F456781

General Info

Members Datasets Scaffolds Average Seq Length
508 271 1016 161

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_101035593|Ga0070673_1010355931
Length 172
Sequence MPASPWQSIERMPSFDIVSQVDQQEVKNAIEQANKEITNRYDFKGSDARIEQKEQELTAYADDEFKLGQVRDVMYGKFAKRGVDVRFLEVGDLEKIGGDKVKQKITVKKGIEQTVAKKIVQMFKDEKLKVTASIQGEAVRVTGAKKDILQEAIAMVRANVKDIPVAFENFRD

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
220 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
221 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
222 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 0
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_101035593 3300005364 Bacteria 765
2 JGI24742J22300_10048122 3300002244 Bacteria 769
3 Ga0065707_10007722 3300005295 Bacteria 2517
4 Ga0065707_10175749 3300005295 Bacteria 1452
5 Ga0070658_10078274 3300005327 Bacteria 2713
6 Ga0070658_10095822 3300005327 Bacteria 2450
7 Ga0070676_10030170 3300005328 Bacteria 3090
8 Ga0070690_100004653 3300005330 Bacteria 7642
9 Ga0068869_100017953 3300005334 Bacteria 4808
10 Ga0068869_100021127 3300005334 Bacteria 4474
11 Ga0070666_10150628 3300005335 Bacteria 1623
12 Ga0070680_100011245 3300005336 Bacteria 6920
13 Ga0070680_100080979 3300005336 Bacteria 2678
14 Ga0070680_100132986 3300005336 Bacteria 2082
15 Ga0070682_100002224 3300005337 Bacteria 10762
16 Ga0068868_100001010 3300005338 Bacteria 19254
17 Ga0068868_100234836 3300005338 Bacteria 1539
18 Ga0068868_100760056 3300005338 Bacteria 871
19 Ga0070689_100005815 3300005340 Bacteria 8465
20 Ga0070689_100403965 3300005340 Bacteria 1155
21 Ga0070691_10010898 3300005341 Bacteria 4151
22 Ga0070687_100000645 3300005343 Bacteria 11542
23 Ga0070692_10002291 3300005345 Bacteria 7365
24 Ga0070669_100311297 3300005353 Bacteria 1269
25 Ga0070675_100008603 3300005354 Bacteria 7924
26 Ga0070675_100162741 3300005354 Bacteria 1920
27 Ga0070671_100278205 3300005355 Bacteria 1423
28 Ga0070674_100080377 3300005356 Bacteria 2327
29 Ga0070674_100593568 3300005356 Bacteria 935
30 Ga0070673_100089826 3300005364 Bacteria 2508
31 Ga0070673_100431264 3300005364 Bacteria 1183
32 Ga0070688_100560742 3300005365 Bacteria 869
33 Ga0070659_100270872 3300005366 Bacteria 1411
34 Ga0070703_10004865 3300005406 Bacteria 3753
35 Ga0070703_10290728 3300005406 Bacteria 678
36 Ga0070713_100792966 3300005436 Bacteria 908
37 Ga0070701_10000101 3300005438 Bacteria 24234
38 Ga0070711_100219482 3300005439 Unclassified 1477
39 Ga0070705_100000043 3300005440 Bacteria 63978
40 Ga0070705_100006493 3300005440 Bacteria 5738
41 Ga0070705_100009842 3300005440 Bacteria 4769
42 Ga0070705_100147848 3300005440 Bacteria 1555
43 Ga0070700_100003779 3300005441 Bacteria 7837
44 Ga0070700_100106398 3300005441 Bacteria 1857
45 Ga0070694_100006344 3300005444 Bacteria 7174
46 Ga0070694_100030371 3300005444 Bacteria 3534
47 Ga0070694_100098916 3300005444 Bacteria 2060
48 Ga0070694_100180301 3300005444 Bacteria 1562
49 Ga0070694_101299328 3300005444 Bacteria 612
50 Ga0070708_100643016 3300005445 Bacteria 1000
51 Ga0070708_101554869 3300005445 Bacteria 616
52 Ga0070681_10076561 3300005458 Bacteria 3303
53 Ga0070681_10227945 3300005458 Bacteria 1778
54 Ga0068867_100000225 3300005459 Bacteria 37110
55 Ga0070707_101176487 3300005468 Bacteria 733
56 Ga0070698_100140834 3300005471 Bacteria 2363
57 Ga0070699_100023890 3300005518 Bacteria 5269
58 Ga0070699_100157621 3300005518 Bacteria 2009
59 Ga0070699_101175141 3300005518 Bacteria 704
60 Ga0070679_100136476 3300005530 Bacteria 2434
61 Ga0070697_100030744 3300005536 Bacteria 4315
62 Ga0068853_100336520 3300005539 Bacteria 1402
63 Ga0068853_101733288 3300005539 Bacteria 605
64 Ga0070686_100019079 3300005544 Bacteria 4035
65 Ga0070686_100030485 3300005544 Bacteria 3290
66 Ga0070686_100345211 3300005544 Bacteria 1117
67 Ga0070695_100001853 3300005545 Bacteria 11935
68 Ga0070695_100002839 3300005545 Bacteria 10070
69 Ga0070695_100233431 3300005545 Bacteria 1331
70 Ga0070696_100000061 3300005546 Bacteria 52371
71 Ga0070696_100003112 3300005546 Bacteria 11038
72 Ga0070696_100051627 3300005546 Bacteria 2860
73 Ga0070696_100098596 3300005546 Bacteria 2090
74 Ga0070693_100000016 3300005547 Bacteria 63019
75 Ga0070693_100687439 3300005547 Bacteria 748
76 Ga0070665_100135614 3300005548 Bacteria 2463
77 Ga0070704_100000587 3300005549 Bacteria 17511
78 Ga0070704_100009221 3300005549 Bacteria 5952
79 Ga0070704_100124279 3300005549 Bacteria 1988
80 Ga0070704_100770637 3300005549 Bacteria 858
81 Ga0068855_100012963 3300005563 Bacteria 10058
82 Ga0068855_100024752 3300005563 Bacteria 7183
83 Ga0068857_101961998 3300005577 Bacteria 574
84 Ga0068854_100172905 3300005578 Bacteria 1682
