F456974

General Info

Members Datasets Scaffolds Average Seq Length
509 217 1018 159

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11642764|Ga0105243_116427641
Length 182
Sequence MFCRYRPLQSVRSEIFEIDMKEIIMKRFVAVRTLILVFALLFGIIPVGASERPYAASGNGLATFITDGAGNVVGATVVVTGNAAHLGSFTGNGEIQFLPDANDPMISHPAGWVTYIAANGDRLPTVIEDGSMDLRTGIATGYMVFQSGTGRFEGASGKAAIVVEQNFITGAYTFTMVGNVNY

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
175 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
176 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
177 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
181 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
184 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
185 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
186 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
190 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
194 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
195 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
198 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
199 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
202 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
203 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
206 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
207 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
208 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
209 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
210 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
211 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.96
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 40.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_11642764 3300009148 Unclassified 670
2 SwRhRL2b_contig_1006212 2162886007 Bacteria 6500
3 CNAas_1001175 3300000532 Bacteria 2369
4 JGI24736J21556_1011861 3300001904 Unclassified 1414
5 JGI24751J29686_10000074 3300002459 Bacteria 56035
6 JGI25406J46586_10004917 3300003203 Bacteria 6206
7 rootL2_10218619 3300003322 Unclassified 1253
8 Ga0065714_10002193 3300005288 Bacteria 121714
9 Ga0065714_10014649 3300005288 Bacteria 2510
10 Ga0065714_10120641 3300005288 Unclassified 1352
11 Ga0065704_10002114 3300005289 Bacteria 7498
12 Ga0065712_10000128 3300005290 Bacteria 121732
13 Ga0065712_10001471 3300005290 Bacteria 8107
14 Ga0065712_10011898 3300005290 Bacteria 3865
15 Ga0065712_10084665 3300005290 Bacteria 2748
16 Ga0065712_10356621 3300005290 Bacteria 777
17 Ga0065715_10014944 3300005293 Bacteria 2787
18 Ga0065715_10089982 3300005293 Bacteria 7969
19 Ga0065715_10097442 3300005293 Unclassified 3704
20 Ga0065715_10113758 3300005293 Bacteria 2422
21 Ga0065715_10476883 3300005293 Unclassified 801
22 Ga0065707_10005756 3300005295 Unclassified 3849
23 Ga0065707_10131385 3300005295 Bacteria 1914
24 Ga0070676_10168373 3300005328 Unclassified 1415
25 Ga0070670_100002663 3300005331 Bacteria 14746
26 Ga0070670_100067678 3300005331 Unclassified 3064
27 Ga0070670_100567022 3300005331 Unclassified 1014
28 Ga0068869_100173240 3300005334 Bacteria 1687
29 Ga0068869_100300139 3300005334 Bacteria 1297
30 Ga0068869_100511352 3300005334 Unclassified 1004
31 Ga0068869_100775041 3300005334 Unclassified 823
32 Ga0070666_10722318 3300005335 Unclassified 731
33 Ga0070680_100387009 3300005336 Unclassified 1191
34 Ga0070680_101025197 3300005336 Unclassified 713
35 Ga0070682_100003450 3300005337 Bacteria 8749
36 Ga0070660_100656116 3300005339 Bacteria 879
37 Ga0070689_100000760 3300005340 Bacteria 19714
38 Ga0070691_10415832 3300005341 Unclassified 761
39 Ga0070692_10036568 3300005345 Bacteria 2492
40 Ga0070692_10045039 3300005345 Bacteria 2274
41 Ga0070692_10118586 3300005345 Unclassified 1473
42 Ga0070669_100112395 3300005353 Bacteria 2068
43 Ga0070669_101456281 3300005353 Unclassified 595
44 Ga0070675_100074797 3300005354 Bacteria 2815
45 Ga0070675_101328443 3300005354 Unclassified 663
46 Ga0070673_100180448 3300005364 Bacteria 1807
47 Ga0070673_100313779 3300005364 Bacteria 1383
48 Ga0070673_100849046 3300005364 Unclassified 845
49 Ga0070673_101553508 3300005364 Unclassified 625
50 Ga0070659_101066832 3300005366 Unclassified 711
51 Ga0070703_10001715 3300005406 Bacteria 6503
52 Ga0070701_10006211 3300005438 Bacteria 5011
53 Ga0070701_10196933 3300005438 Bacteria 1188
54 Ga0070701_10210271 3300005438 Bacteria 1155
55 Ga0070701_10322997 3300005438 Unclassified 955
56 Ga0070705_100150514 3300005440 Unclassified 1543
57 Ga0070705_100687649 3300005440 Unclassified 802
58 Ga0070700_100001145 3300005441 Bacteria 13104
59 Ga0070700_100021914 3300005441 Bacteria 3719
60 Ga0070700_100024182 3300005441 Unclassified 3563
61 Ga0070700_100077632 3300005441 Bacteria 2136
62 Ga0070700_101039265 3300005441 Unclassified 676
63 Ga0070694_100005266 3300005444 Bacteria 7819
64 Ga0070694_100060749 3300005444 Bacteria 2578
65 Ga0070694_100090769 3300005444 Bacteria 2143
66 Ga0070694_100385541 3300005444 Bacteria 1094
67 Ga0070694_100843661 3300005444 Unclassified 753
68 Ga0070694_101636801 3300005444 Unclassified 547
