F456937

General Info

Members Datasets Scaffolds Average Seq Length
509 260 1018 96

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100063956|Ga0070708_1000639565
Length 112
Sequence LLNGAADGRRAVPTIPDVKLLKTKTARFSQVIENCGEPQVYTLWQKPSADRHLSAQINRNRVMTILKSERGTDFGIVGLKESKEARYLIFPKSLTRFAGKRIIGIDWAFVRE

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.68
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 43.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100063956 3300005445 Unclassified 3294
2 JGI24743J22301_10034631 3300001991 Unclassified 1002
3 JGI24035J26624_1000465 3300002126 Bacteria 3802
4 JGI24035J26624_1001974 3300002126 Bacteria 1910
5 JGI24035J26624_1002629 3300002126 Unclassified 1674
6 JGI24035J26624_1004258 3300002126 Unclassified 1357
7 JGI25406J46586_10172823 3300003203 Unclassified 630
8 JGI25405J52794_10007332 3300003911 Bacteria 2033
9 Ga0065704_10103656 3300005289 Unclassified 2165
10 Ga0065704_10752565 3300005289 Bacteria 541
11 Ga0065704_10754547 3300005289 Bacteria 540
12 Ga0065712_10004569 3300005290 Bacteria 3819
13 Ga0065712_10004648 3300005290 Bacteria 3354
14 Ga0065712_10083012 3300005290 Bacteria 2869
15 Ga0065712_10098852 3300005290 Unclassified 2105
16 Ga0065712_10249503 3300005290 Unclassified 951
17 Ga0065715_10005929 3300005293 Bacteria 3739
18 Ga0065715_10012383 3300005293 Bacteria 3008
19 Ga0065715_10015712 3300005293 Bacteria 2953
20 Ga0065715_10019087 3300005293 Bacteria 2301
21 Ga0065715_10030886 3300005293 Bacteria 1968
22 Ga0065715_10201483 3300005293 Unclassified 1359
23 Ga0065707_10029172 3300005295 Bacteria 1089
24 Ga0065707_10601167 3300005295 Unclassified 690
25 Ga0065707_10617817 3300005295 Bacteria 675
26 Ga0065707_10651010 3300005295 Unclassified 663
27 Ga0070658_10328049 3300005327 Bacteria 1308
28 Ga0070676_10103002 3300005328 Bacteria 1766
29 Ga0070683_100046593 3300005329 Unclassified 4006
30 Ga0070683_100464777 3300005329 Bacteria 1208
31 Ga0070683_101029522 3300005329 Unclassified 791
32 Ga0070683_101425642 3300005329 Unclassified 666
33 Ga0070690_100138819 3300005330 Bacteria 1648
34 Ga0070670_100170106 3300005331 Bacteria 1890
35 Ga0068869_100192703 3300005334 Bacteria 1603
36 Ga0070680_100100326 3300005336 Bacteria 2403
37 Ga0068868_100322364 3300005338 Bacteria 1316
38 Ga0068868_100370468 3300005338 Unclassified 1230
39 Ga0068868_100933116 3300005338 Unclassified 790
40 Ga0070660_100325282 3300005339 Bacteria 1263
41 Ga0070660_100712592 3300005339 Bacteria 842
42 Ga0070660_100873646 3300005339 Bacteria 758
43 Ga0070689_100002634 3300005340 Bacteria 11759
44 Ga0070689_100044051 3300005340 Bacteria 3432
45 Ga0070689_100551136 3300005340 Bacteria 993
46 Ga0070689_100587263 3300005340 Bacteria 963
47 Ga0070689_101265515 3300005340 Unclassified 664
48 Ga0070687_100083866 3300005343 Bacteria 1746
49 Ga0070687_100599342 3300005343 Unclassified 757
50 Ga0070661_100267320 3300005344 Bacteria 1323
51 Ga0070692_10115856 3300005345 Unclassified 1488
52 Ga0070668_100442939 3300005347 Bacteria 1115
53 Ga0070668_100731281 3300005347 Unclassified 875
54 Ga0070669_100070015 3300005353 Bacteria 2592
55 Ga0070669_100448842 3300005353 Unclassified 1063
56 Ga0070675_100017002 3300005354 Bacteria 5779
57 Ga0070675_100101130 3300005354 Bacteria 2428
58 Ga0070675_100120621 3300005354 Bacteria 2227
59 Ga0070675_100351260 3300005354 Bacteria 1307
60 Ga0070671_100130628 3300005355 Bacteria 2115
61 Ga0070671_100415954 3300005355 Bacteria 1151
62 Ga0070671_100612271 3300005355 Unclassified 941
63 Ga0070674_100218432 3300005356 Bacteria 1482
64 Ga0070674_100609119 3300005356 Bacteria 924
65 Ga0070673_100012707 3300005364 Bacteria 5790
66 Ga0070673_101702472 3300005364 Unclassified 597
67 Ga0070673_101755339 3300005364 Unclassified 588
68 Ga0070688_100062436 3300005365 Unclassified 2358
69 Ga0070688_101422108 3300005365 Unclassified 563
70 Ga0070659_100001154 3300005366 Bacteria 19280
71 Ga0070659_100100162 3300005366 Unclassified 2331
72 Ga0070659_100175804 3300005366 Bacteria 1755
73 Ga0070659_100422393 3300005366 Bacteria 1128
74 Ga0070667_100122908 3300005367 Bacteria 2260
75 Ga0070667_100423133 3300005367 Bacteria 1214
76 Ga0070667_100974770 3300005367 Unclassified 791
77 Ga0070667_101368878 3300005367 Unclassified 664
78 Ga0070703_10102868 3300005406 Bacteria 1010
79 Ga0070709_10180878 3300005434 Unclassified 1480
80 Ga0070709_11394953 3300005434 Bacteria 567
81 Ga0070714_100030753 3300005435 Unclassified 4473
82 Ga0070714_101396614 3300005435 Bacteria 684
83 Ga0070714_102185154 3300005435 Unclassified 539
84 Ga0070713_100245218 3300005436 Unclassified 1632
85 Ga0070710_10050922 3300005437 Unclassified 2323
86 Ga0070701_10164962 3300005438 Bacteria 1286
87 Ga0070701_11053213 3300005438 Unclassified 570
88 Ga0070711_100126397 3300005439 Bacteria 1898
89 Ga0070711_100281221 3300005439 Bacteria 1316