85 Ga0068854_100316186 3300005578 Bacteria 1268
86 Ga0068854_100404203 3300005578 Bacteria 1131
87 Ga0068856_100016381 3300005614 Bacteria 7170
88 Ga0068856_100216169 3300005614 Bacteria 1932
89 Ga0068856_100382399 3300005614 Bacteria 1427
90 Ga0068856_101133772 3300005614 Bacteria 799
91 Ga0070702_100000017 3300005615 Bacteria 47208
92 Ga0070702_100006544 3300005615 Bacteria 5523
93 Ga0070702_100378430 3300005615 Bacteria 1006
94 Ga0068852_100021674 3300005616 Bacteria 5137
95 Ga0068852_100106623 3300005616 Bacteria 2540
96 Ga0068852_101368533 3300005616 Bacteria 730
97 Ga0068859_100000738 3300005617 Bacteria 32951
98 Ga0068859_100178551 3300005617 Bacteria 2205
99 Ga0068866_10000586 3300005718 Bacteria 16569
100 Ga0068866_10481263 3300005718 Bacteria 818
101 Ga0068861_100000496 3300005719 Bacteria 22901
102 Ga0068861_100004540 3300005719 Bacteria 9321
103 Ga0068861_100186835 3300005719 Bacteria 1729
104 Ga0068861_100795947 3300005719 Bacteria 887
105 Ga0068870_10075225 3300005840 Bacteria 1852
106 Ga0068870_10465947 3300005840 Bacteria 836
107 Ga0068863_100578795 3300005841 Bacteria 1110
108 Ga0068863_100797996 3300005841 Bacteria 942
109 Ga0068858_100001011 3300005842 Bacteria 28980
110 Ga0068858_100491672 3300005842 Bacteria 1185
111 Ga0068862_100005092 3300005844 Bacteria 11059
112 Ga0081539_10001342 3300005985 Bacteria 42880
113 Ga0075364_10004928 3300006051 Bacteria 7734
114 Ga0070715_10100398 3300006163 Bacteria 1349
115 Ga0070716_100068625 3300006173 Bacteria 2075
116 Ga0070716_100257499 3300006173 Bacteria 1192
117 Ga0075362_10063901 3300006177 Bacteria 1670
118 Ga0075367_10055937 3300006178 Bacteria 2343
119 Ga0075369_10000707 3300006186 Bacteria 10736
120 Ga0075366_10009565 3300006195 Bacteria 5415
121 Ga0097621_100005969 3300006237 Bacteria 8611
122 Ga0097621_100007640 3300006237 Bacteria 7749
123 Ga0068871_100010600 3300006358 Bacteria 6737
124 Ga0068871_100053831 3300006358 Bacteria 3263
125 Ga0068871_100109980 3300006358 Bacteria 2317
126 Ga0075428_100013933 3300006844 Bacteria 8953
127 Ga0075428_100208651 3300006844 Bacteria 2111
128 Ga0075428_100320911 3300006844 Bacteria 1664
129 Ga0075430_100118609 3300006846 Bacteria 2206
130 Ga0075430_100140889 3300006846 Bacteria 2008
131 Ga0075430_100261655 3300006846 Bacteria 1433
132 Ga0075431_100004543 3300006847 Bacteria 13627
133 Ga0075431_100118023 3300006847 Bacteria 2738
134 Ga0075431_100619788 3300006847 Bacteria 1064
135 Ga0075433_10117919 3300006852 Bacteria 2356
136 Ga0075433_10132986 3300006852 Bacteria 2210
137 Ga0075433_10725438 3300006852 Bacteria 870
138 Ga0075434_101187541 3300006871 Bacteria 775
139 Ga0075429_100002859 3300006880 Bacteria 14609
140 Ga0075429_100007303 3300006880 Bacteria 9589
141 Ga0075429_100080199 3300006880 Bacteria 2845
142 Ga0075429_100698692 3300006880 Bacteria 888
143 Ga0068865_100013536 3300006881 Bacteria 5158
144 Ga0068865_100016551 3300006881 Bacteria 4721
145 Ga0075436_100000456 3300006914 Bacteria 26361
146 Ga0075436_100041061 3300006914 Bacteria 3192
147 Ga0075436_100083969 3300006914 Bacteria 2210
148 Ga0075436_100147336 3300006914 Bacteria 1655
149 Ga0097620_100000738 3300006931 Bacteria 32951
150 Ga0097620_100178553 3300006931 Bacteria 2205
151 Ga0075435_100050209 3300007076 Bacteria 3356
152 Ga0075435_100051419 3300007076 Bacteria 3319
153 Ga0105240_10055510 3300009093 Bacteria 4959
154 Ga0105240_10517163 3300009093 Bacteria 1325
155 Ga0105240_11463663 3300009093 Bacteria 717
156 Ga0111539_10026228 3300009094 Bacteria 7130
157 Ga0111539_10051084 3300009094 Bacteria 4925
158 Ga0111539_10662444 3300009094 Bacteria 1215
159 Ga0111539_10790390 3300009094 Bacteria 1104
160 Ga0105245_10071299 3300009098 Bacteria 3156
161 Ga0105245_10442778 3300009098 Bacteria 1306
162 Ga0105247_10734462 3300009101 Bacteria 747
163 Ga0114129_10001202 3300009147 Bacteria 34348
164 Ga0114129_10168916 3300009147 Bacteria 2983
165 Ga0114129_10196633 3300009147 Bacteria 2734
166 Ga0114129_10207486 3300009147 Bacteria 2650
167 Ga0114129_10239617 3300009147 Bacteria 2439
168 Ga0105243_10130030 3300009148 Bacteria 2135
169 Ga0105243_11553096 3300009148 Bacteria 687
170 Ga0105243_12115933 3300009148 Bacteria 598
171 Ga0105241_10190855 3300009174 Bacteria 1705
172 Ga0105242_10034662 3300009176 Bacteria 4047
173 Ga0105242_10430776 3300009176 Bacteria 1238
174 Ga0105238_10235393 3300009551 Bacteria 1808
175 Ga0105238_11007371 3300009551 Bacteria 854
176 Ga0105238_11194646 3300009551 Bacteria 785
177 Ga0105249_10010597 3300009553 Bacteria 8099
178 Ga0105249_10011524 3300009553 Bacteria 7770
179 Ga0105249_10712945 3300009553 Bacteria 1064
180 Ga0105249_12156333 3300009553 Bacteria 630