69 Ga0070662_101071969 3300005457 Unclassified 691
70 Ga0068867_100033288 3300005459 Bacteria 3731
71 Ga0068867_100164514 3300005459 Bacteria 1752
72 Ga0068867_100258557 3300005459 Unclassified 1419
73 Ga0068867_100654781 3300005459 Bacteria 922
74 Ga0070706_100000075 3300005467 Bacteria 114725
75 Ga0070707_100021645 3300005468 Bacteria 6078
76 Ga0070698_100192229 3300005471 Bacteria 1978
77 Ga0070699_100015592 3300005518 Bacteria 6528
78 Ga0070699_100053204 3300005518 Bacteria 3504
79 Ga0070699_100187591 3300005518 Unclassified 1836
80 Ga0070679_100017739 3300005530 Bacteria 6891
81 Ga0070697_100148970 3300005536 Bacteria 1972
82 Ga0068853_100141185 3300005539 Bacteria 2162
83 Ga0070686_100059255 3300005544 Unclassified 2466
84 Ga0070695_100012398 3300005545 Bacteria 5113
85 Ga0070695_100038651 3300005545 Bacteria 3013
86 Ga0070695_100105206 3300005545 Bacteria 1907
87 Ga0070695_101154221 3300005545 Unclassified 636
88 Ga0070696_100011443 3300005546 Bacteria 5944
89 Ga0070696_100114610 3300005546 Bacteria 1944
90 Ga0070696_101076650 3300005546 Unclassified 675
91 Ga0070696_101788585 3300005546 Unclassified 531
92 Ga0070693_100001138 3300005547 Bacteria 11928
93 Ga0070693_100066085 3300005547 Bacteria 2116
94 Ga0070693_100299676 3300005547 Unclassified 1083
95 Ga0070704_100092937 3300005549 Bacteria 2253
96 Ga0070704_100151246 3300005549 Unclassified 1825
97 Ga0070704_100238238 3300005549 Bacteria 1488
98 Ga0068855_100395793 3300005563 Bacteria 1515
99 Ga0070664_100035190 3300005564 Unclassified 4204
100 Ga0070664_100295435 3300005564 Unclassified 1463
101 Ga0070664_100706059 3300005564 Bacteria 940
102 Ga0068857_100051705 3300005577 Bacteria 3646
103 Ga0068857_100128810 3300005577 Bacteria 2282
104 Ga0068857_100139510 3300005577 Bacteria 2191
105 Ga0068854_100291184 3300005578 Bacteria 1318
106 Ga0068854_100336453 3300005578 Unclassified 1232
107 Ga0068854_101219629 3300005578 Bacteria 675
108 Ga0070702_100026238 3300005615 Bacteria 3128
109 Ga0070702_100057028 3300005615 Bacteria 2258
110 Ga0070702_100087408 3300005615 Bacteria 1882
111 Ga0070702_100287972 3300005615 Unclassified 1131
112 Ga0068852_100237945 3300005616 Unclassified 1738
113 Ga0068852_100240724 3300005616 Bacteria 1729
114 Ga0068852_100495539 3300005616 Unclassified 1216
115 Ga0068852_101554243 3300005616 Unclassified 684
116 Ga0068859_100003036 3300005617 Bacteria 17022
117 Ga0068859_100011746 3300005617 Bacteria 8797
118 Ga0068859_100024957 3300005617 Bacteria 6000
119 Ga0068859_100061174 3300005617 Bacteria 3794
120 Ga0068859_100086786 3300005617 Bacteria 3176
121 Ga0068859_100107226 3300005617 Bacteria 2853
122 Ga0068859_100107411 3300005617 Unclassified 2851
123 Ga0068859_100145392 3300005617 Bacteria 2446
124 Ga0068859_100373668 3300005617 Unclassified 1521
125 Ga0068859_100504349 3300005617 Unclassified 1305
126 Ga0068859_100561011 3300005617 Bacteria 1236
127 Ga0068864_100004579 3300005618 Bacteria 11351
128 Ga0068864_100113926 3300005618 Unclassified 2411
129 Ga0068864_100159550 3300005618 Bacteria 2049
130 Ga0068864_100564098 3300005618 Bacteria 1102
131 Ga0068864_100589801 3300005618 Unclassified 1077
132 Ga0068864_100674836 3300005618 Unclassified 1008
133 Ga0068864_100896431 3300005618 Unclassified 876
134 Ga0068866_10631786 3300005718 Unclassified 727
135 Ga0068861_100042913 3300005719 Bacteria 3392
136 Ga0068861_100068334 3300005719 Unclassified 2745
137 Ga0068861_100313312 3300005719 Bacteria 1364
138 Ga0068861_100682101 3300005719 Unclassified 953
139 Ga0068851_10001596 3300005834 Bacteria 9952
140 Ga0068870_10007037 3300005840 Unclassified 4995
141 Ga0068870_10231127 3300005840 Bacteria 1137
142 Ga0068870_10523430 3300005840 Bacteria 794
143 Ga0068870_10802918 3300005840 Unclassified 658
144 Ga0068863_100031547 3300005841 Bacteria 5056
145 Ga0068863_100143179 3300005841 Unclassified 2286
146 Ga0068863_101770272 3300005841 Unclassified 627
147 Ga0068858_100018377 3300005842 Bacteria 6546
148 Ga0068858_100068435 3300005842 Bacteria 3290
149 Ga0068858_100389984 3300005842 Bacteria 1337
150 Ga0068858_100416508 3300005842 Bacteria 1292
151 Ga0068858_100620695 3300005842 Unclassified 1049
152 Ga0068858_100786828 3300005842 Bacteria 928
153 Ga0068860_100009907 3300005843 Bacteria 9449
154 Ga0068860_100386959 3300005843 Bacteria 1381
155 Ga0068860_100410489 3300005843 Bacteria 1341
156 Ga0068860_100412607 3300005843 Unclassified 1337
157 Ga0068860_101406916 3300005843 Unclassified 719
158 Ga0068862_100053911 3300005844 Bacteria 3443
159 Ga0068862_100151485 3300005844 Bacteria 2064
160 Ga0068862_100993523 3300005844 Unclassified 830
161 Ga0081539_10001281 3300005985 Bacteria 44259
162 Ga0081539_10024358 3300005985 Bacteria 3930
163 Ga0081539_10062455 3300005985 Bacteria 2036
164 Ga0075432_10043516 3300006058 Bacteria 1573
165 Ga0075432_10331340 3300006058 Unclassified 640
166 Ga0070715_10925054 3300006163 Bacteria 538
167 Ga0097621_100001147 3300006237 Bacteria 18389
168 Ga0097621_100022067 3300006237 Bacteria 4937
