacteria 6047
427 Ga0495586_0032482 3300046535 Bacteria 2798
428 Ga0495586_0192747 3300046535 Unclassified 1154
429 Ga0495598_0353828 3300046537 Unclassified 566
430 Ga0495645_0500424 3300046543 Unclassified 760
431 Ga0495667_0023119 3300046559 Unclassified 4189
432 Ga0495667_0469261 3300046559 Unclassified 790
433 Ga0495667_0510894 3300046559 Unclassified 752
434 Ga0495668_0686867 3300046616 Unclassified 566
435 Ga0495634_0062073 3300046642 Bacteria 2482
436 Ga0495634_0110891 3300046642 Bacteria 1764
437 Ga0495634_0311005 3300046642 Bacteria 950
438 Ga0495635_0129242 3300046663 Bacteria 1722
439 Ga0495635_0283180 3300046663 Unclassified 1113
440 Ga0495599_0108519 3300046678 Unclassified 1729
441 Ga0495599_0352243 3300046678 Bacteria 882
442 Ga0495646_0587225 3300046680 Unclassified 567
443 Ga0495647_0045375 3300046681 Bacteria 1688
444 Ga0495647_0183822 3300046681 Unclassified 910
445 Ga0495658_0010416 3300046683 Bacteria 4652
446 Ga0495658_0035232 3300046683 Bacteria 2752
447 Ga0495613_0005951 3300046689 Bacteria 9124
448 Ga0495613_0116811 3300046689 Bacteria 1918
449 Ga0495613_0182206 3300046689 Bacteria 1487
450 Ga0495613_0714131 3300046689 Bacteria 659
451 Ga0495624_0550920 3300046690 Bacteria 689
452 Ga0495624_0701322 3300046690 Unclassified 601
453 Ga0495600_0230359 3300046809 Unclassified 1183
454 Ga0495600_0779511 3300046809 Bacteria 571
455 Ga0495581_0151235 3300047315 Bacteria 1355
456 Ga0495581_0499545 3300047315 Unclassified 707
457 Ga0495604_0620637 3300047317 Bacteria 692
458 Ga0495636_0582576 3300047318 Unclassified 546
459 Ga0495674_0010471 3300047319 Bacteria 8779
460 Ga0495674_0019072 3300047319 Bacteria 6375
461 Ga0495674_0385162 3300047319 Unclassified 1134
462 Ga0495674_0386224 3300047319 Unclassified 1132
463 Ga0495676_0091738 3300047321 Bacteria 2269
464 Ga0495676_0180142 3300047321 Bacteria 1481
465 Ga0495676_0602970 3300047321 Unclassified 715
466 Ga0495680_0056379 3300047322 Bacteria 3042
467 Ga0495680_0539465 3300047322 Bacteria 787
468 Ga0495680_0881554 3300047322 Bacteria 579
469 Ga0495675_0086962 3300047444 Bacteria 1964
470 Ga0495675_0335828 3300047444 Unclassified 891
471 Ga0495675_0490173 3300047444 Unclassified 707
472 Ga0495675_0533121 3300047444 Unclassified 671
473 Ga0495684_0258206 3300047471 Bacteria 1265
474 Ga0495684_0328944 3300047471 Bacteria 1090
475 Ga0495593_0273831 3300047673 Bacteria 845
476 Ga0495614_0508909 3300048089 Unclassified 573
477 Ga0496112_0689572 3300048915 Bacteria 950
478 Ga0501306_015393 3300049127 Unclassified 1017
479 Ga0501305_032821 3300049161 Unclassified 816
480 Ga0501307_009299 3300049162 Unclassified 1121
481 Ga0501311_093519 3300049527 Unclassified 525
482 Ga0501312_058938 3300049528 Unclassified 662
483 Ga0501314_050799 3300049530 Unclassified 501
484 Ga0501033_0320907 3300049570 Unclassified 1088
485 Ga0501034_0155007 3300049571 Bacteria 2265
486 Ga0501034_0187546 3300049571 Bacteria 2031