181 Ga0105246_10690224 3300011119 Bacteria 893
182 Ga0157369_10022722 3300013105 Bacteria 6995
183 Ga0157369_11452051 3300013105 Bacteria 698
184 Ga0157378_10002191 3300013297 Bacteria 17332
185 Ga0157378_10989527 3300013297 Bacteria 875
186 Ga0157372_10004004 3300013307 Bacteria 15805
187 Ga0157372_10281948 3300013307 Bacteria 1932
188 Ga0157372_11712385 3300013307 Bacteria 723
189 Ga0157375_10234037 3300013308 Bacteria 1996
190 Ga0157375_11217277 3300013308 Bacteria 884
191 Ga0157380_10756576 3300014326 Bacteria 984
192 Ga0157379_10169196 3300014968 Bacteria 1973
193 Ga0157376_10025846 3300014969 Bacteria 4629
194 Ga0157376_10064003 3300014969 Bacteria 3100
195 Ga0157376_10498047 3300014969 Bacteria 1197
196 Ga0163161_10263479 3300017792 Bacteria 1347
197 Ga0207642_10217393 3300025899 Bacteria 1066
198 Ga0207647_10026895 3300025904 Bacteria 3757
199 Ga0207685_10365935 3300025905 Bacteria 731
200 Ga0207699_10639791 3300025906 Bacteria 776
201 Ga0207699_11065761 3300025906 Bacteria 598
202 Ga0207645_10021824 3300025907 Bacteria 4171
203 Ga0207643_10285313 3300025908 Bacteria 1024
204 Ga0207705_10047001 3300025909 Bacteria 3103
205 Ga0207705_10105736 3300025909 Bacteria 2075
206 Ga0207705_10293516 3300025909 Bacteria 1246
207 Ga0207707_10005823 3300025912 Bacteria 10768
208 Ga0207695_10089407 3300025913 Bacteria 3097
209 Ga0207695_10231158 3300025913 Bacteria 1753
210 Ga0207671_10769915 3300025914 Bacteria 764
211 Ga0207652_10053149 3300025921 Bacteria 3479
212 Ga0207652_10321087 3300025921 Bacteria 1398
213 Ga0207681_10003429 3300025923 Bacteria 9910
214 Ga0207694_10138999 3300025924 Bacteria 1952
215 Ga0207694_11143484 3300025924 Bacteria 659
216 Ga0207659_10341606 3300025926 Bacteria 1240
217 Ga0207700_10620458 3300025928 Bacteria 963
218 Ga0207690_10376130 3300025932 Bacteria 1128
219 Ga0207686_10118554 3300025934 Bacteria 1798
220 Ga0207709_10006072 3300025935 Bacteria 6810
221 Ga0207709_10078480 3300025935 Bacteria 2120
222 Ga0207670_10341562 3300025936 Bacteria 1183
223 Ga0207670_11338082 3300025936 Bacteria 608
224 Ga0207669_10038335 3300025937 Bacteria 2758
225 Ga0207669_10301066 3300025937 Bacteria 1219
226 Ga0207704_10010132 3300025938 Bacteria 4579
227 Ga0207665_10042797 3300025939 Bacteria 3028
228 Ga0207665_10170301 3300025939 Bacteria 1572
229 Ga0207665_10520926 3300025939 Bacteria 921
230 Ga0207691_10196648 3300025940 Bacteria 1756
231 Ga0207691_10669239 3300025940 Bacteria 876
232 Ga0207711_10580154 3300025941 Bacteria 1046
233 Ga0207689_10026230 3300025942 Bacteria 4879
234 Ga0207661_10075628 3300025944 Bacteria 2764
235 Ga0207667_10013185 3300025949 Bacteria 9475
236 Ga0207651_10642130 3300025960 Bacteria 931
237 Ga0207651_10928325 3300025960 Bacteria 776
238 Ga0207712_10002362 3300025961 Bacteria 12229
239 Ga0207712_11382659 3300025961 Bacteria 630
240 Ga0207640_10241893 3300025981 Bacteria 1395
241 Ga0207640_11162081 3300025981 Bacteria 685
242 Ga0207677_10068889 3300026023 Bacteria 2486
243 Ga0207677_10655346 3300026023 Bacteria 927
244 Ga0207703_10942519 3300026035 Bacteria 827
245 Ga0207639_10307940 3300026041 Bacteria 1402
246 Ga0207708_10038281 3300026075 Bacteria 3654
247 Ga0207702_10150885 3300026078 Bacteria 2114
248 Ga0207702_10374359 3300026078 Bacteria 1368
249 Ga0207674_10400041 3300026116 Bacteria 1327
250 Ga0207675_101478010 3300026118 Bacteria 700
251 Ga0207683_10130466 3300026121 Bacteria 2260
252 Ga0207698_10103876 3300026142 Bacteria 2363
253 Ga0207698_10600212 3300026142 Bacteria 1085
254 Ga0209967_1002761 3300027364 Bacteria 2286
255 Ga0209967_1027557 3300027364 Bacteria 845
256 Ga0209981_1002995 3300027378 Bacteria 2176
257 Ga0209996_1005474 3300027395 Bacteria 1626
258 Ga0210000_1002205 3300027462 Bacteria 2763
259 Ga0210000_1010012 3300027462 Bacteria 1401
260 Ga0209968_1006861 3300027526 Bacteria 1718
261 Ga0209968_1046319 3300027526 Bacteria 749
262 Ga0209999_1015085 3300027543 Bacteria 1405
263 Ga0209970_1015518 3300027614 Bacteria 1268
264 Ga0209588_1030976 3300027671 Bacteria 1710
265 Ga0209966_1025543 3300027695 Bacteria 1172
266 Ga0209974_10134697 3300027876 Bacteria 883
267 Ga0209974_10215830 3300027876 Bacteria 713
268 Ga0207428_10011171 3300027907 Bacteria 7964
269 Ga0207428_10058105 3300027907 Bacteria 3070
270 Ga0207428_10250021 3300027907 Bacteria 1322
271 Ga0207428_10755175 3300027907 Bacteria 693
272 Ga0268265_10002108 3300028380 Bacteria 15460
273 Ga0307408_100235257 3300031548 Bacteria 1502
274 Ga0307408_100798468 3300031548 Bacteria 856
275 Ga0307405_10800166 3300031731 Bacteria 790
276 Ga0307407_10566345 3300031903 Bacteria 842
277 Ga0307412_11439358 3300031911 Bacteria 625
278 Ga0307416_100157725 3300032002 Bacteria 2092