169 Ga0068871_100016425 3300006358 Bacteria 5574
170 Ga0068871_101259899 3300006358 Unclassified 695
171 Ga0075428_100003072 3300006844 Bacteria 18208
172 Ga0075428_100340855 3300006844 Unclassified 1609
173 Ga0075431_100405643 3300006847 Bacteria 1364
174 Ga0075433_10012548 3300006852 Bacteria 6849
175 Ga0075433_10038838 3300006852 Bacteria 4113
176 Ga0075433_10067946 3300006852 Bacteria 3128
177 Ga0075434_100079549 3300006871 Bacteria 3274
178 Ga0075434_100233344 3300006871 Bacteria 1859
179 Ga0075429_100603725 3300006880 Bacteria 961
180 Ga0075429_100740269 3300006880 Unclassified 861
181 Ga0068865_100496305 3300006881 Unclassified 1017
182 Ga0068865_101185148 3300006881 Unclassified 676
183 Ga0097620_100003036 3300006931 Bacteria 17022
184 Ga0097620_100011746 3300006931 Bacteria 8797
185 Ga0097620_100024957 3300006931 Bacteria 6000
186 Ga0097620_100061175 3300006931 Bacteria 3794
187 Ga0097620_100086785 3300006931 Bacteria 3176
188 Ga0097620_100107225 3300006931 Bacteria 2853
189 Ga0097620_100107410 3300006931 Unclassified 2851
190 Ga0097620_100145388 3300006931 Bacteria 2446
191 Ga0097620_100373718 3300006931 Unclassified 1521
192 Ga0097620_100504402 3300006931 Unclassified 1305
193 Ga0097620_100560992 3300006931 Bacteria 1236
194 Ga0075435_100546593 3300007076 Bacteria 1003
195 Ga0105240_10238362 3300009093 Bacteria 2110
196 Ga0105240_10513241 3300009093 Unclassified 1331
197 Ga0111539_10017002 3300009094 Bacteria 9002
198 Ga0105245_10833164 3300009098 Unclassified 962
199 Ga0105245_12156595 3300009098 Unclassified 611
200 Ga0105247_10000155 3300009101 Bacteria 67215
201 Ga0105247_10062174 3300009101 Bacteria 2316
202 Ga0105247_10185526 3300009101 Bacteria 1390
203 Ga0105247_10215129 3300009101 Bacteria 1298
204 Ga0105247_10285043 3300009101 Unclassified 1141
205 Ga0105247_10429307 3300009101 Unclassified 948
206 Ga0114129_10027412 3300009147 Bacteria 8065
207 Ga0114129_10105541 3300009147 Bacteria 3893
208 Ga0114129_11618135 3300009147 Bacteria 792
209 Ga0105243_10002314 3300009148 Bacteria 15954
210 Ga0105243_10163842 3300009148 Bacteria 1919
211 Ga0105243_10196374 3300009148 Unclassified 1766
212 Ga0105243_10274443 3300009148 Bacteria 1516
213 Ga0105243_10338851 3300009148 Unclassified 1377
214 Ga0105243_11270249 3300009148 Unclassified 752
215 Ga0105241_10144682 3300009174 Bacteria 1939
216 Ga0105241_10205734 3300009174 Bacteria 1647
217 Ga0105241_10256385 3300009174 Bacteria 1485
218 Ga0105241_10347490 3300009174 Bacteria 1287
219 Ga0105241_10351793 3300009174 Unclassified 1279
220 Ga0105241_10757144 3300009174 Unclassified 891
221 Ga0105242_10215798 3300009176 Bacteria 1712
222 Ga0105242_10309169 3300009176 Unclassified 1445
223 Ga0105242_10917870 3300009176 Bacteria 877
224 Ga0105248_10003539 3300009177 Bacteria 17310
225 Ga0105248_10007816 3300009177 Bacteria 11741
226 Ga0105248_10041585 3300009177 Bacteria 5153
227 Ga0105248_10164356 3300009177 Bacteria 2502
228 Ga0105248_10408880 3300009177 Unclassified 1528
229 Ga0105248_10720376 3300009177 Bacteria 1126
230 Ga0105248_11436574 3300009177 Unclassified 781
231 Ga0105237_10002068 3300009545 Bacteria 25449
232 Ga0105238_10000706 3300009551 Bacteria 34901
233 Ga0105238_10055885 3300009551 Bacteria 3961
234 Ga0105238_11326784 3300009551 Unclassified 746
235 Ga0105238_11392672 3300009551 Bacteria 728
236 Ga0105249_10090728 3300009553 Bacteria 2857
237 Ga0105249_10147982 3300009553 Bacteria 2258
238 Ga0105249_11676609 3300009553 Bacteria 708
239 Ga0105239_10458480 3300010375 Bacteria 1447
240 Ga0105239_10479603 3300010375 Unclassified 1413
241 Ga0105239_10666913 3300010375 Bacteria 1188
242 Ga0105239_10762117 3300010375 Unclassified 1108
243 Ga0105246_10003052 3300011119 Bacteria 10162
244 Ga0105246_12128661 3300011119 Bacteria 544
245 Ga0157373_10098531 3300013100 Unclassified 2057
246 Ga0157373_10546321 3300013100 Bacteria 840
247 Ga0157373_10717594 3300013100 Unclassified 733
248 Ga0157373_11250462 3300013100 Unclassified 561
249 Ga0157371_10489322 3300013102 Unclassified 908
250 Ga0157374_10247783 3300013296 Bacteria 1753
251 Ga0157374_11056953 3300013296 Unclassified 832
252 Ga0157378_10106928 3300013297 Unclassified 2560
253 Ga0163162_10105996 3300013306 Bacteria 2906
254 Ga0163162_10141402 3300013306 Bacteria 2520
255 Ga0163162_10196637 3300013306 Bacteria 2145
256 Ga0163162_10273454 3300013306 Unclassified 1821
257 Ga0163162_10464091 3300013306 Unclassified 1398
258 Ga0163162_10864610 3300013306 Bacteria 1019
259 Ga0157372_10080476 3300013307 Bacteria 3686
260 Ga0157372_10652097 3300013307 Bacteria 1226
261 Ga0157375_10004439 3300013308 Bacteria 12185
262 Ga0157375_10092152 3300013308 Bacteria 3093
263 Ga0157375_10424231 3300013308 Unclassified 1496
264 Ga0157375_11283900 3300013308 Bacteria 860
265 Ga0157375_11663629 3300013308 Unclassified 755
266 Ga0163163_10001953 3300014325 Bacteria 17436
267 Ga0163163_10038193 3300014325 Bacteria 4677
268 Ga0163163_10067870 3300014325 Bacteria 3547
269 Ga0163163_10086348 3300014325 Bacteria 3147
270 Ga0163163_10488460 3300014325 Bacteria 1293