90 Ga0070705_100016698 3300005440 Unclassified 3818
91 Ga0070705_100040404 3300005440 Bacteria 2652
92 Ga0070700_100088957 3300005441 Bacteria 2011
93 Ga0070694_100181049 3300005444 Unclassified 1559
94 Ga0070694_100632289 3300005444 Bacteria 865
95 Ga0070708_100242921 3300005445 Bacteria 1691
96 Ga0070663_101115880 3300005455 Unclassified 690
97 Ga0070663_101219870 3300005455 Unclassified 661
98 Ga0070678_100186170 3300005456 Bacteria 1703
99 Ga0070662_100022986 3300005457 Unclassified 4278
100 Ga0070662_100128386 3300005457 Bacteria 1951
101 Ga0070662_100246504 3300005457 Bacteria 1434
102 Ga0070662_100515573 3300005457 Unclassified 998
103 Ga0070662_100566866 3300005457 Bacteria 953
104 Ga0070662_101782743 3300005457 Unclassified 532
105 Ga0070681_10030785 3300005458 Bacteria 5385
106 Ga0070681_10820057 3300005458 Bacteria 848
107 Ga0068867_101341430 3300005459 Bacteria 661
108 Ga0070685_10073318 3300005466 Unclassified 2034
109 Ga0070685_10475795 3300005466 Unclassified 879
110 Ga0070685_10683830 3300005466 Bacteria 747
111 Ga0070706_100048571 3300005467 Bacteria 3916
112 Ga0070706_101800660 3300005467 Unclassified 557
113 Ga0070707_100050676 3300005468 Bacteria 3980
114 Ga0070707_100202010 3300005468 Unclassified 1937
115 Ga0070707_100790679 3300005468 Unclassified 912
116 Ga0070707_100845136 3300005468 Bacteria 879
117 Ga0070707_102264407 3300005468 Bacteria 511
118 Ga0070698_100001933 3300005471 Bacteria 23020
119 Ga0070699_100194481 3300005518 Unclassified 1802
120 Ga0070679_100084397 3300005530 Unclassified 3164
121 Ga0070684_100001312 3300005535 Bacteria 17819
122 Ga0070684_100047615 3300005535 Unclassified 3715
123 Ga0070697_100020725 3300005536 Bacteria 5204
124 Ga0070697_100782935 3300005536 Bacteria 844
125 Ga0070672_100807684 3300005543 Unclassified 825
126 Ga0070686_100058959 3300005544 Bacteria 2471
127 Ga0070686_100309935 3300005544 Bacteria 1173
128 Ga0070686_100475027 3300005544 Unclassified 966
129 Ga0070693_100366843 3300005547 Unclassified 990
130 Ga0070665_100016091 3300005548 Bacteria 7505
131 Ga0070665_100054248 3300005548 Bacteria 4020
132 Ga0070665_100113660 3300005548 Unclassified 2710
133 Ga0070665_100816313 3300005548 Unclassified 946
134 Ga0070704_100024717 3300005549 Unclassified 3945
135 Ga0070704_100095856 3300005549 Bacteria 2223
136 Ga0070704_101069947 3300005549 Bacteria 732
137 Ga0070664_100156352 3300005564 Unclassified 2015
138 Ga0070664_100505074 3300005564 Unclassified 1115
139 Ga0068854_100894284 3300005578 Unclassified 780
140 Ga0068856_100382620 3300005614 Bacteria 1426
141 Ga0068856_101275100 3300005614 Bacteria 750
142 Ga0068856_102693427 3300005614 Bacteria 502
143 Ga0070702_100053339 3300005615 Unclassified 2323
144 Ga0070702_101290909 3300005615 Unclassified 592
145 Ga0068859_100390850 3300005617 Bacteria 1487
146 Ga0068864_100173437 3300005618 Bacteria 1968
147 Ga0068864_101644520 3300005618 Unclassified 646
148 Ga0068866_10806855 3300005718 Unclassified 653
149 Ga0068861_100393552 3300005719 Bacteria 1228
150 Ga0068863_100489862 3300005841 Unclassified 1210
151 Ga0068858_100118968 3300005842 Unclassified 2470
152 Ga0068860_100026862 3300005843 Bacteria 5547
153 Ga0068860_100223238 3300005843 Bacteria 1830
154 Ga0068860_101455001 3300005843 Bacteria 707
155 Ga0068862_100360231 3300005844 Bacteria 1351
156 Ga0068862_100519677 3300005844 Bacteria 1133
157 Ga0081455_10001399 3300005937 Bacteria 29813
158 Ga0081455_10003842 3300005937 Bacteria 17128
159 Ga0081455_10006698 3300005937 Bacteria 12311
160 Ga0081455_10022422 3300005937 Bacteria 5901
161 Ga0081455_10050883 3300005937 Bacteria 3558
162 Ga0081455_10568928 3300005937 Bacteria 745
163 Ga0081540_1000036 3300005983 Bacteria 140805
164 Ga0081540_1046210 3300005983 Bacteria 2201
165 Ga0081539_10028564 3300005985 Bacteria 3504
166 Ga0081539_10108100 3300005985 Bacteria 1406
167 Ga0070717_10700500 3300006028 Bacteria 920
168 Ga0070715_10059392 3300006163 Unclassified 1673
169 Ga0070715_10542856 3300006163 Bacteria 672
170 Ga0070716_100161888 3300006173 Bacteria 1451
171 Ga0070716_100353815 3300006173 Bacteria 1040
172 Ga0070716_100493504 3300006173 Bacteria 902
173 Ga0070716_100513631 3300006173 Bacteria 886
174 Ga0070712_100118092 3300006175 Bacteria 1991
175 Ga0070712_100125751 3300006175 Unclassified 1936
176 Ga0070712_100330603 3300006175 Unclassified 1241
177 Ga0070712_100693640 3300006175 Unclassified 868
178 Ga0070712_100845968 3300006175 Bacteria 787
179 Ga0070712_100940083 3300006175 Bacteria 746
180 Ga0097621_100109208 3300006237 Bacteria 2336
181 Ga0097621_101519493 3300006237 Unclassified 636
182 Ga0068871_100990172 3300006358 Unclassified 782
183 Ga0068871_102143689 3300006358 Unclassified 532
184 Ga0075428_100782234 3300006844 Unclassified 1015
185 Ga0075428_100805005 3300006844 Unclassified 999
186 Ga0068865_100058216 3300006881 Bacteria 2698
187 Ga0097620_100390830 3300006931 Bacteria 1487