279 Ga0307416_100342050 3300032002 Bacteria 1509
280 Ga0307416_100727782 3300032002 Bacteria 1083
281 Ga0307411_10336601 3300032005 Bacteria 1225
282 Ga0307411_10909220 3300032005 Bacteria 782
283 Ga0307415_100630393 3300032126 Bacteria 958
284 Ga0307415_100984908 3300032126 Bacteria 783
285 Ga0316583_10174693 3300032133 Bacteria 747
286 Ga0373926_0124966 3300035083 Bacteria 971
287 Ga0373928_0066367 3300035084 Bacteria 883
288 Ga0373929_0002974 3300035085 Bacteria 3085
289 Ga0373944_0058597 3300035089 Bacteria 1230
290 Ga0373949_0006545 3300035090 Bacteria 2562
291 Ga0373951_0003251 3300035091 Bacteria 3978
292 Ga0373923_0036912 3300035111 Bacteria 1997
293 Ga0373923_0117901 3300035111 Bacteria 1184
294 Ga0373932_0001314 3300035112 Bacteria 6996
295 Ga0373936_0013971 3300035113 Bacteria 3067
296 Ga0373939_0025360 3300035114 Bacteria 1661
297 Ga0373941_0001753 3300035115 Bacteria 4661
298 Ga0373945_0021754 3300035116 Bacteria 2206
299 Ga0373954_0000505 3300035118 Bacteria 14601
300 Ga0373960_0002399 3300035121 Bacteria 4207
301 Ga0373960_0196673 3300035121 Bacteria 711
302 Ga0373946_0063003 3300035171 Bacteria 1582
303 Ga0373961_0019893 3300035241 Bacteria 1768
304 Ga0373961_0059632 3300035241 Bacteria 1154
305 Ga0373961_0072272 3300035241 Bacteria 1069
306 Ga0373962_0122843 3300035242 Bacteria 829
307 Ga0373931_0002540 3300035691 Bacteria 8110
308 Ga0373931_0012381 3300035691 Bacteria 4133
309 Ga0373931_0694112 3300035691 Bacteria 672
310 Ga0373935_0011448 3300035692 Bacteria 5325
311 Ga0373927_0008482 3300035695 Bacteria 6915
312 Ga0373927_0027947 3300035695 Bacteria 3681
313 Ga0373933_0009922 3300035724 Bacteria 5212
314 Ga0373933_0607643 3300035724 Bacteria 718
315 Ga0373937_0001546 3300036401 Bacteria 19330
316 Ga0373937_0064219 3300036401 Bacteria 3377
317 Ga0373925_0008212 3300037068 Bacteria 7600
318 Ga0395900_0142680 3300037418 Bacteria 2451
319 Ga0395898_1101846 3300037466 Bacteria 727
320 Ga0395905_0224572 3300037471 Bacteria 1757
321 Ga0395905_0775284 3300037471 Bacteria 862
322 Ga0395901_0008364 3300038443 Bacteria 10461
323 Ga0439436_0039292 3300041404 Bacteria 1359
324 Ga0439436_0167764 3300041404 Bacteria 622
325 Ga0439439_0035439 3300041406 Bacteria 1282
326 Ga0439431_0005315 3300041997 Bacteria 2841
327 Ga0439441_000134 3300042001 Bacteria 6182
328 Ga0439443_003147 3300042003 Bacteria 2051
329 Ga0439443_022601 3300042003 Bacteria 999
330 Ga0439446_0060470 3300042156 Bacteria 1144
331 Ga0439446_0280752 3300042156 Bacteria 581
332 Ga0439434_0000058 3300042435 Bacteria 27004
333 Ga0439434_0089707 3300042435 Bacteria 982
334 Ga0439435_0000001 3300042436 Bacteria 43463
335 Ga0439435_0071031 3300042436 Bacteria 1030
336 Ga0439444_0002002 3300042437 Bacteria 2725
337 Ga0439444_0014835 3300042437 Bacteria 1307
338 Ga0439460_0001966 3300042461 Bacteria 4921
339 Ga0439460_0004753 3300042461 Bacteria 3313
340 Ga0450893_0021292 3300042532 Bacteria 1119
341 Ga0450893_0041859 3300042532 Bacteria 841
342 Ga0453683_0218689 3300044673 Bacteria 1211
343 Ga0453683_0541498 3300044673 Bacteria 757
344 Ga0466966_0530210 3300044684 Bacteria 708
345 Ga0466961_0102242 3300044693 Bacteria 1805
346 Ga0466957_0004733 3300044842 Bacteria 7622
347 Ga0466959_0067260 3300045049 Bacteria 2598
348 Ga0451576_0043751 3300045051 Bacteria 4723
349 Ga0451576_0048475 3300045051 Bacteria 4461
350 Ga0451576_0051879 3300045051 Bacteria 4299
351 Ga0451576_0087129 3300045051 Bacteria 3247
352 Ga0451576_0211140 3300045051 Bacteria 2027
353 Ga0451576_0221258 3300045051 Bacteria 1976
354 Ga0451576_0231741 3300045051 Bacteria 1929
355 Ga0451576_0516859 3300045051 Bacteria 1254
356 Ga0466958_0079408 3300045836 Bacteria 2017
357 Ga0466967_0006276 3300045976 Bacteria 8384
358 Ga0495603_0011340 3300046455 Bacteria 5398
359 Ga0495580_0026436 3300046472 Bacteria 4231
360 Ga0495639_0031647 3300046475 Bacteria 2356
361 Ga0495608_0113382 3300046511 Bacteria 1742
362 Ga0495630_0314564 3300046517 Bacteria 1197
363 Ga0495642_0011914 3300046528 Bacteria 3349
364 Ga0495652_0322799 3300046529 Bacteria 1115
365 Ga0495586_0018239 3300046535 Bacteria 3736
366 Ga0495587_0426849 3300046536 Bacteria 735
367 Ga0495598_0008757 3300046537 Bacteria 2366
368 Ga0495621_0026230 3300046539 Bacteria 1964
369 Ga0495621_0171082 3300046539 Bacteria 863
370 Ga0495659_0014761 3300046664 Bacteria 2562
371 Ga0495647_0070785 3300046681 Bacteria 1396
372 Ga0495658_0278375 3300046683 Bacteria 1055
373 Ga0495669_0037284 3300046684 Bacteria 2151
374 Ga0495676_0068440 3300047321 Bacteria 2743
375 Ga0495677_0186480 3300047445 Bacteria 805
376 Ga0495681_0340091 3300047470 Bacteria 573
377 Ga0495615_0063370 3300048090 Bacteria 981