271 Ga0163163_10527011 3300014325 Unclassified 1244
272 Ga0157380_10023316 3300014326 Unclassified 4668
273 Ga0157380_10033420 3300014326 Unclassified 3960
274 Ga0157380_10624424 3300014326 Unclassified 1070
275 Ga0157380_10669375 3300014326 Unclassified 1038
276 Ga0157377_10088612 3300014745 Bacteria 1823
277 Ga0157377_10224667 3300014745 Bacteria 1204
278 Ga0157377_10678769 3300014745 Unclassified 745
279 Ga0157379_10046605 3300014968 Bacteria 3867
280 Ga0163161_10735538 3300017792 Unclassified 824
281 Ga0207697_10074800 3300025315 Unclassified 1423
282 Ga0207656_10004028 3300025321 Bacteria 5097
283 Ga0207653_10001567 3300025885 Bacteria 7390
284 Ga0207653_10048160 3300025885 Unclassified 1413
285 Ga0207642_10184790 3300025899 Bacteria 1139
286 Ga0207710_10119747 3300025900 Bacteria 1256
287 Ga0207710_10213633 3300025900 Unclassified 956
288 Ga0207688_10164495 3300025901 Unclassified 1317
289 Ga0207647_10041552 3300025904 Unclassified 2890
290 Ga0207647_10109652 3300025904 Bacteria 1632
291 Ga0207647_10301604 3300025904 Unclassified 912
292 Ga0207645_10116932 3300025907 Bacteria 1729
293 Ga0207645_10912963 3300025907 Unclassified 596
294 Ga0207643_10002727 3300025908 Bacteria 9551
295 Ga0207643_10010313 3300025908 Bacteria 5029
296 Ga0207643_10086077 3300025908 Unclassified 1826
297 Ga0207643_10121951 3300025908 Unclassified 1545
298 Ga0207643_10458800 3300025908 Bacteria 811
299 Ga0207684_10000093 3300025910 Bacteria 166136
300 Ga0207654_10357434 3300025911 Bacteria 1007
301 Ga0207707_10313839 3300025912 Bacteria 1354
302 Ga0207695_10053898 3300025913 Bacteria 4203
303 Ga0207671_10001847 3300025914 Bacteria 23644
304 Ga0207671_10579229 3300025914 Unclassified 895
305 Ga0207660_11164016 3300025917 Bacteria 628
306 Ga0207662_10011845 3300025918 Bacteria 4848
307 Ga0207662_10140053 3300025918 Bacteria 1532
308 Ga0207652_10103400 3300025921 Bacteria 2518
309 Ga0207646_10102679 3300025922 Bacteria 2564
310 Ga0207681_10440847 3300025923 Unclassified 1058
311 Ga0207681_11054331 3300025923 Unclassified 682
312 Ga0207681_11493233 3300025923 Bacteria 567
313 Ga0207694_10009023 3300025924 Bacteria 7526
314 Ga0207694_11325107 3300025924 Unclassified 609
315 Ga0207650_10000028 3300025925 Bacteria 236867
316 Ga0207650_10150452 3300025925 Bacteria 1836
317 Ga0207650_10564100 3300025925 Bacteria 955
318 Ga0207650_10788211 3300025925 Bacteria 805
319 Ga0207690_10742323 3300025932 Unclassified 809
320 Ga0207706_10708343 3300025933 Unclassified 860
321 Ga0207686_10142808 3300025934 Bacteria 1657
322 Ga0207686_10488872 3300025934 Unclassified 953
323 Ga0207686_10601481 3300025934 Bacteria 865
324 Ga0207686_10732362 3300025934 Unclassified 788
325 Ga0207709_10012715 3300025935 Unclassified 4639
326 Ga0207709_10480765 3300025935 Unclassified 966
327 Ga0207709_11561120 3300025935 Unclassified 548
328 Ga0207670_10001261 3300025936 Bacteria 13373
329 Ga0207704_10165000 3300025938 Unclassified 1581
330 Ga0207704_11488339 3300025938 Unclassified 581
331 Ga0207711_10009424 3300025941 Bacteria 8151
332 Ga0207711_10026376 3300025941 Bacteria 4875
333 Ga0207711_10093378 3300025941 Bacteria 2650
334 Ga0207711_10477741 3300025941 Unclassified 1161
335 Ga0207689_10109787 3300025942 Bacteria 2266
336 Ga0207689_10165780 3300025942 Bacteria 1820
337 Ga0207689_10644442 3300025942 Unclassified 892
338 Ga0207689_10776330 3300025942 Unclassified 809
339 Ga0207689_10782909 3300025942 Bacteria 805
340 Ga0207679_10134821 3300025945 Bacteria 1987
341 Ga0207679_10260161 3300025945 Unclassified 1480
342 Ga0207679_11450932 3300025945 Unclassified 629
343 Ga0207667_11040133 3300025949 Unclassified 804
344 Ga0207651_10065344 3300025960 Bacteria 2551
345 Ga0207651_10250482 3300025960 Bacteria 1449
346 Ga0207651_10776711 3300025960 Bacteria 848
347 Ga0207651_10880063 3300025960 Unclassified 797
348 Ga0207712_10011610 3300025961 Bacteria 5617
349 Ga0207640_10306648 3300025981 Unclassified 1258
350 Ga0207640_10840957 3300025981 Bacteria 798
351 Ga0207640_11227830 3300025981 Unclassified 667
352 Ga0207658_10740866 3300025986 Unclassified 890
353 Ga0207703_10034297 3300026035 Bacteria 4027
354 Ga0207703_10067529 3300026035 Unclassified 2942
355 Ga0207703_10075265 3300026035 Bacteria 2798
356 Ga0207703_10353945 3300026035 Bacteria 1353
357 Ga0207703_11971903 3300026035 Unclassified 560
358 Ga0207639_10133764 3300026041 Bacteria 2056
359 Ga0207708_10002795 3300026075 Bacteria 12833
360 Ga0207708_10009478 3300026075 Bacteria 7212
361 Ga0207708_10037097 3300026075 Unclassified 3712
362 Ga0207708_10042720 3300026075 Bacteria 3454
363 Ga0207708_10081023 3300026075 Unclassified 2494
364 Ga0207641_10046644 3300026088 Bacteria 3653
365 Ga0207641_10318622 3300026088 Unclassified 1474
366 Ga0207641_10898671 3300026088 Unclassified 879
367 Ga0207641_11273781 3300026088 Unclassified 735
368 Ga0207648_10030028 3300026089 Unclassified 4819
369 Ga0207648_10081739 3300026089 Bacteria 2817
370 Ga0207648_10324461 3300026089 Bacteria 1384
371 Ga0207676_10009701 3300026095 Bacteria 6844