188 Ga0075435_101204410 3300007076 Bacteria 663
189 Ga0099794_10248392 3300007265 Bacteria 917
190 Ga0099794_10342698 3300007265 Bacteria 777
191 Ga0099795_10109797 3300007788 Unclassified 1092
192 Ga0105251_10113212 3300009011 Unclassified 1235
193 Ga0105250_10158008 3300009092 Bacteria 946
194 Ga0105250_10174476 3300009092 Bacteria 901
195 Ga0111539_10833688 3300009094 Unclassified 1073
196 Ga0105245_10065631 3300009098 Bacteria 3283
197 Ga0105245_10242370 3300009098 Unclassified 1748
198 Ga0105245_11350674 3300009098 Unclassified 762
199 Ga0105247_10296440 3300009101 Bacteria 1120
200 Ga0114129_10285530 3300009147 Unclassified 2204
201 Ga0105243_10361700 3300009148 Bacteria 1336
202 Ga0105243_10920563 3300009148 Bacteria 871
203 Ga0105243_11277553 3300009148 Bacteria 750
204 Ga0105241_10595062 3300009174 Bacteria 998
205 Ga0105241_11402756 3300009174 Unclassified 669
206 Ga0105242_10183541 3300009176 Bacteria 1847
207 Ga0105242_11004511 3300009176 Unclassified 842
208 Ga0105248_10172172 3300009177 Unclassified 2440
209 Ga0105248_11603911 3300009177 Bacteria 737
210 Ga0105237_10387661 3300009545 Bacteria 1402
211 Ga0105237_10584681 3300009545 Bacteria 1124
212 Ga0105237_12175633 3300009545 Unclassified 564
213 Ga0105238_11117109 3300009551 Unclassified 811
214 Ga0105249_10025192 3300009553 Bacteria 5352
215 Ga0105249_10042139 3300009553 Unclassified 4151
216 Ga0105249_10661759 3300009553 Unclassified 1102
217 Ga0099796_10011394 3300010159 Bacteria 2480
218 Ga0099796_10128436 3300010159 Unclassified 980
219 Ga0105239_10094819 3300010375 Bacteria 3296
220 Ga0105239_10211708 3300010375 Bacteria 2173
221 Ga0105239_10309917 3300010375 Bacteria 1779
222 Ga0105239_11962870 3300010375 Unclassified 679
223 Ga0105239_13510266 3300010375 Unclassified 510
224 Ga0105246_10117456 3300011119 Unclassified 1965
225 Ga0157371_11112818 3300013102 Bacteria 606
226 Ga0157371_11145429 3300013102 Unclassified 598
227 Ga0157369_12378774 3300013105 Unclassified 537
228 Ga0157374_10045827 3300013296 Bacteria 4047
229 Ga0157374_10081146 3300013296 Unclassified 3078
230 Ga0157374_10212012 3300013296 Bacteria 1899
231 Ga0157374_10225950 3300013296 Bacteria 1838
232 Ga0157374_10258367 3300013296 Bacteria 1715
233 Ga0157374_10346142 3300013296 Bacteria 1476
234 Ga0157378_10028828 3300013297 Bacteria 4900
235 Ga0157378_10064719 3300013297 Unclassified 3272
236 Ga0157378_10111907 3300013297 Bacteria 2504
237 Ga0157378_10225346 3300013297 Bacteria 1784
238 Ga0157378_12036762 3300013297 Unclassified 624
239 Ga0163162_10083996 3300013306 Bacteria 3259
240 Ga0163162_11842310 3300013306 Unclassified 692
241 Ga0163162_12373466 3300013306 Unclassified 610
242 Ga0157372_10211979 3300013307 Bacteria 2245
243 Ga0157372_10360189 3300013307 Unclassified 1695
244 Ga0157375_10002759 3300013308 Bacteria 15191
245 Ga0157375_10023260 3300013308 Bacteria 5715
246 Ga0157375_10909961 3300013308 Unclassified 1023
247 Ga0157375_12068937 3300013308 Unclassified 677
248 Ga0157375_13077206 3300013308 Bacteria 557
249 Ga0163163_10108858 3300014325 Unclassified 2798
250 Ga0163163_10125396 3300014325 Bacteria 2605
251 Ga0163163_10203615 3300014325 Unclassified 2028
252 Ga0163163_12212061 3300014325 Bacteria 609
253 Ga0163163_13128206 3300014325 Unclassified 516
254 Ga0182008_10023042 3300014497 Unclassified 3185
255 Ga0157377_10056455 3300014745 Unclassified 2230
256 Ga0157377_10081498 3300014745 Bacteria 1893
257 Ga0157377_11077656 3300014745 Unclassified 614
258 Ga0157379_10003796 3300014968 Bacteria 12869
259 Ga0157379_10884295 3300014968 Unclassified 847
260 Ga0157376_10052701 3300014969 Bacteria 3384
261 Ga0157376_10125127 3300014969 Unclassified 2285
262 Ga0157376_11939151 3300014969 Unclassified 626
263 Ga0157376_12670981 3300014969 Unclassified 539
264 Ga0182005_1010196 3300015265 Bacteria 2708
265 Ga0163161_10359632 3300017792 Bacteria 1159
266 Ga0163161_12034062 3300017792 Bacteria 511
267 Ga0207666_1000268 3300025271 Bacteria 7510
268 Ga0207666_1009433 3300025271 Bacteria 1319
269 Ga0207673_1010715 3300025290 Bacteria 1182
270 Ga0207673_1013482 3300025290 Bacteria 1073
271 Ga0207673_1019498 3300025290 Unclassified 911
272 Ga0207697_10000749 3300025315 Bacteria 18385
273 Ga0207697_10000856 3300025315 Bacteria 17220
274 Ga0207697_10006618 3300025315 Bacteria 5225
275 Ga0207697_10010369 3300025315 Bacteria 3986
276 Ga0207697_10497844 3300025315 Bacteria 538
277 Ga0207653_10008138 3300025885 Bacteria 3267
278 Ga0207692_10183027 3300025898 Unclassified 1222
279 Ga0207688_10222228 3300025901 Unclassified 1138
280 Ga0207688_10910379 3300025901 Unclassified 557
281 Ga0207680_10214027 3300025903 Bacteria 1319
282 Ga0207680_10280137 3300025903 Unclassified 1158
283 Ga0207647_10155025 3300025904 Unclassified 1338
284 Ga0207647_10383558 3300025904 Bacteria 793
285 Ga0207685_10046721 3300025905 Bacteria 1649