378 Ga0501291_046375 3300049514 Bacteria 779
379 Ga0501296_046377 3300049519 Bacteria 626
380 Ga0501299_106509 3300049522 Bacteria 658
381 Ga0501031_0067526 3300049568 Bacteria 2329
382 Ga0501031_0211109 3300049568 Bacteria 1265
383 Ga0501032_0239489 3300049569 Bacteria 1179
384 Ga0501033_0059948 3300049570 Bacteria 2809
385 Ga0501033_0213632 3300049570 Bacteria 1375
386 Ga0501036_0001716 3300049572 Bacteria 17030
387 Ga0501036_0401062 3300049572 Bacteria 1144
388 Ga0501037_0090802 3300049573 Bacteria 2209
389 Ga0501037_0125666 3300049573 Bacteria 1842
390 Ga0501038_0006982 3300049574 Bacteria 10428
391 Ga0501038_0039146 3300049574 Bacteria 4148
392 Ga0501038_0562029 3300049574 Bacteria 867
393 Ga0501039_0013309 3300049575 Bacteria 6290
394 Ga0501039_0015965 3300049575 Bacteria 5749
395 Ga0501039_0054123 3300049575 Bacteria 3106
396 Ga0501039_0168635 3300049575 Bacteria 1721
397 Ga0501039_0750884 3300049575 Bacteria 762
398 Ga0501040_0008184 3300049576 Bacteria 6797
399 Ga0501040_0014856 3300049576 Bacteria 5140
400 Ga0501040_0060566 3300049576 Bacteria 2601
401 Ga0501040_0621970 3300049576 Bacteria 780
402 Ga0501041_0020796 3300049577 Bacteria 3926
403 Ga0501041_0101228 3300049577 Bacteria 1783
404 Ga0501042_0018598 3300049578 Bacteria 4813
405 Ga0501042_0317776 3300049578 Bacteria 1125
406 Ga0501043_0105080 3300049579 Bacteria 2219
407 Ga0501046_0006823 3300049580 Bacteria 10072
408 Ga0501048_0109055 3300049582 Bacteria 1954
409 Ga0501048_0118982 3300049582 Bacteria 1866
410 Ga0501048_0608986 3300049582 Bacteria 784
411 Ga0501068_0028797 3300049584 Bacteria 3287
412 Ga0501070_0206378 3300049586 Bacteria 1613
413 Ga0501071_0029606 3300049587 Bacteria 3866
414 Ga0501071_0174473 3300049587 Bacteria 1610
415 Ga0501071_0686361 3300049587 Bacteria 788
416 Ga0501072_0001755 3300049588 Bacteria 16124
417 Ga0501072_0021171 3300049588 Bacteria 5044
418 Ga0501072_0050337 3300049588 Bacteria 3280
419 Ga0501072_0124022 3300049588 Bacteria 2058
420 Ga0501072_0196947 3300049588 Bacteria 1607
421 Ga0501072_0236394 3300049588 Bacteria 1455
422 Ga0501072_0305132 3300049588 Bacteria 1265
423 Ga0501072_1223343 3300049588 Bacteria 583
424 Ga0501073_0394476 3300049589 Bacteria 956
425 Ga0501074_0127231 3300049590 Bacteria 1823
426 Ga0501074_0252477 3300049590 Bacteria 1254
427 Ga0501074_0296982 3300049590 Bacteria 1148
428 Ga0501075_0074908 3300049591 Bacteria 2560
429 Ga0501075_0077275 3300049591 Bacteria 2519
430 Ga0501075_0079003 3300049591 Bacteria 2490
431 Ga0501075_0092811 3300049591 Bacteria 2291
432 Ga0501076_0000185 3300049592 Bacteria 37179
433 Ga0501076_0002196 3300049592 Bacteria 13366
434 Ga0501076_0060593 3300049592 Bacteria 3011
435 Ga0501077_0001199 3300049593 Bacteria 15656
436 Ga0501077_0039789 3300049593 Bacteria 2995
437 Ga0501208_066216 3300049655 Bacteria 718
438 Ga0501079_0032306 3300049741 Bacteria 4025
439 Ga0501079_0053365 3300049741 Bacteria 3118
440 Ga0501079_0090680 3300049741 Bacteria 2368
441 Ga0501079_0909627 3300049741 Bacteria 693
442 Ga0501079_1062830 3300049741 Bacteria 638
443 Ga0501080_0009074 3300049742 Bacteria 9051
444 Ga0501080_0096675 3300049742 Bacteria 2742
445 Ga0501080_0123805 3300049742 Bacteria 2395
446 Ga0501081_0001180 3300049743 Bacteria 15796
447 Ga0501081_0001515 3300049743 Bacteria 14277
448 Ga0501081_0049457 3300049743 Bacteria 2895
449 Ga0501081_0134982 3300049743 Bacteria 1766
450 Ga0501081_0434657 3300049743 Bacteria 974
451 Ga0501081_0770153 3300049743 Bacteria 724
452 Ga0501083_0071249 3300049744 Bacteria 2311
453 Ga0501083_0428329 3300049744 Bacteria 861
454 Ga0501035_0221999 3300049822 Bacteria 1613
455 Ga0501035_0350154 3300049822 Bacteria 1236
456 Ga0501035_0614679 3300049822 Bacteria 884
457 Ga0501044_1151292 3300049823 Bacteria 644
458 Ga0501045_0002002 3300049824 Bacteria 13762
459 Ga0501045_0091121 3300049824 Bacteria 2253
460 nmdc:mga03683_36293_c1 3300050489 Bacteria 2004
461 nmdc:mga03n38_182311_c1 3300050490 Bacteria 1076
462 nmdc:mga00v17_1746_c1 3300050491 Bacteria 11303
463 nmdc:mga0k408_9828_c1 3300050493 Bacteria 5166
464 nmdc:mga06z11_38698_c1 3300050494 Bacteria 1957
465 nmdc:mga05p37_22767_c1 3300050507 Bacteria 7601
466 nmdc:mga05p37_389995_c1 3300050507 Bacteria 1629
467 nmdc:mga05p37_5672_c1 3300050507 Bacteria 14675
468 nmdc:mga09592_233766_c1 3300050508 Bacteria 1593
469 nmdc:mga09592_257837_c1 3300050508 Bacteria 1512
470 nmdc:mga09592_622_c1 3300050508 Bacteria 27059
471 nmdc:mga0qj67_220526_c1 3300050509 Bacteria 1540
472 nmdc:mga0qj67_338751_c1 3300050509 Bacteria 1217
473 nmdc:mga0qj67_548243_c1 3300050509 Bacteria 927
474 nmdc:mga0qj67_5972_c1 3300050509 Bacteria 8921