372 Ga0207676_10076176 3300026095 Bacteria 2709
373 Ga0207676_10101367 3300026095 Bacteria 2387
374 Ga0207676_10167337 3300026095 Bacteria 1912
375 Ga0207676_10915213 3300026095 Unclassified 861
376 Ga0207676_11262100 3300026095 Bacteria 733
377 Ga0207676_11723685 3300026095 Unclassified 625
378 Ga0207674_10018115 3300026116 Bacteria 7663
379 Ga0207674_10048783 3300026116 Bacteria 4332
380 Ga0207674_10072749 3300026116 Bacteria 3453
381 Ga0207674_10364572 3300026116 Unclassified 1397
382 Ga0207674_10935285 3300026116 Unclassified 835
383 Ga0207675_100064582 3300026118 Bacteria 3421
384 Ga0207675_100071467 3300026118 Unclassified 3245
385 Ga0207675_100129722 3300026118 Bacteria 2390
386 Ga0207675_100388373 3300026118 Unclassified 1374
387 Ga0207675_100491515 3300026118 Bacteria 1221
388 Ga0207675_101170055 3300026118 Unclassified 789
389 Ga0207698_10136757 3300026142 Bacteria 2104
390 Ga0207698_10151256 3300026142 Bacteria 2015
391 Ga0207428_10026445 3300027907 Bacteria 4844
392 Ga0268265_10251281 3300028380 Bacteria 1566
393 Ga0268265_10394884 3300028380 Unclassified 1277
394 Ga0268265_11195131 3300028380 Bacteria 758
395 Ga0268265_11559267 3300028380 Bacteria 665
396 Ga0268264_10031869 3300028381 Unclassified 4324
397 Ga0268264_10693150 3300028381 Unclassified 1011
398 Ga0268264_10780089 3300028381 Unclassified 954
399 Ga0268264_10787434 3300028381 Unclassified 949
400 Ga0268264_11163575 3300028381 Unclassified 780
401 Ga0268264_11764405 3300028381 Unclassified 629
402 Ga0307408_100068143 3300031548 Bacteria 2619
403 Ga0307408_100243282 3300031548 Unclassified 1480
404 Ga0307405_10018351 3300031731 Bacteria 3857
405 Ga0307405_10117752 3300031731 Unclassified 1812
406 Ga0307410_10027802 3300031852 Bacteria 3578
407 Ga0307406_10026571 3300031901 Bacteria 3478
408 Ga0307406_10645351 3300031901 Unclassified 878
409 Ga0307412_10105421 3300031911 Bacteria 2002
410 Ga0307416_100019853 3300032002 Bacteria 4776
411 Ga0307416_100264448 3300032002 Bacteria 1684
412 Ga0307416_100597486 3300032002 Bacteria 1183
413 Ga0307414_10012206 3300032004 Bacteria 5069
414 Ga0307414_10254434 3300032004 Bacteria 1462
415 Ga0307411_10033148 3300032005 Bacteria 3201
416 Ga0307411_10583094 3300032005 Unclassified 959
417 Ga0307415_100008880 3300032126 Bacteria 5598
418 Ga0307415_100603998 3300032126 Unclassified 977
419 Ga0373959_0072533 3300034820 Unclassified 781
420 Ga0373951_0112475 3300035091 Unclassified 734
421 Ga0373961_0406940 3300035241 Unclassified 523
422 Ga0373931_0191311 3300035691 Bacteria 1218
423 Ga0395900_0325631 3300037418 Unclassified 1516
424 Ga0395898_1122732 3300037466 Unclassified 719
425 Ga0242422_06945 3300038699 Unclassified 673
426 Ga0242420_003496 3300038996 Bacteria 2323
427 Ga0451576_0829299 3300045051 Unclassified 971
428 Ga0495656_0412565 3300046615 Unclassified 708
429 Ga0496102_1327889 3300048905 Unclassified 638
430 Ga0496106_0847165 3300048909 Unclassified 724
431 Ga0496107_0264910 3300048910 Unclassified 1279
432 Ga0496107_0273774 3300048910 Unclassified 1256
433 Ga0496108_0205530 3300048911 Bacteria 1709
434 Ga0496110_0077038 3300048913 Bacteria 2966
435 Ga0496112_0199491 3300048915 Bacteria 1961
436 Ga0496112_0280121 3300048915 Bacteria 1615
437 Ga0496112_1027496 3300048915 Unclassified 744
438 Ga0496113_0058431 3300048916 Bacteria 2902
439 Ga0501309_070840 3300049129 Unclassified 573
440 Ga0501290_004933 3300049513 Bacteria 1666
441 Ga0501292_011812 3300049515 Unclassified 1326
442 Ga0501292_055818 3300049515 Bacteria 708
443 Ga0501296_005083 3300049519 Unclassified 1455
444 Ga0501297_008009 3300049520 Unclassified 1159
445 Ga0501298_000754 3300049521 Bacteria 4551
446 Ga0501298_000757 3300049521 Bacteria 4540
447 Ga0501299_001862 3300049522 Bacteria 2831
448 Ga0501198_000676 3300049649 Bacteria 4238
449 Ga0501198_048950 3300049649 Unclassified 749
450 Ga0501201_009305 3300049651 Unclassified 955
451 Ga0501202_001400 3300049652 Bacteria 3866
452 Ga0501202_003008 3300049652 Bacteria 2862
453 Ga0501202_015692 3300049652 Viruses 1462
454 Ga0501207_000581 3300049654 Bacteria 4195
455 Ga0501207_018891 3300049654 Unclassified 1088
456 Ga0501208_017570 3300049655 Unclassified 1129
457 Ga0501208_020172 3300049655 Bacteria 1082
458 Ga0501209_012939 3300049656 Bacteria 1792
459 Ga0501216_000778 3300049660 Bacteria 3987
460 Ga0501217_004579 3300049661 Bacteria 2847
461 Ga0501223_001225 3300049663 Bacteria 5991
462 Ga0501224_003858 3300049664 Bacteria 2111
463 Ga0501224_004048 3300049664 Unclassified 2066
464 Ga0501224_012196 3300049664 Unclassified 1265
465 Ga0501227_003022 3300049665 Bacteria 3669
466 Ga0501227_014088 3300049665 Bacteria 1770
467 Ga0501227_022457 3300049665 Unclassified 1461
468 Ga0501233_010381 3300049668 Bacteria 1833
469 Ga0501235_008874 3300049669 Bacteria 2192
470 Ga0501235_020077 3300049669 Unclassified 1484
471 Ga0501236_005425 3300049670 Bacteria 1540
472 Ga0501243_005840 3300049675 Bacteria 1858
473 Ga0501243_007266 3300049675 Bacteria 1691
474 Ga0501243_068954 3300049675 Unclassified 669