487 Ga0501034_0858842 3300049571 Unclassified 797
488 Ga0501046_0307265 3300049580 Unclassified 1157
489 Ga0501047_0319263 3300049581 Unclassified 1393
490 Ga0501242_047067 3300049674 Unclassified 624
491 Ga0501257_029395 3300049686 Unclassified 1320
492 Ga0501083_0035676 3300049744 Bacteria 3396
493 Ga0501267_038996 3300049764 Unclassified 586
494 Ga0501279_076680 3300049775 Unclassified 571
495 Ga0501044_0228709 3300049823 Unclassified 1808
496 nmdc:mga09592_628237_c2 3300050508 Unclassified 611
497 nmdc:mga06r32_262000_c1 3300050510 Unclassified 1716
498 nmdc:mga08y16_186543_c1 3300050511 Bacteria 2152
499 nmdc:mga08y16_21885_c1 3300050511 Bacteria 6748
500 nmdc:mga08y16_297006_c1 3300050511 Unclassified 1665
501 nmdc:mga0n895_1016616_c1 3300050512 Bacteria 809
502 nmdc:mga0n895_112837_c1 3300050512 Unclassified 2735
503 nmdc:mga0rr50_749859_c1 3300050513 Bacteria 833
504 nmdc:mga08x19_1310214_c1 3300050514 Unclassified 513
505 nmdc:mga08x19_489182_c1 3300050514 Unclassified 868
506 nmdc:mga0a205_959094_c1 3300050515 Unclassified 702
507 Ga0495601_0020834 3300053077 Bacteria 4008
508 Ga0500650_0002738 3300053098 Bacteria 5917
509 Ga0590071_211041 3300059421 Unclassified 512
510 Ga0207681_10415813
511 rootH2_10078033
512 rootH1_10284720
513 Ga0058863_10506688
514 Ga0058863_11036164
515 Ga0065707_11035292
516 Ga0070658_11356718
517 Ga0070683_102418848
518 Ga0070690_100103079
519 Ga0070690_101194001
520 Ga0068869_101458336
521 Ga0068868_100487880
522 Ga0070660_101399316
523 Ga0070689_100013962
524 Ga0070689_100034962
525 Ga0070689_100597075
526 Ga0070689_101551889
527 Ga0070668_100281429
528 Ga0070675_100146070
529 Ga0070688_100138713
530 Ga0070688_100210106
531 Ga0070688_101723386
532 Ga0070659_102148475
533 Ga0070667_101163991
534 Ga0070713_100324022
535 Ga0070701_10236741
536 Ga0070701_10269585
537 Ga0070711_100074099
538 Ga0070711_100731193
539 Ga0070711_100861482
540 Ga0070700_100831765
541 Ga0070694_100279058
542 Ga0070708_101045983
543 Ga0070678_100762185
544 Ga0070681_10669038
545 Ga0070707_100808542
546 Ga0070697_101400015
547 Ga0070686_100052531
548 Ga0070686_100086404
549 Ga0070665_102117671
550 Ga0070665_102559153
551 Ga0070704_101168423
552 Ga0070704_101690845
553 Ga0068855_100383833
554 Ga0068855_101007109
555 Ga0068857_102124658
556 Ga0068856_100078427
557 Ga0068856_101325210
558 Ga0068856_102220559
559 Ga0070702_100306869
560 Ga0070702_101347881
561 Ga0068859_100054411
562 Ga0068859_100082799
563 Ga0068859_100091750
564 Ga0068864_100146879
565 Ga0068864_100901289
566 Ga0068864_102386748
567 Ga0068861_101466646
568 Ga0068861_101625523
569 Ga0068863_100087341
570 Ga0068863_100130965
571 Ga0068863_100261879
572 Ga0068863_100465936
573 Ga0068863_102088018
574 Ga0068858_100122398
575 Ga0068858_100733030
576 Ga0068858_100806699
577 Ga0068858_100811014
578 Ga0068858_101335163
579 Ga0068860_101076206
580 Ga0081455_10073748
581 Ga0081455_10303862
582 Ga0070716_100929180
583 Ga0097621_100262113