475 nmdc:mga06r32_253119_c1 3300050510 Bacteria 1749
476 nmdc:mga06r32_332786_c1 3300050510 Bacteria 1504
477 nmdc:mga06r32_640122_c1 3300050510 Bacteria 1032
478 nmdc:mga06r32_6845_c1 3300050510 Bacteria 10244
479 nmdc:mga08y16_123947_c1 3300050511 Bacteria 2689
480 nmdc:mga08y16_13184_c1 3300050511 Bacteria 8694
481 nmdc:mga08y16_39678_c1 3300050511 Bacteria 4939
482 nmdc:mga0rr50_231601_c1 3300050513 Bacteria 1529
483 nmdc:mga0rr50_574804_c1 3300050513 Bacteria 960
484 nmdc:mga0rr50_575790_c1 3300050513 Bacteria 959
485 nmdc:mga0rr50_724918_c1 3300050513 Bacteria 849
486 nmdc:mga08x19_17644_c1 3300050514 Bacteria 4370
487 nmdc:mga08x19_20513_c1 3300050514 Bacteria 4069
488 nmdc:mga08x19_428_c1 3300050514 Bacteria 28852
489 nmdc:mga08x19_76601_c1 3300050514 Bacteria 2189
490 nmdc:mga08x19_9071_c1 3300050514 Bacteria 5939
491 nmdc:mga08x19_99504_c1 3300050514 Bacteria 1928
492 nmdc:mga0a205_11599_c1 3300050515 Bacteria 8120
493 nmdc:mga0a205_263401_c1 3300050515 Bacteria 1601
494 nmdc:mga0a205_758101_c1 3300050515 Bacteria 819
495 Ga0500646_0080414 3300053090 Bacteria 994
496 Ga0500568_0000029 3300053139 Bacteria 159927
497 Ga0501084_0104315 3300054114 Bacteria 2381
498 Ga0501084_0178502 3300054114 Bacteria 1793
499 Ga0501084_0310595 3300054114 Bacteria 1331
500 Ga0501084_0427446 3300054114 Bacteria 1120
501 Ga0590077_014599 3300059426 Bacteria 1637
502 Ga0501082_0071382 3300060353 Bacteria 2990
503 Ga0501082_0195142 3300060353 Bacteria 1761
504 Ga0501082_0332013 3300060353 Bacteria 1325
505 Ga0501082_0562320 3300060353 Bacteria 998
506 Ga0530510_0047085 3300061734 Bacteria 3115
507 Ga0530510_0176575 3300061734 Bacteria 1583
508 Ga0530510_0378006 3300061734 Bacteria 1066
509 Ga0070673_101035593
510 JGI24742J22300_10048122
511 Ga0065707_10007722
512 Ga0065707_10175749
513 Ga0070658_10078274
514 Ga0070658_10095822
515 Ga0070676_10030170
516 Ga0070690_100004653
517 Ga0068869_100017953
518 Ga0068869_100021127
519 Ga0070666_10150628
520 Ga0070680_100011245
521 Ga0070680_100080979
522 Ga0070680_100132986
523 Ga0070682_100002224
524 Ga0068868_100001010
525 Ga0068868_100234836
526 Ga0068868_100760056
527 Ga0070689_100005815
528 Ga0070689_100403965
529 Ga0070691_10010898
530 Ga0070687_100000645
531 Ga0070692_10002291
532 Ga0070669_100311297
533 Ga0070675_100008603
534 Ga0070675_100162741
535 Ga0070671_100278205
536 Ga0070674_100080377
537 Ga0070674_100593568
538 Ga0070673_100089826
539 Ga0070673_100431264
540 Ga0070688_100560742
541 Ga0070659_100270872
542 Ga0070703_10004865
543 Ga0070703_10290728
544 Ga0070713_100792966
545 Ga0070701_10000101
546 Ga0070711_100219482
547 Ga0070705_100000043
548 Ga0070705_100006493
549 Ga0070705_100009842
550 Ga0070705_100147848
551 Ga0070700_100003779
552 Ga0070700_100106398
553 Ga0070694_100006344
554 Ga0070694_100030371
555 Ga0070694_100098916
556 Ga0070694_100180301
557 Ga0070694_101299328
558 Ga0070708_100643016
559 Ga0070708_101554869
560 Ga0070681_10076561
561 Ga0070681_10227945
562 Ga0068867_100000225
563 Ga0070707_101176487
564 Ga0070698_100140834
565 Ga0070699_100023890
566 Ga0070699_100157621
567 Ga0070699_101175141
568 Ga0070679_100136476
569 Ga0070697_100030744
570 Ga0068853_100336520
571 Ga0068853_101733288
572 Ga0070686_100019079
573 Ga0070686_100030485
574 Ga0070686_100345211
575 Ga0070695_100001853
576 Ga0070695_100002839
577 Ga0070695_100233431
578 Ga0070696_100000061
579 Ga0070696_100003112
580 Ga0070696_100051627
581 Ga0070696_100098596
582 Ga0070693_100000016
583 Ga0070693_100687439
584 Ga0070665_100135614
585 Ga0070704_100000587
586 Ga0070704_100009221
587 Ga0070704_100124279
588 Ga0070704_100770637
589 Ga0068855_100012963
590 Ga0068855_100024752
591 Ga0068857_101961998
592 Ga0068854_100172905
593 Ga0068854_100316186
594 Ga0068854_100404203
595 Ga0068856_100016381
596 Ga0068856_100216169
597 Ga0068856_100382399
598 Ga0068856_101133772
599 Ga0070702_100000017
600 Ga0070702_100006544
601 Ga0070702_100378430
602 Ga0068852_100021674
603 Ga0068852_100106623
604 Ga0068852_101368533
605 Ga0068859_100000738
606 Ga0068859_100178551
607 Ga0068866_10000586
608 Ga0068866_10481263
609 Ga0068861_100000496
610 Ga0068861_100004540
611 Ga0068861_100186835
612 Ga0068861_100795947
613 Ga0068870_10075225
614 Ga0068870_10465947
615 Ga0068863_100578795
616 Ga0068863_100797996
617 Ga0068858_100001011
618 Ga0068858_100491672
619 Ga0068862_100005092
620 Ga0081539_10001342
621 Ga0075364_10004928
622 Ga0070715_10100398
623 Ga0070716_100068625
624 Ga0070716_100257499
625 Ga0075362_10063901
626 Ga0075367_10055937
627 Ga0075369_10000707
628 Ga0075366_10009565
629 Ga0097621_100005969
630 Ga0097621_100007640
631 Ga0068871_100010600
632 Ga0068871_100053831