475 Ga0501246_005049 3300049676 Unclassified 1101
476 Ga0501249_044458 3300049679 Bacteria 1012
477 Ga0501251_004301 3300049681 Bacteria 1466
478 Ga0501255_001083 3300049684 Unclassified 2104
479 Ga0501257_005208 3300049686 Bacteria 2860
480 Ga0501257_022468 3300049686 Bacteria 1493
481 Ga0501225_0005634 3300049705 Bacteria 3671
482 Ga0501225_0010833 3300049705 Bacteria 2575
483 Ga0501225_0025116 3300049705 Unclassified 1640
484 Ga0501225_0029897 3300049705 Bacteria 1497
485 Ga0501229_042148 3300049706 Unclassified 653
486 Ga0501234_003476 3300049707 Bacteria 2477
487 Ga0501245_010123 3300049708 Unclassified 1360
488 Ga0501268_007624 3300049765 Unclassified 1618
489 Ga0501272_020441 3300049769 Bacteria 793
490 Ga0501275_012529 3300049772 Unclassified 937
491 Ga0501279_004695 3300049775 Bacteria 1793
492 Ga0501280_103117 3300049776 Unclassified 550
493 Ga0501283_028544 3300049779 Unclassified 926
494 Ga0501204_028134 3300049850 Bacteria 768
495 Ga0501212_010662 3300049851 Unclassified 1314
496 nmdc:mga05p37_126867_c1 3300050507 Bacteria 3133
497 nmdc:mga05p37_157274_c1 3300050507 Bacteria 2777
498 nmdc:mga05p37_82414_c1 3300050507 Unclassified 3963
499 nmdc:mga09592_574302_c1 3300050508 Unclassified 967
500 nmdc:mga06r32_7848_c1 3300050510 Bacteria 9589
501 nmdc:mga08y16_145875_c1 3300050511 Bacteria 2460
502 nmdc:mga08y16_20660_c1 3300050511 Bacteria 6950
503 nmdc:mga08y16_30441_c1 3300050511 Bacteria 5681
504 nmdc:mga08y16_33081_c1 3300050511 Bacteria 5432
505 nmdc:mga0n895_458038_c1 3300050512 Unclassified 1287
506 nmdc:mga0n895_760318_c1 3300050512 Unclassified 962
507 nmdc:mga0a205_14674_c1 3300050515 Bacteria 7309
508 nmdc:mga0a205_280475_c1 3300050515 Unclassified 1541
509 nmdc:mga0a205_359101_c1 3300050515 Bacteria 1324
510 Ga0105243_11642764
511 SwRhRL2b_contig_1006212
512 CNAas_1001175
513 JGI24736J21556_1011861
514 JGI24751J29686_10000074
515 JGI25406J46586_10004917
516 rootL2_10218619
517 Ga0065714_10002193
518 Ga0065714_10014649
519 Ga0065714_10120641
520 Ga0065704_10002114
521 Ga0065712_10000128
522 Ga0065712_10001471
523 Ga0065712_10011898
524 Ga0065712_10084665
525 Ga0065712_10356621
526 Ga0065715_10014944
527 Ga0065715_10089982
528 Ga0065715_10097442
529 Ga0065715_10113758
530 Ga0065715_10476883
531 Ga0065707_10005756
532 Ga0065707_10131385
533 Ga0070676_10168373
534 Ga0070670_100002663
535 Ga0070670_100067678
536 Ga0070670_100567022
537 Ga0068869_100173240
538 Ga0068869_100300139
539 Ga0068869_100511352
540 Ga0068869_100775041
541 Ga0070666_10722318
542 Ga0070680_100387009
543 Ga0070680_101025197
544 Ga0070682_100003450
545 Ga0070660_100656116
546 Ga0070689_100000760
547 Ga0070691_10415832
548 Ga0070692_10036568
549 Ga0070692_10045039
550 Ga0070692_10118586
551 Ga0070669_100112395
552 Ga0070669_101456281
553 Ga0070675_100074797
554 Ga0070675_101328443
555 Ga0070673_100180448
556 Ga0070673_100313779
557 Ga0070673_100849046
558 Ga0070673_101553508
559 Ga0070659_101066832
560 Ga0070703_10001715
561 Ga0070701_10006211
562 Ga0070701_10196933
563 Ga0070701_10210271
564 Ga0070701_10322997
565 Ga0070705_100150514
566 Ga0070705_100687649
567 Ga0070700_100001145
568 Ga0070700_100021914
569 Ga0070700_100024182
570 Ga0070700_100077632
571 Ga0070700_101039265
572 Ga0070694_100005266
573 Ga0070694_100060749
574 Ga0070694_100090769
575 Ga0070694_100385541
576 Ga0070694_100843661
577 Ga0070694_101636801
578 Ga0070662_101071969
579 Ga0068867_100033288
580 Ga0068867_100164514
581 Ga0068867_100258557
582 Ga0068867_100654781
583 Ga0070706_100000075
584 Ga0070707_100021645
585 Ga0070698_100192229
586 Ga0070699_100015592
587 Ga0070699_100053204
588 Ga0070699_100187591
589 Ga0070679_100017739
590 Ga0070697_100148970
591 Ga0068853_100141185
592 Ga0070686_100059255
593 Ga0070695_100012398
594 Ga0070695_100038651
595 Ga0070695_100105206
596 Ga0070695_101154221
597 Ga0070696_100011443
598 Ga0070696_100114610
599 Ga0070696_101076650
600 Ga0070696_101788585
601 Ga0070693_100001138
602 Ga0070693_100066085
603 Ga0070693_100299676
604 Ga0070704_100092937
605 Ga0070704_100151246
606 Ga0070704_100238238
607 Ga0068855_100395793
608 Ga0070664_100035190
609 Ga0070664_100295435
610 Ga0070664_100706059
611 Ga0068857_100051705
612 Ga0068857_100128810
613 Ga0068857_100139510
614 Ga0068854_100291184
615 Ga0068854_100336453
616 Ga0068854_101219629
617 Ga0070702_100026238
618 Ga0070702_100057028
619 Ga0070702_100087408
620 Ga0070702_100287972
621 Ga0068852_100237945
622 Ga0068852_100240724
623 Ga0068852_100495539
624 Ga0068852_101554243
625 Ga0068859_100003036
626 Ga0068859_100011746
627 Ga0068859_100024957
628 Ga0068859_100061174
629 Ga0068859_100086786
630 Ga0068859_100107226
631 Ga0068859_100107411
632 Ga0068859_100145392
633 Ga0068859_100373668
634 Ga0068859_100504349
635 Ga0068859_100561011
636 Ga0068864_100004579
637 Ga0068864_100113926
638 Ga0068864_100159550
639 Ga0068864_100564098
640 Ga0068864_100589801
641 Ga0068864_100674836
642 Ga0068864_100896431
643 Ga0068866_10631786
644 Ga0068861_100042913
645 Ga0068861_100068334
646 Ga0068861_100313312