286 Ga0207699_10994768 3300025906 Unclassified 620
287 Ga0207645_10011103 3300025907 Bacteria 6162
288 Ga0207645_10069142 3300025907 Bacteria 2259
289 Ga0207643_10434994 3300025908 Bacteria 833
290 Ga0207684_10018897 3300025910 Bacteria 5894
291 Ga0207684_11709723 3300025910 Bacteria 507
292 Ga0207654_10191965 3300025911 Bacteria 1339
293 Ga0207707_10305313 3300025912 Unclassified 1375
294 Ga0207671_10279162 3300025914 Bacteria 1317
295 Ga0207671_10363132 3300025914 Bacteria 1149
296 Ga0207693_10392744 3300025915 Unclassified 1085
297 Ga0207693_10570658 3300025915 Unclassified 882
298 Ga0207693_10880744 3300025915 Unclassified 687
299 Ga0207663_10047801 3300025916 Bacteria 2644
300 Ga0207663_10224255 3300025916 Unclassified 1369
301 Ga0207663_10569407 3300025916 Bacteria 887
302 Ga0207660_10132666 3300025917 Unclassified 1897
303 Ga0207662_10013346 3300025918 Bacteria 4593
304 Ga0207662_10116547 3300025918 Unclassified 1671
305 Ga0207657_10061798 3300025919 Unclassified 3210
306 Ga0207657_10227539 3300025919 Bacteria 1492
307 Ga0207657_10835211 3300025919 Unclassified 711
308 Ga0207657_10993757 3300025919 Unclassified 644
309 Ga0207657_11144755 3300025919 Bacteria 593
310 Ga0207649_10036337 3300025920 Unclassified 2966
311 Ga0207649_10173956 3300025920 Unclassified 1502
312 Ga0207652_10335870 3300025921 Unclassified 1364
313 Ga0207646_10046523 3300025922 Bacteria 3892
314 Ga0207646_11618220 3300025922 Unclassified 558
315 Ga0207681_10074976 3300025923 Bacteria 2371
316 Ga0207681_11417544 3300025923 Unclassified 583
317 Ga0207659_10164581 3300025926 Bacteria 1744
318 Ga0207659_10393722 3300025926 Bacteria 1157
319 Ga0207659_10716653 3300025926 Unclassified 857
320 Ga0207687_10174366 3300025927 Bacteria 1661
321 Ga0207664_10028747 3300025929 Bacteria 4228
322 Ga0207644_10390936 3300025931 Unclassified 1135
323 Ga0207644_10530937 3300025931 Bacteria 973
324 Ga0207644_10862190 3300025931 Unclassified 758
325 Ga0207690_10001098 3300025932 Bacteria 17229
326 Ga0207690_10151219 3300025932 Bacteria 1721
327 Ga0207706_10015719 3300025933 Bacteria 6840
328 Ga0207706_10036596 3300025933 Unclassified 4360
329 Ga0207706_10085231 3300025933 Bacteria 2778
330 Ga0207706_10473481 3300025933 Bacteria 1082
331 Ga0207686_10191744 3300025934 Bacteria 1457
332 Ga0207686_11663946 3300025934 Unclassified 527
333 Ga0207670_10005497 3300025936 Bacteria 6964
334 Ga0207670_10031417 3300025936 Bacteria 3403
335 Ga0207670_10247384 3300025936 Unclassified 1376
336 Ga0207669_10441468 3300025937 Bacteria 1029
337 Ga0207704_10287209 3300025938 Bacteria 1253
338 Ga0207704_10731229 3300025938 Unclassified 822
339 Ga0207704_11961443 3300025938 Unclassified 504
340 Ga0207665_10037428 3300025939 Bacteria 3229
341 Ga0207665_10087773 3300025939 Unclassified 2150
342 Ga0207665_11399864 3300025939 Unclassified 557
343 Ga0207711_10261233 3300025941 Bacteria 1591
344 Ga0207689_10234624 3300025942 Bacteria 1516
345 Ga0207689_11521684 3300025942 Unclassified 558
346 Ga0207661_10594534 3300025944 Bacteria 1015
347 Ga0207661_12128106 3300025944 Unclassified 507
348 Ga0207679_10587696 3300025945 Bacteria 1002
349 Ga0207679_10741454 3300025945 Bacteria 893
350 Ga0207679_11002892 3300025945 Unclassified 765
351 Ga0207651_10173640 3300025960 Bacteria 1702
352 Ga0207651_12026720 3300025960 Unclassified 517
353 Ga0207712_10097506 3300025961 Bacteria 2178
354 Ga0207668_10060801 3300025972 Bacteria 2653
355 Ga0207668_11101776 3300025972 Unclassified 712
356 Ga0207668_11832053 3300025972 Unclassified 547
357 Ga0207640_11232506 3300025981 Unclassified 666
358 Ga0207658_10592607 3300025986 Bacteria 995
359 Ga0207658_11716487 3300025986 Unclassified 573
360 Ga0207677_10152901 3300026023 Bacteria 1783
361 Ga0207677_10676683 3300026023 Bacteria 913
362 Ga0207677_10843373 3300026023 Unclassified 823
363 Ga0207677_11034536 3300026023 Unclassified 746
364 Ga0207703_10029366 3300026035 Unclassified 4338
365 Ga0207703_11612090 3300026035 Bacteria 624
366 Ga0207678_10957830 3300026067 Unclassified 757
367 Ga0207708_10025715 3300026075 Unclassified 4455
368 Ga0207702_10039001 3300026078 Unclassified 3979
369 Ga0207702_12445879 3300026078 Unclassified 509
370 Ga0207641_10019247 3300026088 Bacteria 5602
371 Ga0207641_11909963 3300026088 Unclassified 595
372 Ga0207648_10973471 3300026089 Bacteria 794
373 Ga0207676_10063412 3300026095 Bacteria 2935
374 Ga0207675_100489437 3300026118 Bacteria 1223
375 Ga0207675_101258951 3300026118 Unclassified 760
376 Ga0207675_101417382 3300026118 Unclassified 715
377 Ga0207683_10033937 3300026121 Bacteria 4434
378 Ga0207683_10200517 3300026121 Bacteria 1814
379 Ga0210002_1054701 3300027617 Bacteria 691
380 Ga0209974_10304829 3300027876 Unclassified 610
381 Ga0268266_10013533 3300028379 Bacteria 7025
382 Ga0268266_11746711 3300028379 Bacteria 597
383 Ga0268265_10828242 3300028380 Unclassified 904