584 Ga0097621_100358186
585 Ga0097621_100943349
586 Ga0068871_100043629
587 Ga0068871_100730932
588 Ga0075428_101114561
589 Ga0075431_100052238
590 Ga0075431_101343522
591 Ga0075434_100047744
592 Ga0075434_101718057
593 Ga0075434_102166761
594 Ga0068865_100122626
595 Ga0068865_102138319
596 Ga0075436_100366361
597 Ga0075436_101485829
598 Ga0097620_100054412
599 Ga0097620_100082802
600 Ga0097620_100091751
601 Ga0097620_100363154
602 Ga0075435_101555938
603 Ga0099794_10659579
604 Ga0105250_10391727
605 Ga0105240_10006286
606 Ga0105240_10379767
607 Ga0111539_10014480
608 Ga0111539_10146975
609 Ga0111539_10194630
610 Ga0111539_11064901
611 Ga0111539_12503272
612 Ga0105245_11770428
613 Ga0105241_10848324
614 Ga0105242_13042246
615 Ga0105248_10375790
616 Ga0105248_11203585
617 Ga0105248_12521602
618 Ga0105238_10003252
619 Ga0105238_10328298
620 Ga0105238_10657445
621 Ga0105249_13489213
622 Ga0105239_11582421
623 Ga0105246_11187581
624 Ga0157371_10083150
625 Ga0157370_11364175
626 Ga0157374_10655133
627 Ga0157374_10739342
628 Ga0157374_11212005
629 Ga0157374_11908815
630 Ga0157378_10321688
631 Ga0157378_10515823
632 Ga0157378_11353905
633 Ga0163162_10789364
634 Ga0163162_12293373
635 Ga0157372_10261309
636 Ga0157372_10707563
637 Ga0157372_12641303
638 Ga0157375_10069987
639 Ga0157375_11585792
640 Ga0163163_10038999
641 Ga0163163_10072386
642 Ga0157377_11675321
643 Ga0157376_10343618
644 Ga0157376_11667410
645 Ga0182007_10371618
646 Ga0206356_10931428
647 Ga0207653_10163051
648 Ga0207695_10042071
649 Ga0207695_10282618
650 Ga0207695_10746039
651 Ga0207695_10785229
652 Ga0207663_10061903
653 Ga0207663_11362251
654 Ga0207663_11419874
655 Ga0207646_10613706
656 Ga0207681_11836693
657 Ga0207694_10011188
658 Ga0207694_10433070
659 Ga0207694_11142098
660 Ga0207659_10393009
661 Ga0207659_11543243
662 Ga0207700_10431465
663 Ga0207700_11851537
664 Ga0207690_11864557
665 Ga0207686_10526383
666 Ga0207670_10004396
667 Ga0207670_10009706
668 Ga0207670_10143462
669 Ga0207704_10098906
670 Ga0207704_11673606
671 Ga0207711_10478539
672 Ga0207689_10705218
673 Ga0207661_10269660
674 Ga0207667_10161631
675 Ga0207667_10894638
676 Ga0207651_10813074
677 Ga0207677_10343524
678 Ga0207703_10223478
679 Ga0207703_10575199
680 Ga0207703_11620460
681 Ga0207708_10384956
682 Ga0207708_10650999
683 Ga0207702_11100892
684 Ga0207702_11394997
685 Ga0207641_10133228
686 Ga0207641_10330123
687 Ga0207641_10461189
688 Ga0207641_10637236
689 Ga0207641_10791525
690 Ga0207676_12357556
691 Ga0207674_11487453
692 Ga0207675_102067395
693 Ga0207428_10329422
694 Ga0268266_10510792
695 Ga0268264_11414169
696 Ga0265337_1000019
697 Ga0265337_1001311
698 Ga0265337_1002078
699 Ga0265337_1008953
700 Ga0265337_1009934
701 Ga0265337_1029630
702 Ga0265337_1037600
703 Ga0265337_1050572
704 Ga0265326_10004954
705 Ga0265326_10039182
706 Ga0265319_1000019
707 Ga0265319_1005132
708 Ga0265319_1226213
709 Ga0265334_10129540
710 Ga0265334_10178774