647 Ga0068861_100682101
648 Ga0068851_10001596
649 Ga0068870_10007037
650 Ga0068870_10231127
651 Ga0068870_10523430
652 Ga0068870_10802918
653 Ga0068863_100031547
654 Ga0068863_100143179
655 Ga0068863_101770272
656 Ga0068858_100018377
657 Ga0068858_100068435
658 Ga0068858_100389984
659 Ga0068858_100416508
660 Ga0068858_100620695
661 Ga0068858_100786828
662 Ga0068860_100009907
663 Ga0068860_100386959
664 Ga0068860_100410489
665 Ga0068860_100412607
666 Ga0068860_101406916
667 Ga0068862_100053911
668 Ga0068862_100151485
669 Ga0068862_100993523
670 Ga0081539_10001281
671 Ga0081539_10024358
672 Ga0081539_10062455
673 Ga0075432_10043516
674 Ga0075432_10331340
675 Ga0070715_10925054
676 Ga0097621_100001147
677 Ga0097621_100022067
678 Ga0068871_100016425
679 Ga0068871_101259899
680 Ga0075428_100003072
681 Ga0075428_100340855
682 Ga0075431_100405643
683 Ga0075433_10012548
684 Ga0075433_10038838
685 Ga0075433_10067946
686 Ga0075434_100079549
687 Ga0075434_100233344
688 Ga0075429_100603725
689 Ga0075429_100740269
690 Ga0068865_100496305
691 Ga0068865_101185148
692 Ga0097620_100003036
693 Ga0097620_100011746
694 Ga0097620_100024957
695 Ga0097620_100061175
696 Ga0097620_100086785
697 Ga0097620_100107225
698 Ga0097620_100107410
699 Ga0097620_100145388
700 Ga0097620_100373718
701 Ga0097620_100504402
702 Ga0097620_100560992
703 Ga0075435_100546593
704 Ga0105240_10238362
705 Ga0105240_10513241
706 Ga0111539_10017002
707 Ga0105245_10833164
708 Ga0105245_12156595
709 Ga0105247_10000155
710 Ga0105247_10062174
711 Ga0105247_10185526
712 Ga0105247_10215129
713 Ga0105247_10285043
714 Ga0105247_10429307
715 Ga0114129_10027412
716 Ga0114129_10105541
717 Ga0114129_11618135
718 Ga0105243_10002314
719 Ga0105243_10163842
720 Ga0105243_10196374
721 Ga0105243_10274443
722 Ga0105243_10338851
723 Ga0105243_11270249
724 Ga0105241_10144682
725 Ga0105241_10205734
726 Ga0105241_10256385
727 Ga0105241_10347490
728 Ga0105241_10351793
729 Ga0105241_10757144
730 Ga0105242_10215798
731 Ga0105242_10309169
732 Ga0105242_10917870
733 Ga0105248_10003539
734 Ga0105248_10007816
735 Ga0105248_10041585
736 Ga0105248_10164356
737 Ga0105248_10408880
738 Ga0105248_10720376
739 Ga0105248_11436574
740 Ga0105237_10002068
741 Ga0105238_10000706
742 Ga0105238_10055885
743 Ga0105238_11326784
744 Ga0105238_11392672
745 Ga0105249_10090728
746 Ga0105249_10147982
747 Ga0105249_11676609
748 Ga0105239_10458480
749 Ga0105239_10479603
750 Ga0105239_10666913
751 Ga0105239_10762117
752 Ga0105246_10003052
753 Ga0105246_12128661
754 Ga0157373_10098531
755 Ga0157373_10546321
756 Ga0157373_10717594
757 Ga0157373_11250462
758 Ga0157371_10489322
759 Ga0157374_10247783
760 Ga0157374_11056953
761 Ga0157378_10106928
762 Ga0163162_10105996
763 Ga0163162_10141402
764 Ga0163162_10196637
765 Ga0163162_10273454
766 Ga0163162_10464091
767 Ga0163162_10864610
768 Ga0157372_10080476
769 Ga0157372_10652097
770 Ga0157375_10004439
771 Ga0157375_10092152
772 Ga0157375_10424231
773 Ga0157375_11283900
774 Ga0157375_11663629
775 Ga0163163_10001953
776 Ga0163163_10038193
777 Ga0163163_10067870
778 Ga0163163_10086348
779 Ga0163163_10488460
780 Ga0163163_10527011
781 Ga0157380_10023316
782 Ga0157380_10033420
783 Ga0157380_10624424
784 Ga0157380_10669375
785 Ga0157377_10088612
786 Ga0157377_10224667
787 Ga0157377_10678769
788 Ga0157379_10046605
789 Ga0163161_10735538
790 Ga0207697_10074800
791 Ga0207656_10004028
792 Ga0207653_10001567
793 Ga0207653_10048160
794 Ga0207642_10184790
795 Ga0207710_10119747
796 Ga0207710_10213633
797 Ga0207688_10164495
798 Ga0207647_10041552
799 Ga0207647_10109652
800 Ga0207647_10301604
801 Ga0207645_10116932
802 Ga0207645_10912963
803 Ga0207643_10002727
804 Ga0207643_10010313
805 Ga0207643_10086077
806 Ga0207643_10121951
807 Ga0207643_10458800
808 Ga0207684_10000093
809 Ga0207654_10357434
810 Ga0207707_10313839
811 Ga0207695_10053898
812 Ga0207671_10001847
813 Ga0207671_10579229
814 Ga0207660_11164016
815 Ga0207662_10011845
816 Ga0207662_10140053
817 Ga0207652_10103400
818 Ga0207646_10102679
819 Ga0207681_10440847
820 Ga0207681_11054331
821 Ga0207681_11493233
822 Ga0207694_10009023
823 Ga0207694_11325107
824 Ga0207650_10000028
825 Ga0207650_10150452
826 Ga0207650_10564100
827 Ga0207650_10788211
828 Ga0207690_10742323
829 Ga0207706_10708343
830 Ga0207686_10142808
831 Ga0207686_10488872
832 Ga0207686_10601481
833 Ga0207686_10732362
834 Ga0207709_10012715
835 Ga0207709_10480765
836 Ga0207709_11561120
837 Ga0207670_10001261
838 Ga0207704_10165000
839 Ga0207704_11488339
840 Ga0207711_10009424
841 Ga0207711_10026376
842 Ga0207711_10093378
843 Ga0207711_10477741
844 Ga0207689_10109787
845 Ga0207689_10165780
846 Ga0207689_10644442
847 Ga0207689_10776330
848 Ga0207689_10782909
849 Ga0207679_10134821
850 Ga0207679_10260161
851 Ga0207679_11450932
852 Ga0207667_11040133
853 Ga0207651_10065344
854 Ga0207651_10250482
855 Ga0207651_10776711
856 Ga0207651_10880063
857 Ga0207712_10011610
858 Ga0207640_10306648
859 Ga0207640_10840957
860 Ga0207640_11227830
861 Ga0207658_10740866
862 Ga0207703_10034297