384 Ga0268264_10006406 3300028381 Bacteria 9914
385 Ga0268264_11283364 3300028381 Bacteria 742
386 Ga0373944_0126510 3300035089 Unclassified 885
387 Ga0373944_0235045 3300035089 Unclassified 673
388 Ga0373923_0386695 3300035111 Unclassified 672
389 Ga0373945_0467927 3300035116 Unclassified 559
390 Ga0373954_0648766 3300035118 Unclassified 523
391 Ga0373956_0017332 3300035119 Bacteria 3036
392 Ga0373943_0104474 3300035170 Unclassified 1486
393 Ga0373943_0249365 3300035170 Bacteria 997
394 Ga0373955_1023174 3300035172 Unclassified 509
395 Ga0373924_0129421 3300035410 Unclassified 1098
396 Ga0373935_0044156 3300035692 Bacteria 2808
397 Ga0373927_0118968 3300035695 Bacteria 1724
398 Ga0373927_0483834 3300035695 Bacteria 818
399 Ga0373933_0031573 3300035724 Unclassified 3073
400 Ga0373947_0044726 3300035725 Unclassified 2648
401 Ga0373947_0215806 3300035725 Bacteria 1260
402 Ga0373947_0985556 3300035725 Bacteria 575
403 Ga0373937_0047738 3300036401 Bacteria 3918
404 Ga0373937_1012429 3300036401 Unclassified 779
405 Ga0373937_1358763 3300036401 Unclassified 658
406 Ga0373925_0178732 3300037068 Bacteria 1678
407 Ga0373925_0682843 3300037068 Unclassified 846
408 Ga0395900_0753168 3300037418 Unclassified 904
409 Ga0395900_1811715 3300037418 Unclassified 521
410 Ga0395905_0610211 3300037471 Unclassified 993
411 Ga0395901_0722472 3300038443 Bacteria 992
412 Ga0451795_1629900 3300041456 Unclassified 508
413 Ga0451853_3708832 3300041512 Bacteria 802
414 Ga0439448_0052373 3300042005 Unclassified 1338
415 Ga0439455_0006219 3300042012 Bacteria 2468
416 Ga0439458_0007055 3300042157 Bacteria 2502
417 Ga0439464_0009116 3300042439 Unclassified 2608
418 Ga0439460_0086990 3300042461 Bacteria 988
419 Ga0466965_0759650 3300044683 Unclassified 559
420 Ga0466967_0099443 3300045976 Bacteria 2657
421 Ga0495592_0002664 3300046454 Bacteria 12625
422 Ga0495592_0946782 3300046454 Unclassified 504
423 Ga0495603_0837279 3300046455 Unclassified 524
424 Ga0495641_0064367 3300046461 Unclassified 1652
425 Ga0495582_0071860 3300046473 Bacteria 1914
426 Ga0495605_0252870 3300046474 Bacteria 754
427 Ga0495664_0867486 3300046477 Unclassified 529
428 Ga0495594_0696948 3300046499 Unclassified 574
429 Ga0495608_0263432 3300046511 Bacteria 1073
430 Ga0495618_0187964 3300046514 Bacteria 1311
431 Ga0495628_0118782 3300046516 Bacteria 2029
432 Ga0495630_0020812 3300046517 Bacteria 4841
433 Ga0495630_0356446 3300046517 Bacteria 1119
434 Ga0495663_0192305 3300046525 Bacteria 710
435 Ga0495652_0019989 3300046529 Bacteria 5956
436 Ga0495665_0154545 3300046531 Bacteria 1197
437 Ga0495586_0087036 3300046535 Unclassified 1722
438 Ga0495587_0202774 3300046536 Bacteria 1121
439 Ga0495645_0010882 3300046543 Bacteria 6389
440 Ga0495667_0835980 3300046559 Unclassified 567
441 Ga0495656_0489003 3300046615 Unclassified 652
442 Ga0495634_0124217 3300046642 Bacteria 1651
443 Ga0495635_0305758 3300046663 Bacteria 1066
444 Ga0495635_0420820 3300046663 Unclassified 886
445 Ga0495657_0614343 3300046675 Bacteria 628
446 Ga0495599_0024676 3300046678 Unclassified 3760
447 Ga0495623_0069071 3300046679 Bacteria 2202
448 Ga0495646_0025075 3300046680 Bacteria 3751
449 Ga0495669_0205133 3300046684 Bacteria 943
450 Ga0495669_0303173 3300046684 Unclassified 770
451 Ga0495613_0035241 3300046689 Unclassified 3715
452 Ga0495613_0416230 3300046689 Bacteria 915
453 Ga0495613_0691984 3300046689 Unclassified 672
454 Ga0495600_0767881 3300046809 Unclassified 576
455 Ga0495581_0473714 3300047315 Unclassified 728
456 Ga0495604_0090371 3300047317 Bacteria 2274
457 Ga0495604_0857149 3300047317 Unclassified 570
458 Ga0495674_0193470 3300047319 Bacteria 1689
459 Ga0495674_0350773 3300047319 Unclassified 1198
460 Ga0495674_0642227 3300047319 Bacteria 837
461 Ga0495676_0199906 3300047321 Bacteria 1389
462 Ga0495676_0214520 3300047321 Unclassified 1330
463 Ga0495680_0133830 3300047322 Unclassified 1819
464 Ga0495680_0214428 3300047322 Unclassified 1377
465 Ga0495680_0796262 3300047322 Bacteria 618
466 Ga0495684_0032260 3300047471 Unclassified 4020
467 Ga0495614_0357353 3300048089 Unclassified 682
468 Ga0496101_0041001 3300048904 Unclassified 3299
469 Ga0496101_0215457 3300048904 Bacteria 1489
470 Ga0496101_0421747 3300048904 Unclassified 1052
471 Ga0496102_0052897 3300048905 Bacteria 3701
472 Ga0496102_0672292 3300048905 Bacteria 959
473 Ga0496102_0725592 3300048905 Unclassified 916
474 Ga0496102_0934249 3300048905 Unclassified 789
475 Ga0496103_0866430 3300048906 Unclassified 567
476 Ga0496104_0213629 3300048907 Bacteria 1841
477 Ga0496104_0227069 3300048907 Bacteria 1779
478 Ga0496104_0387381 3300048907 Bacteria 1310
479 Ga0496105_0067315 3300048908 Bacteria 2957
480 Ga0496106_0165595 3300048909 Unclassified 1750
481 Ga0496106_0646502 3300048909 Bacteria 845
482 Ga0496107_0684096 3300048910 Bacteria 755
483 Ga0496108_0104028 3300048911 Bacteria 2423
484 Ga0496108_0298172 3300048911 Bacteria 1404