633 Ga0068871_100109980
634 Ga0075428_100013933
635 Ga0075428_100208651
636 Ga0075428_100320911
637 Ga0075430_100118609
638 Ga0075430_100140889
639 Ga0075430_100261655
640 Ga0075431_100004543
641 Ga0075431_100118023
642 Ga0075431_100619788
643 Ga0075433_10117919
644 Ga0075433_10132986
645 Ga0075433_10725438
646 Ga0075434_101187541
647 Ga0075429_100002859
648 Ga0075429_100007303
649 Ga0075429_100080199
650 Ga0075429_100698692
651 Ga0068865_100013536
652 Ga0068865_100016551
653 Ga0075436_100000456
654 Ga0075436_100041061
655 Ga0075436_100083969
656 Ga0075436_100147336
657 Ga0097620_100000738
658 Ga0097620_100178553
659 Ga0075435_100050209
660 Ga0075435_100051419
661 Ga0105240_10055510
662 Ga0105240_10517163
663 Ga0105240_11463663
664 Ga0111539_10026228
665 Ga0111539_10051084
666 Ga0111539_10662444
667 Ga0111539_10790390
668 Ga0105245_10071299
669 Ga0105245_10442778
670 Ga0105247_10734462
671 Ga0114129_10001202
672 Ga0114129_10168916
673 Ga0114129_10196633
674 Ga0114129_10207486
675 Ga0114129_10239617
676 Ga0105243_10130030
677 Ga0105243_11553096
678 Ga0105243_12115933
679 Ga0105241_10190855
680 Ga0105242_10034662
681 Ga0105242_10430776
682 Ga0105238_10235393
683 Ga0105238_11007371
684 Ga0105238_11194646
685 Ga0105249_10010597
686 Ga0105249_10011524
687 Ga0105249_10712945
688 Ga0105249_12156333
689 Ga0105246_10690224
690 Ga0157369_10022722
691 Ga0157369_11452051
692 Ga0157378_10002191
693 Ga0157378_10989527
694 Ga0157372_10004004
695 Ga0157372_10281948
696 Ga0157372_11712385
697 Ga0157375_10234037
698 Ga0157375_11217277
699 Ga0157380_10756576
700 Ga0157379_10169196
701 Ga0157376_10025846
702 Ga0157376_10064003
703 Ga0157376_10498047
704 Ga0163161_10263479
705 Ga0207642_10217393
706 Ga0207647_10026895
707 Ga0207685_10365935
708 Ga0207699_10639791
709 Ga0207699_11065761
710 Ga0207645_10021824
711 Ga0207643_10285313
712 Ga0207705_10047001
713 Ga0207705_10105736
714 Ga0207705_10293516
715 Ga0207707_10005823
716 Ga0207695_10089407
717 Ga0207695_10231158
718 Ga0207671_10769915
719 Ga0207652_10053149
720 Ga0207652_10321087
721 Ga0207681_10003429
722 Ga0207694_10138999
723 Ga0207694_11143484
724 Ga0207659_10341606
725 Ga0207700_10620458
726 Ga0207690_10376130
727 Ga0207686_10118554
728 Ga0207709_10006072
729 Ga0207709_10078480
730 Ga0207670_10341562
731 Ga0207670_11338082
732 Ga0207669_10038335
733 Ga0207669_10301066
734 Ga0207704_10010132
735 Ga0207665_10042797
736 Ga0207665_10170301
737 Ga0207665_10520926
738 Ga0207691_10196648
739 Ga0207691_10669239
740 Ga0207711_10580154
741 Ga0207689_10026230
742 Ga0207661_10075628
743 Ga0207667_10013185
744 Ga0207651_10642130
745 Ga0207651_10928325
746 Ga0207712_10002362
747 Ga0207712_11382659
748 Ga0207640_10241893
749 Ga0207640_11162081
750 Ga0207677_10068889
751 Ga0207677_10655346
752 Ga0207703_10942519
753 Ga0207639_10307940
754 Ga0207708_10038281
755 Ga0207702_10150885
756 Ga0207702_10374359
757 Ga0207674_10400041
758 Ga0207675_101478010
759 Ga0207683_10130466
760 Ga0207698_10103876
761 Ga0207698_10600212
762 Ga0209967_1002761
763 Ga0209967_1027557
764 Ga0209981_1002995
765 Ga0209996_1005474
766 Ga0210000_1002205
767 Ga0210000_1010012
768 Ga0209968_1006861
769 Ga0209968_1046319
770 Ga0209999_1015085
771 Ga0209970_1015518
772 Ga0209588_1030976
773 Ga0209966_1025543
774 Ga0209974_10134697
775 Ga0209974_10215830
776 Ga0207428_10011171
777 Ga0207428_10058105
778 Ga0207428_10250021
779 Ga0207428_10755175
780 Ga0268265_10002108
781 Ga0307408_100235257
782 Ga0307408_100798468
783 Ga0307405_10800166
784 Ga0307407_10566345
785 Ga0307412_11439358
786 Ga0307416_100157725
787 Ga0307416_100342050
788 Ga0307416_100727782
789 Ga0307411_10336601
790 Ga0307411_10909220
791 Ga0307415_100630393
792 Ga0307415_100984908
793 Ga0316583_10174693
794 Ga0373926_0124966
795 Ga0373928_0066367
796 Ga0373929_0002974
797 Ga0373944_0058597
798 Ga0373949_0006545
799 Ga0373951_0003251
800 Ga0373923_0036912
801 Ga0373923_0117901
802 Ga0373932_0001314
803 Ga0373936_0013971
804 Ga0373939_0025360
805 Ga0373941_0001753
806 Ga0373945_0021754
807 Ga0373954_0000505
808 Ga0373960_0002399
809 Ga0373960_0196673
810 Ga0373946_0063003
811 Ga0373961_0019893
812 Ga0373961_0059632
813 Ga0373961_0072272
814 Ga0373962_0122843
815 Ga0373931_0002540
816 Ga0373931_0012381
817 Ga0373931_0694112
818 Ga0373935_0011448
819 Ga0373927_0008482
820 Ga0373927_0027947
821 Ga0373933_0009922
822 Ga0373933_0607643
823 Ga0373937_0001546
824 Ga0373937_0064219
825 Ga0373925_0008212
826 Ga0395900_0142680
827 Ga0395898_1101846
828 Ga0395905_0224572
829 Ga0395905_0775284
830 Ga0395901_0008364
831 Ga0439436_0039292
832 Ga0439436_0167764
833 Ga0439439_0035439
834 Ga0439431_0005315
835 Ga0439441_000134