711 Ga0265318_10100002
712 Ga0265318_10300600
713 Ga0265323_10023002
714 Ga0265323_10043821
715 Ga0265323_10172206
716 Ga0265323_10183523
717 Ga0265323_10218818
718 Ga0265323_10262764
719 Ga0265322_10027131
720 Ga0265322_10070601
721 Ga0265336_10003147
722 Ga0265336_10029294
723 Ga0265336_10063315
724 Ga0265338_10000016
725 Ga0265338_10000036
726 Ga0265338_10000145
727 Ga0265338_10000214
728 Ga0265338_10000276
729 Ga0265338_10001186
730 Ga0265338_10001578
731 Ga0265338_10002314
732 Ga0265338_10009538
733 Ga0265338_10011463
734 Ga0265338_10017479
735 Ga0265338_10035880
736 Ga0265338_10040849
737 Ga0265338_10046320
738 Ga0265338_10075728
739 Ga0265338_10087685
740 Ga0265338_10096683
741 Ga0265338_10117039
742 Ga0265338_10144880
743 Ga0265338_10188790
744 Ga0265338_10556105
745 Ga0265338_10593767
746 Ga0265338_11199594
747 Ga0265324_10001693
748 Ga0265324_10006387
749 Ga0265324_10011711
750 Ga0265324_10030054
751 Ga0265324_10049164
752 Ga0265324_10068051
753 Ga0265324_10071285
754 Ga0265324_10265832
755 Ga0265330_10072225
756 Ga0265330_10124512
757 Ga0265330_10154031
758 Ga0265332_10051666
759 Ga0265332_10185356
760 Ga0265332_10230636
761 Ga0265332_10319684
762 Ga0265328_10016230
763 Ga0265328_10100832
764 Ga0265320_10000536
765 Ga0265320_10003039
766 Ga0265320_10008245
767 Ga0265320_10011918
768 Ga0265320_10036788
769 Ga0265320_10072481
770 Ga0265320_10191935
771 Ga0265320_10248463
772 Ga0265320_10364202
773 Ga0265320_10383240
774 Ga0265320_10388470
775 Ga0265325_10017236
776 Ga0265325_10020886
777 Ga0265325_10082163
778 Ga0265325_10433095
779 Ga0265329_10005622
780 Ga0265340_10014990
781 Ga0265340_10023583
782 Ga0265340_10032889
783 Ga0265340_10137631
784 Ga0265340_10197176
785 Ga0265339_10007758
786 Ga0265339_10020223
787 Ga0265339_10132349
788 Ga0265339_10219044
789 Ga0265339_10220448
790 Ga0265339_10260989
791 Ga0265339_10297831
792 Ga0265339_10451815
793 Ga0265339_10505439
794 Ga0265331_10065177
795 Ga0265331_10282163
796 Ga0265327_10002194
797 Ga0265316_10000812
798 Ga0265316_10013762
799 Ga0265316_10032642
800 Ga0265316_10064382
801 Ga0265316_10097968
802 Ga0265316_10099765
803 Ga0265316_10191613
804 Ga0265316_10228770
805 Ga0265316_10669111
806 Ga0265316_10716844
807 Ga0265316_10853267
808 Ga0307408_101649734
809 Ga0265313_10001645
810 Ga0265313_10004745
811 Ga0265314_10001100
812 Ga0265314_10066550
813 Ga0265314_10086692
814 Ga0265314_10099832
815 Ga0265314_10341282
816 Ga0265342_10018887
817 Ga0265342_10079647
818 Ga0265342_10536497
819 Ga0265342_10651414
820 Ga0307412_11072696
821 Ga0316596_1047164
822 Ga0373948_0096241
823 Ga0373958_0031505
824 Ga0373938_0005398
825 Ga0373926_0009731
826 Ga0373944_0008967
827 Ga0373945_0064518
828 Ga0373954_0037526
829 Ga0373954_0259665
830 Ga0373954_0357067
831 Ga0373956_0047996
832 Ga0373956_0049370
833 Ga0373956_0398911
834 Ga0373957_0095192
835 Ga0373943_0024060
836 Ga0373946_0029987
837 Ga0373955_0068029
838 Ga0373955_0260159
839 Ga0373942_0076938