485 Ga0496109_0064048 3300048912 Bacteria 3363
486 Ga0496109_0253693 3300048912 Unclassified 1657
487 Ga0496109_0642329 3300048912 Unclassified 998
488 Ga0496109_0849138 3300048912 Unclassified 851
489 Ga0496110_0752909 3300048913 Bacteria 877
490 Ga0496111_0216233 3300048914 Bacteria 1424
491 Ga0496112_0113667 3300048915 Unclassified 2678
492 Ga0496112_0708776 3300048915 Bacteria 934
493 Ga0496112_1064849 3300048915 Bacteria 727
494 Ga0496112_1079009 3300048915 Bacteria 721
495 Ga0496113_0246354 3300048916 Unclassified 1426
496 Ga0496113_0417379 3300048916 Bacteria 1078
497 Ga0496113_0962497 3300048916 Unclassified 673
498 Ga0496114_0017959 3300048917 Bacteria 5716
499 Ga0496115_0001716 3300048918 Bacteria 15716
500 Ga0496115_0244144 3300048918 Bacteria 1480
501 Ga0501069_0910625 3300049585 Bacteria 535
502 nmdc:mga08y16_1316386_c1 3300050511 Unclassified 688
503 nmdc:mga0n895_329119_c1 3300050512 Unclassified 1548
504 nmdc:mga0a205_554245_c1 3300050515 Bacteria 1004
505 Ga0495601_0012359 3300053077 Bacteria 5121
506 Ga0495612_0092595 3300053078 Bacteria 1281
507 Ga0495595_0080483 3300053084 Bacteria 1551
508 Ga0495619_0184828 3300053085 Unclassified 1442
509 Ga0495619_0564950 3300053085 Bacteria 780
510 Ga0070708_100063956
511 JGI24743J22301_10034631
512 JGI24035J26624_1000465
513 JGI24035J26624_1001974
514 JGI24035J26624_1002629
515 JGI24035J26624_1004258
516 JGI25406J46586_10172823
517 JGI25405J52794_10007332
518 Ga0065704_10103656
519 Ga0065704_10752565
520 Ga0065704_10754547
521 Ga0065712_10004569
522 Ga0065712_10004648
523 Ga0065712_10083012
524 Ga0065712_10098852
525 Ga0065712_10249503
526 Ga0065715_10005929
527 Ga0065715_10012383
528 Ga0065715_10015712
529 Ga0065715_10019087
530 Ga0065715_10030886
531 Ga0065715_10201483
532 Ga0065707_10029172
533 Ga0065707_10601167
534 Ga0065707_10617817
535 Ga0065707_10651010
536 Ga0070658_10328049
537 Ga0070676_10103002
538 Ga0070683_100046593
539 Ga0070683_100464777
540 Ga0070683_101029522
541 Ga0070683_101425642
542 Ga0070690_100138819
543 Ga0070670_100170106
544 Ga0068869_100192703
545 Ga0070680_100100326
546 Ga0068868_100322364
547 Ga0068868_100370468
548 Ga0068868_100933116
549 Ga0070660_100325282
550 Ga0070660_100712592
551 Ga0070660_100873646
552 Ga0070689_100002634
553 Ga0070689_100044051
554 Ga0070689_100551136
555 Ga0070689_100587263
556 Ga0070689_101265515
557 Ga0070687_100083866
558 Ga0070687_100599342
559 Ga0070661_100267320
560 Ga0070692_10115856
561 Ga0070668_100442939
562 Ga0070668_100731281
563 Ga0070669_100070015
564 Ga0070669_100448842
565 Ga0070675_100017002
566 Ga0070675_100101130
567 Ga0070675_100120621
568 Ga0070675_100351260
569 Ga0070671_100130628
570 Ga0070671_100415954
571 Ga0070671_100612271
572 Ga0070674_100218432
573 Ga0070674_100609119
574 Ga0070673_100012707
575 Ga0070673_101702472
576 Ga0070673_101755339
577 Ga0070688_100062436
578 Ga0070688_101422108
579 Ga0070659_100001154
580 Ga0070659_100100162
581 Ga0070659_100175804
582 Ga0070659_100422393
583 Ga0070667_100122908
584 Ga0070667_100423133
585 Ga0070667_100974770
586 Ga0070667_101368878
587 Ga0070703_10102868
588 Ga0070709_10180878
589 Ga0070709_11394953
590 Ga0070714_100030753
591 Ga0070714_101396614
592 Ga0070714_102185154
593 Ga0070713_100245218
594 Ga0070710_10050922
595 Ga0070701_10164962
596 Ga0070701_11053213
597 Ga0070711_100126397
598 Ga0070711_100281221
599 Ga0070705_100016698
600 Ga0070705_100040404
601 Ga0070700_100088957
602 Ga0070694_100181049
603 Ga0070694_100632289
604 Ga0070708_100242921
605 Ga0070663_101115880
606 Ga0070663_101219870
607 Ga0070678_100186170
608 Ga0070662_100022986
609 Ga0070662_100128386
610 Ga0070662_100246504
611 Ga0070662_100515573
612 Ga0070662_100566866
613 Ga0070662_101782743
614 Ga0070681_10030785
615 Ga0070681_10820057
616 Ga0068867_101341430
617 Ga0070685_10073318
618 Ga0070685_10475795
619 Ga0070685_10683830
620 Ga0070706_100048571
621 Ga0070706_101800660
622 Ga0070707_100050676
623 Ga0070707_100202010
624 Ga0070707_100790679
625 Ga0070707_100845136
626 Ga0070707_102264407
627 Ga0070698_100001933
628 Ga0070699_100194481
629 Ga0070679_100084397
630 Ga0070684_100001312
631 Ga0070684_100047615
632 Ga0070697_100020725
633 Ga0070697_100782935
634 Ga0070672_100807684
635 Ga0070686_100058959
636 Ga0070686_100309935
637 Ga0070686_100475027
638 Ga0070693_100366843
639 Ga0070665_100016091
640 Ga0070665_100054248
641 Ga0070665_100113660
642 Ga0070665_100816313
643 Ga0070704_100024717
644 Ga0070704_100095856
645 Ga0070704_101069947
646 Ga0070664_100156352
647 Ga0070664_100505074
648 Ga0068854_100894284
649 Ga0068856_100382620
650 Ga0068856_101275100
651 Ga0068856_102693427
652 Ga0070702_100053339
653 Ga0070702_101290909
654 Ga0068859_100390850
655 Ga0068864_100173437
656 Ga0068864_101644520
657 Ga0068866_10806855
658 Ga0068861_100393552
659 Ga0068863_100489862
660 Ga0068858_100118968