863 Ga0207703_10067529
864 Ga0207703_10075265
865 Ga0207703_10353945
866 Ga0207703_11971903
867 Ga0207639_10133764
868 Ga0207708_10002795
869 Ga0207708_10009478
870 Ga0207708_10037097
871 Ga0207708_10042720
872 Ga0207708_10081023
873 Ga0207641_10046644
874 Ga0207641_10318622
875 Ga0207641_10898671
876 Ga0207641_11273781
877 Ga0207648_10030028
878 Ga0207648_10081739
879 Ga0207648_10324461
880 Ga0207676_10009701
881 Ga0207676_10076176
882 Ga0207676_10101367
883 Ga0207676_10167337
884 Ga0207676_10915213
885 Ga0207676_11262100
886 Ga0207676_11723685
887 Ga0207674_10018115
888 Ga0207674_10048783
889 Ga0207674_10072749
890 Ga0207674_10364572
891 Ga0207674_10935285
892 Ga0207675_100064582
893 Ga0207675_100071467
894 Ga0207675_100129722
895 Ga0207675_100388373
896 Ga0207675_100491515
897 Ga0207675_101170055
898 Ga0207698_10136757
899 Ga0207698_10151256
900 Ga0207428_10026445
901 Ga0268265_10251281
902 Ga0268265_10394884
903 Ga0268265_11195131
904 Ga0268265_11559267
905 Ga0268264_10031869
906 Ga0268264_10693150
907 Ga0268264_10780089
908 Ga0268264_10787434
909 Ga0268264_11163575
910 Ga0268264_11764405
911 Ga0307408_100068143
912 Ga0307408_100243282
913 Ga0307405_10018351
914 Ga0307405_10117752
915 Ga0307410_10027802
916 Ga0307406_10026571
917 Ga0307406_10645351
918 Ga0307412_10105421
919 Ga0307416_100019853
920 Ga0307416_100264448
921 Ga0307416_100597486
922 Ga0307414_10012206
923 Ga0307414_10254434
924 Ga0307411_10033148
925 Ga0307411_10583094
926 Ga0307415_100008880
927 Ga0307415_100603998
928 Ga0373959_0072533
929 Ga0373951_0112475
930 Ga0373961_0406940
931 Ga0373931_0191311
932 Ga0395900_0325631
933 Ga0395898_1122732
934 Ga0242422_06945
935 Ga0242420_003496
936 Ga0451576_0829299
937 Ga0495656_0412565
938 Ga0496102_1327889
939 Ga0496106_0847165
940 Ga0496107_0264910
941 Ga0496107_0273774
942 Ga0496108_0205530
943 Ga0496110_0077038
944 Ga0496112_0199491
945 Ga0496112_0280121
946 Ga0496112_1027496
947 Ga0496113_0058431
948 Ga0501309_070840
949 Ga0501290_004933
950 Ga0501292_011812
951 Ga0501292_055818
952 Ga0501296_005083
953 Ga0501297_008009
954 Ga0501298_000754
955 Ga0501298_000757
956 Ga0501299_001862
957 Ga0501198_000676
958 Ga0501198_048950
959 Ga0501201_009305
960 Ga0501202_001400
961 Ga0501202_003008
962 Ga0501202_015692
963 Ga0501207_000581
964 Ga0501207_018891
965 Ga0501208_017570
966 Ga0501208_020172
967 Ga0501209_012939
968 Ga0501216_000778
969 Ga0501217_004579
970 Ga0501223_001225
971 Ga0501224_003858
972 Ga0501224_004048
973 Ga0501224_012196
974 Ga0501227_003022
975 Ga0501227_014088
976 Ga0501227_022457
977 Ga0501233_010381
978 Ga0501235_008874
979 Ga0501235_020077
980 Ga0501236_005425
981 Ga0501243_005840
982 Ga0501243_007266
983 Ga0501243_068954
984 Ga0501246_005049
985 Ga0501249_044458
986 Ga0501251_004301
987 Ga0501255_001083
988 Ga0501257_005208
989 Ga0501257_022468
990 Ga0501225_0005634
991 Ga0501225_0010833
992 Ga0501225_0025116
993 Ga0501225_0029897
994 Ga0501229_042148
995 Ga0501234_003476
996 Ga0501245_010123
997 Ga0501268_007624
998 Ga0501272_020441
999 Ga0501275_012529
1000 Ga0501279_004695
1001 Ga0501280_103117
1002 Ga0501283_028544
1003 Ga0501204_028134
1004 Ga0501212_010662
1005 nmdc:mga05p37_126867_c1
1006 nmdc:mga05p37_157274_c1
1007 nmdc:mga05p37_82414_c1
1008 nmdc:mga09592_574302_c1
1009 nmdc:mga06r32_7848_c1
1010 nmdc:mga08y16_145875_c1
1011 nmdc:mga08y16_20660_c1
1012 nmdc:mga08y16_30441_c1
1013 nmdc:mga08y16_33081_c1
1014 nmdc:mga0n895_458038_c1
1015 nmdc:mga0n895_760318_c1
1016 nmdc:mga0a205_14674_c1
1017 nmdc:mga0a205_280475_c1
1018 nmdc:mga0a205_359101_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x7z-assembly2.cif.gz_B the crystal structure of 2+2/4+2 cyclase ploi4 0.6358 29 163
6hmj-assembly1.cif.gz_A structure of an rna-binding light-oxygen-voltage receptor 0.6079 116 159
4h6b-assembly1.cif.gz_D structural basis for allene oxide cyclization in moss 0.5981 31 160
7x7z-assembly2.cif.gz_B the crystal structure of 2+2/4+2 cyclase ploi4 0.5975 29 163
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.5966 31 161
ID Description Score Start End Superfamily
af_A0A1D6F1Q6_31_182_2.40.480.10 Mainly Beta;Beta Barrel;AOC barrel-like;Allene oxide cyclase-like 0.6605 29 163 2.40.480.10
af_A0A0P0WG65_20_167_2.40.480.10 Mainly Beta;Beta Barrel;AOC barrel-like;Allene oxide cyclase-like 0.6371 27 163 2.40.480.10
af_Q09243_24_162_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6341 38 83 3.10.450.50
af_A0A0P0XSY5_13_190_2.40.480.10 Mainly Beta;Beta Barrel;AOC barrel-like;Allene oxide cyclase-like 0.6251 28 163 2.40.480.10
af_A0A0P0XSY5_16_152_2.40.480.10 Mainly Beta;Beta Barrel;AOC barrel-like;Allene oxide cyclase-like 0.6181 31 160 2.40.480.10
ID Description Score Start End GO Terms
AF-A0A517ZAW4-F1-model_v4 Uncharacterized protein 0.8771 25 163
AF-A0A2T6DYU1-F1-model_v4 Uncharacterized protein 0.8731 25 162
AF-A0A832HLR9-F1-model_v4 Uncharacterized protein 0.8701 24 163
AF-A0A4Q6GDS4-F1-model_v4 deleted 0.8662 30 163
AF-A0A2V7ST71-F1-model_v4 Uncharacterized protein 0.8579 28 162

Map