840 Ga0373961_0170359
841 Ga0373962_0174117
842 Ga0373924_0058822
843 Ga0373924_0149046
844 Ga0373931_0155577
845 Ga0373935_0034562
846 Ga0373927_0012646
847 Ga0373933_0100518
848 Ga0373933_0334451
849 Ga0373933_0466936
850 Ga0373947_1217189
851 Ga0373937_0007459
852 Ga0373937_0009353
853 Ga0373937_0448170
854 Ga0373937_0616005
855 Ga0373937_0727095
856 Ga0373937_1149846
857 Ga0373937_1612469
858 Ga0373925_0011712
859 Ga0373925_0219167
860 Ga0373925_1636909
861 Ga0395905_0258934
862 Ga0395905_0650309
863 Ga0395905_1739796
864 Ga0395901_0803104
865 Ga0451798_0295431
866 Ga0451804_0698673
867 Ga0451807_1309338
868 Ga0451807_1961902
869 Ga0451833_0032650
870 Ga0451847_0157960
871 Ga0451577_0023113
872 Ga0451577_0102652
873 Ga0451577_0285586
874 Ga0451577_0638809
875 Ga0466966_0296830
876 Ga0453684_0002169
877 Ga0453684_0248507
878 Ga0453684_0748526
879 Ga0453684_1531210
880 Ga0453684_1535821
881 Ga0453684_1826003
882 Ga0451576_0157569
883 Ga0451576_0181156
884 Ga0451576_0202126
885 Ga0451576_0246755
886 Ga0451576_0273521
887 Ga0451576_0426008
888 Ga0451576_0555199
889 Ga0451576_0647409
890 Ga0451576_0692334
891 Ga0451576_0796550
892 Ga0451576_0882586
893 Ga0451576_0916204
894 Ga0451576_1712837
895 Ga0451576_1808713
896 Ga0451576_2410914
897 Ga0495592_0630625
898 Ga0495629_0212912
899 Ga0495629_0223340
900 Ga0495629_0435243
901 Ga0495641_0013178
902 Ga0495651_0815041
903 Ga0495653_0661263
904 Ga0495580_0463181
905 Ga0495580_0661834
906 Ga0495582_0133733
907 Ga0495662_0221628
908 Ga0495664_0674214
909 Ga0495608_0343718
910 Ga0495608_0593719
911 Ga0495608_0780672
912 Ga0495618_0031274
913 Ga0495618_0669245
914 Ga0495618_0675343
915 Ga0495628_0394775
916 Ga0495628_0437097
917 Ga0495628_0717949
918 Ga0495628_0811443
919 Ga0495630_0000309
920 Ga0495630_0069816
921 Ga0495630_0141098
922 Ga0495630_0163371
923 Ga0495630_0863200
924 Ga0495630_1252475
925 Ga0495666_0005212
926 Ga0495666_0022923
927 Ga0495652_0863743
928 Ga0495665_0075999
929 Ga0495640_0062268
930 Ga0495640_0076871
931 Ga0495640_0130248
932 Ga0495640_0208958
933 Ga0495586_0000050
934 Ga0495586_0005090
935 Ga0495586_0006909
936 Ga0495586_0032482
937 Ga0495586_0192747
938 Ga0495598_0353828
939 Ga0495645_0500424
940 Ga0495667_0023119
941 Ga0495667_0469261
942 Ga0495667_0510894
943 Ga0495668_0686867
944 Ga0495634_0062073
945 Ga0495634_0110891
946 Ga0495634_0311005
947 Ga0495635_0129242
948 Ga0495635_0283180
949 Ga0495599_0108519
950 Ga0495599_0352243
951 Ga0495646_0587225
952 Ga0495647_0045375
953 Ga0495647_0183822
954 Ga0495658_0010416
955 Ga0495658_0035232
956 Ga0495613_0005951
957 Ga0495613_0116811
958 Ga0495613_0182206
959 Ga0495613_0714131
960 Ga0495624_0550920
961 Ga0495624_0701322
962 Ga0495600_0230359
963 Ga0495600_0779511
964 Ga0495581_0151235
965 Ga0495581_0499545
966 Ga0495604_0620637
967 Ga0495636_0582576
968 Ga0495674_0010471
969 Ga0495674_0019072
970 Ga0495674_0385162
971 Ga0495674_0386224
972 Ga0495676_0091738