661 Ga0068860_100026862
662 Ga0068860_100223238
663 Ga0068860_101455001
664 Ga0068862_100360231
665 Ga0068862_100519677
666 Ga0081455_10001399
667 Ga0081455_10003842
668 Ga0081455_10006698
669 Ga0081455_10022422
670 Ga0081455_10050883
671 Ga0081455_10568928
672 Ga0081540_1000036
673 Ga0081540_1046210
674 Ga0081539_10028564
675 Ga0081539_10108100
676 Ga0070717_10700500
677 Ga0070715_10059392
678 Ga0070715_10542856
679 Ga0070716_100161888
680 Ga0070716_100353815
681 Ga0070716_100493504
682 Ga0070716_100513631
683 Ga0070712_100118092
684 Ga0070712_100125751
685 Ga0070712_100330603
686 Ga0070712_100693640
687 Ga0070712_100845968
688 Ga0070712_100940083
689 Ga0097621_100109208
690 Ga0097621_101519493
691 Ga0068871_100990172
692 Ga0068871_102143689
693 Ga0075428_100782234
694 Ga0075428_100805005
695 Ga0068865_100058216
696 Ga0097620_100390830
697 Ga0075435_101204410
698 Ga0099794_10248392
699 Ga0099794_10342698
700 Ga0099795_10109797
701 Ga0105251_10113212
702 Ga0105250_10158008
703 Ga0105250_10174476
704 Ga0111539_10833688
705 Ga0105245_10065631
706 Ga0105245_10242370
707 Ga0105245_11350674
708 Ga0105247_10296440
709 Ga0114129_10285530
710 Ga0105243_10361700
711 Ga0105243_10920563
712 Ga0105243_11277553
713 Ga0105241_10595062
714 Ga0105241_11402756
715 Ga0105242_10183541
716 Ga0105242_11004511
717 Ga0105248_10172172
718 Ga0105248_11603911
719 Ga0105237_10387661
720 Ga0105237_10584681
721 Ga0105237_12175633
722 Ga0105238_11117109
723 Ga0105249_10025192
724 Ga0105249_10042139
725 Ga0105249_10661759
726 Ga0099796_10011394
727 Ga0099796_10128436
728 Ga0105239_10094819
729 Ga0105239_10211708
730 Ga0105239_10309917
731 Ga0105239_11962870
732 Ga0105239_13510266
733 Ga0105246_10117456
734 Ga0157371_11112818
735 Ga0157371_11145429
736 Ga0157369_12378774
737 Ga0157374_10045827
738 Ga0157374_10081146
739 Ga0157374_10212012
740 Ga0157374_10225950
741 Ga0157374_10258367
742 Ga0157374_10346142
743 Ga0157378_10028828
744 Ga0157378_10064719
745 Ga0157378_10111907
746 Ga0157378_10225346
747 Ga0157378_12036762
748 Ga0163162_10083996
749 Ga0163162_11842310
750 Ga0163162_12373466
751 Ga0157372_10211979
752 Ga0157372_10360189
753 Ga0157375_10002759
754 Ga0157375_10023260
755 Ga0157375_10909961
756 Ga0157375_12068937
757 Ga0157375_13077206
758 Ga0163163_10108858
759 Ga0163163_10125396
760 Ga0163163_10203615
761 Ga0163163_12212061
762 Ga0163163_13128206
763 Ga0182008_10023042
764 Ga0157377_10056455
765 Ga0157377_10081498
766 Ga0157377_11077656
767 Ga0157379_10003796
768 Ga0157379_10884295
769 Ga0157376_10052701
770 Ga0157376_10125127
771 Ga0157376_11939151
772 Ga0157376_12670981
773 Ga0182005_1010196
774 Ga0163161_10359632
775 Ga0163161_12034062
776 Ga0207666_1000268
777 Ga0207666_1009433
778 Ga0207673_1010715
779 Ga0207673_1013482
780 Ga0207673_1019498
781 Ga0207697_10000749
782 Ga0207697_10000856
783 Ga0207697_10006618
784 Ga0207697_10010369
785 Ga0207697_10497844
786 Ga0207653_10008138
787 Ga0207692_10183027
788 Ga0207688_10222228
789 Ga0207688_10910379
790 Ga0207680_10214027
791 Ga0207680_10280137
792 Ga0207647_10155025
793 Ga0207647_10383558
794 Ga0207685_10046721
795 Ga0207699_10994768
796 Ga0207645_10011103
797 Ga0207645_10069142
798 Ga0207643_10434994
799 Ga0207684_10018897
800 Ga0207684_11709723
801 Ga0207654_10191965
802 Ga0207707_10305313
803 Ga0207671_10279162
804 Ga0207671_10363132
805 Ga0207693_10392744
806 Ga0207693_10570658
807 Ga0207693_10880744
808 Ga0207663_10047801
809 Ga0207663_10224255
810 Ga0207663_10569407
811 Ga0207660_10132666
812 Ga0207662_10013346
813 Ga0207662_10116547
814 Ga0207657_10061798
815 Ga0207657_10227539
816 Ga0207657_10835211
817 Ga0207657_10993757
818 Ga0207657_11144755
819 Ga0207649_10036337
820 Ga0207649_10173956
821 Ga0207652_10335870
822 Ga0207646_10046523
823 Ga0207646_11618220
824 Ga0207681_10074976
825 Ga0207681_11417544
826 Ga0207659_10164581
827 Ga0207659_10393722
828 Ga0207659_10716653
829 Ga0207687_10174366
830 Ga0207664_10028747
831 Ga0207644_10390936
832 Ga0207644_10530937
833 Ga0207644_10862190
834 Ga0207690_10001098
835 Ga0207690_10151219
836 Ga0207706_10015719
837 Ga0207706_10036596
838 Ga0207706_10085231
839 Ga0207706_10473481
840 Ga0207686_10191744
841 Ga0207686_11663946
842 Ga0207670_10005497
843 Ga0207670_10031417
844 Ga0207670_10247384
845 Ga0207669_10441468
846 Ga0207704_10287209
847 Ga0207704_10731229
848 Ga0207704_11961443
849 Ga0207665_10037428
850 Ga0207665_10087773
851 Ga0207665_11399864
852 Ga0207711_10261233
853 Ga0207689_10234624
854 Ga0207689_11521684
855 Ga0207661_10594534
856 Ga0207661_12128106
857 Ga0207679_10587696
858 Ga0207679_10741454
859 Ga0207679_11002892
860 Ga0207651_10173640
861 Ga0207651_12026720
862 Ga0207712_10097506
863 Ga0207668_10060801
864 Ga0207668_11101776
865 Ga0207668_11832053
866 Ga0207640_11232506
867 Ga0207658_10592607
868 Ga0207658_11716487
869 Ga0207677_10152901
870 Ga0207677_10676683
871 Ga0207677_10843373
872 Ga0207677_11034536
873 Ga0207703_10029366
874 Ga0207703_11612090
875 Ga0207678_10957830
876 Ga0207708_10025715
877 Ga0207702_10039001
878 Ga0207702_12445879
879 Ga0207641_10019247
880 Ga0207641_11909963
881 Ga0207648_10973471
882 Ga0207676_10063412
883 Ga0207675_100489437
884 Ga0207675_101258951
885 Ga0207675_101417382
886 Ga0207683_10033937
887 Ga0207683_10200517
888 Ga0210002_1054701
889 Ga0209974_10304829
890 Ga0268266_10013533
891 Ga0268266_11746711
892 Ga0268265_10828242
893 Ga0268264_10006406
894 Ga0268264_11283364
895 Ga0373944_0126510
896 Ga0373944_0235045
897 Ga0373923_0386695
898 Ga0373945_0467927
899 Ga0373954_0648766
900 Ga0373956_0017332
901 Ga0373943_0104474
902 Ga0373943_0249365
903 Ga0373955_1023174
904 Ga0373924_0129421
905 Ga0373935_0044156
906 Ga0373927_0118968
907 Ga0373927_0483834
908 Ga0373933_0031573
909 Ga0373947_0044726
910 Ga0373947_0215806
911 Ga0373947_0985556
912 Ga0373937_0047738
913 Ga0373937_1012429
914 Ga0373937_1358763
915 Ga0373925_0178732
916 Ga0373925_0682843
917 Ga0395900_0753168
918 Ga0395900_1811715
919 Ga0395905_0610211
920 Ga0395901_0722472
921 Ga0451795_1629900
922 Ga0451853_3708832
923 Ga0439448_0052373
924 Ga0439455_0006219
925 Ga0439458_0007055
926 Ga0439464_0009116
927 Ga0439460_0086990
928 Ga0466965_0759650
929 Ga0466967_0099443
930 Ga0495592_0002664
931 Ga0495592_0946782
932 Ga0495603_0837279
933 Ga0495641_0064367
934 Ga0495582_0071860
935 Ga0495605_0252870
936 Ga0495664_0867486
937 Ga0495594_0696948
938 Ga0495608_0263432
939 Ga0495618_0187964
940 Ga0495628_0118782
941 Ga0495630_0020812
942 Ga0495630_0356446
943 Ga0495663_0192305
944 Ga0495652_0019989
945 Ga0495665_0154545
946 Ga0495586_0087036
947 Ga0495587_0202774
948 Ga0495645_0010882
949 Ga0495667_0835980
950 Ga0495656_0489003
951 Ga0495634_0124217
952 Ga0495635_0305758
953 Ga0495635_0420820
954 Ga0495657_0614343
955 Ga0495599_0024676
956 Ga0495623_0069071
957 Ga0495646_0025075
958 Ga0495669_0205133
959 Ga0495669_0303173
960 Ga0495613_0035241
961 Ga0495613_0416230
962 Ga0495613_0691984
963 Ga0495600_0767881
964 Ga0495581_0473714
965 Ga0495604_0090371
966 Ga0495604_0857149
967 Ga0495674_0193470
968 Ga0495674_0350773
969 Ga0495674_0642227
970 Ga0495676_0199906
971 Ga0495676_0214520
972 Ga0495680_0133830
973 Ga0495680_0214428
974 Ga0495680_0796262
975 Ga0495684_0032260
976 Ga0495614_0357353
977 Ga0496101_0041001
978 Ga0496101_0215457
979 Ga0496101_0421747
980 Ga0496102_0052897
981 Ga0496102_0672292
982 Ga0496102_0725592
983 Ga0496102_0934249
984 Ga0496103_0866430
985 Ga0496104_0213629
986 Ga0496104_0227069
987 Ga0496104_0387381
988 Ga0496105_0067315
989 Ga0496106_0165595
990 Ga0496106_0646502
991 Ga0496107_0684096
992 Ga0496108_0104028
993 Ga0496108_0298172
994 Ga0496109_0064048
995 Ga0496109_0253693
996 Ga0496109_0642329
997 Ga0496109_0849138
998 Ga0496110_0752909
999 Ga0496111_0216233
1000 Ga0496112_0113667
1001 Ga0496112_0708776
1002 Ga0496112_1064849
1003 Ga0496112_1079009
1004 Ga0496113_0246354
1005 Ga0496113_0417379
1006 Ga0496113_0962497
1007 Ga0496114_0017959
1008 Ga0496115_0001716
1009 Ga0496115_0244144
1010 Ga0501069_0910625
1011 nmdc:mga08y16_1316386_c1
1012 nmdc:mga0n895_329119_c1
1013 nmdc:mga0a205_554245_c1
1014 Ga0495601_0012359
1015 Ga0495612_0092595
1016 Ga0495595_0080483
1017 Ga0495619_0184828
1018 Ga0495619_0564950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ogr-assembly1.cif.gz_D crystal structure of yellow fluorescent protein from zoanthus sp. at 1.8 a resolution 0.4777 43 75
3h4l-assembly3.cif.gz_B crystal structure of n terminal domain of a dna repair protein 0.476 36 81
6f3h-assembly2.cif.gz_B crystal structure of dss1 exoribonuclease active site mutant d477n from candida glabrata 0.4651 3 41
8iai-assembly1.cif.gz_2 structure of mammalian spectrin-actin junctional complex of membrane skeleton, state ii, global map 0.4577 2 59
3h4l-assembly2.cif.gz_A crystal structure of n terminal domain of a dna repair protein 0.4461 36 82
ID Description Score Start End Superfamily
af_A0A0R0KYZ0_3_70_3.40.1810.10 Alpha Beta;3-Layer(aba) Sandwich;SRF-like;Transcription factor, MADS-box 0.6358 2 31 3.40.1810.10
af_Q8VY21_109_406_3.20.90.10 Alpha Beta;Alpha-Beta Barrel;Tubby Protein; Chain A;Tubby Protein; Chain A 0.5708 43 67 3.20.90.10
2ykhB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.567 33 77 3.30.450.280
af_P9WGL5_1_135_3.30.450.280 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.5205 31 92 3.30.450.280
af_Q5NBJ3_86_311_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.5147 34 74 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A2T6E2D2-F1-model_v4 Uncharacterized protein 0.7469 11 91
AF-B9XNM6-F1-model_v4 Uncharacterized protein 0.7331 11 92
AF-A0A2V2RCT8-F1-model_v4 deleted 0.7326 11 92
AF-A0A838DIP7-F1-model_v4 Uncharacterized protein 0.6987 11 92
AF-A0A7V9J238-F1-model_v4 Uncharacterized protein 0.6978 11 95

Map