973 Ga0495676_0180142
974 Ga0495676_0602970
975 Ga0495680_0056379
976 Ga0495680_0539465
977 Ga0495680_0881554
978 Ga0495675_0086962
979 Ga0495675_0335828
980 Ga0495675_0490173
981 Ga0495675_0533121
982 Ga0495684_0258206
983 Ga0495684_0328944
984 Ga0495593_0273831
985 Ga0495614_0508909
986 Ga0496112_0689572
987 Ga0501306_015393
988 Ga0501305_032821
989 Ga0501307_009299
990 Ga0501311_093519
991 Ga0501312_058938
992 Ga0501314_050799
993 Ga0501033_0320907
994 Ga0501034_0155007
995 Ga0501034_0187546
996 Ga0501034_0858842
997 Ga0501046_0307265
998 Ga0501047_0319263
999 Ga0501242_047067
1000 Ga0501257_029395
1001 Ga0501083_0035676
1002 Ga0501267_038996
1003 Ga0501279_076680
1004 Ga0501044_0228709
1005 nmdc:mga09592_628237_c2
1006 nmdc:mga06r32_262000_c1
1007 nmdc:mga08y16_186543_c1
1008 nmdc:mga08y16_21885_c1
1009 nmdc:mga08y16_297006_c1
1010 nmdc:mga0n895_1016616_c1
1011 nmdc:mga0n895_112837_c1
1012 nmdc:mga0rr50_749859_c1
1013 nmdc:mga08x19_1310214_c1
1014 nmdc:mga08x19_489182_c1
1015 nmdc:mga0a205_959094_c1
1016 Ga0495601_0020834
1017 Ga0500650_0002738
1018 Ga0590071_211041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01084

Ribosomal_S18

Ribosomal protein S18

51

102

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdu-assembly1.cif.gz_U rnase r bound to a 30s degradation intermediate (main state) 0.9892 37 80
5o61-assembly1.cif.gz_BR the complete structure of the mycobacterium smegmatis 70s ribosome 0.9821 36 80
7p48-assembly1.cif.gz_r staphylococcus aureus ribosome in complex with sal(b) 0.9708 37 80
5xyu-assembly1.cif.gz_R small subunit of mycobacterium smegmatis ribosome 0.9703 37 80
7nhn-assembly1.cif.gz_s vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9696 37 82
ID Description Score Start End Superfamily
5xyuR00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9703 37 80 4.10.640.10
5mmjr00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9684 37 82 4.10.640.10
5o5jR00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9658 37 82 4.10.640.10
4tp2R00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9539 37 82 4.10.640.10
2qalR00 Few Secondary Structures;Irregular;30s Ribosomal Protein S18;Ribosomal protein S18 0.9523 36 82 4.10.640.10
ID Description Score Start End GO Terms
AF-Q2N9S6-F1-model_v4 Small ribosomal subunit protein bS18 (30S ribosomal protein S18) 0.9978 36 80 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A386AXS8-F1-model_v4 Small ribosomal subunit protein bS18c 0.9966 33 80 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:0070181
GO:1990904
AF-A0A2H0SKE2-F1-model_v4 Small ribosomal subunit protein bS18 0.9862 37 82 GO:0003735
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A525PQ58-F1-model_v4 Small ribosomal subunit protein bS18 0.985 35 79 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A0D6E1F4-F1-model_v4 Small ribosomal subunit protein bS18c 0.984 30 80 GO:0003735
GO:0005763
GO:0006412
GO:0009507
GO:0070181

Map