836 Ga0439443_003147
837 Ga0439443_022601
838 Ga0439446_0060470
839 Ga0439446_0280752
840 Ga0439434_0000058
841 Ga0439434_0089707
842 Ga0439435_0000001
843 Ga0439435_0071031
844 Ga0439444_0002002
845 Ga0439444_0014835
846 Ga0439460_0001966
847 Ga0439460_0004753
848 Ga0450893_0021292
849 Ga0450893_0041859
850 Ga0453683_0218689
851 Ga0453683_0541498
852 Ga0466966_0530210
853 Ga0466961_0102242
854 Ga0466957_0004733
855 Ga0466959_0067260
856 Ga0451576_0043751
857 Ga0451576_0048475
858 Ga0451576_0051879
859 Ga0451576_0087129
860 Ga0451576_0211140
861 Ga0451576_0221258
862 Ga0451576_0231741
863 Ga0451576_0516859
864 Ga0466958_0079408
865 Ga0466967_0006276
866 Ga0495603_0011340
867 Ga0495580_0026436
868 Ga0495639_0031647
869 Ga0495608_0113382
870 Ga0495630_0314564
871 Ga0495642_0011914
872 Ga0495652_0322799
873 Ga0495586_0018239
874 Ga0495587_0426849
875 Ga0495598_0008757
876 Ga0495621_0026230
877 Ga0495621_0171082
878 Ga0495659_0014761
879 Ga0495647_0070785
880 Ga0495658_0278375
881 Ga0495669_0037284
882 Ga0495676_0068440
883 Ga0495677_0186480
884 Ga0495681_0340091
885 Ga0495615_0063370
886 Ga0501291_046375
887 Ga0501296_046377
888 Ga0501299_106509
889 Ga0501031_0067526
890 Ga0501031_0211109
891 Ga0501032_0239489
892 Ga0501033_0059948
893 Ga0501033_0213632
894 Ga0501036_0001716
895 Ga0501036_0401062
896 Ga0501037_0090802
897 Ga0501037_0125666
898 Ga0501038_0006982
899 Ga0501038_0039146
900 Ga0501038_0562029
901 Ga0501039_0013309
902 Ga0501039_0015965
903 Ga0501039_0054123
904 Ga0501039_0168635
905 Ga0501039_0750884
906 Ga0501040_0008184
907 Ga0501040_0014856
908 Ga0501040_0060566
909 Ga0501040_0621970
910 Ga0501041_0020796
911 Ga0501041_0101228
912 Ga0501042_0018598
913 Ga0501042_0317776
914 Ga0501043_0105080
915 Ga0501046_0006823
916 Ga0501048_0109055
917 Ga0501048_0118982
918 Ga0501048_0608986
919 Ga0501068_0028797
920 Ga0501070_0206378
921 Ga0501071_0029606
922 Ga0501071_0174473
923 Ga0501071_0686361
924 Ga0501072_0001755
925 Ga0501072_0021171
926 Ga0501072_0050337
927 Ga0501072_0124022
928 Ga0501072_0196947
929 Ga0501072_0236394
930 Ga0501072_0305132
931 Ga0501072_1223343
932 Ga0501073_0394476
933 Ga0501074_0127231
934 Ga0501074_0252477
935 Ga0501074_0296982
936 Ga0501075_0074908
937 Ga0501075_0077275
938 Ga0501075_0079003
939 Ga0501075_0092811
940 Ga0501076_0000185
941 Ga0501076_0002196
942 Ga0501076_0060593
943 Ga0501077_0001199
944 Ga0501077_0039789
945 Ga0501208_066216
946 Ga0501079_0032306
947 Ga0501079_0053365
948 Ga0501079_0090680
949 Ga0501079_0909627
950 Ga0501079_1062830
951 Ga0501080_0009074
952 Ga0501080_0096675
953 Ga0501080_0123805
954 Ga0501081_0001180
955 Ga0501081_0001515
956 Ga0501081_0049457
957 Ga0501081_0134982
958 Ga0501081_0434657
959 Ga0501081_0770153
960 Ga0501083_0071249
961 Ga0501083_0428329
962 Ga0501035_0221999
963 Ga0501035_0350154
964 Ga0501035_0614679
965 Ga0501044_1151292
966 Ga0501045_0002002
967 Ga0501045_0091121
968 nmdc:mga03683_36293_c1
969 nmdc:mga03n38_182311_c1
970 nmdc:mga00v17_1746_c1
971 nmdc:mga0k408_9828_c1
972 nmdc:mga06z11_38698_c1
973 nmdc:mga05p37_22767_c1
974 nmdc:mga05p37_389995_c1
975 nmdc:mga05p37_5672_c1
976 nmdc:mga09592_233766_c1
977 nmdc:mga09592_257837_c1
978 nmdc:mga09592_622_c1
979 nmdc:mga0qj67_220526_c1
980 nmdc:mga0qj67_338751_c1
981 nmdc:mga0qj67_548243_c1
982 nmdc:mga0qj67_5972_c1
983 nmdc:mga06r32_253119_c1
984 nmdc:mga06r32_332786_c1
985 nmdc:mga06r32_640122_c1
986 nmdc:mga06r32_6845_c1
987 nmdc:mga08y16_123947_c1
988 nmdc:mga08y16_13184_c1
989 nmdc:mga08y16_39678_c1
990 nmdc:mga0rr50_231601_c1
991 nmdc:mga0rr50_574804_c1
992 nmdc:mga0rr50_575790_c1
993 nmdc:mga0rr50_724918_c1
994 nmdc:mga08x19_17644_c1
995 nmdc:mga08x19_20513_c1
996 nmdc:mga08x19_428_c1
997 nmdc:mga08x19_76601_c1
998 nmdc:mga08x19_9071_c1
999 nmdc:mga08x19_99504_c1
1000 nmdc:mga0a205_11599_c1
1001 nmdc:mga0a205_263401_c1
1002 nmdc:mga0a205_758101_c1
1003 Ga0500646_0080414
1004 Ga0500568_0000029
1005 Ga0501084_0104315
1006 Ga0501084_0178502
1007 Ga0501084_0310595
1008 Ga0501084_0427446
1009 Ga0590077_014599
1010 Ga0501082_0071382
1011 Ga0501082_0195142
1012 Ga0501082_0332013
1013 Ga0501082_0562320
1014 Ga0530510_0047085
1015 Ga0530510_0176575
1016 Ga0530510_0378006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

13

171

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8978 1 161
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8522 2 161
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8428 2 161
6q2d-assembly1.cif.gz_F crystal structure of methanobrevibacter smithii dph2 in complex with methanobrevibacter smithii elongation factor 2 0.7548 102 160
5f0u-assembly1.cif.gz_A crystal structure of gold binding protein 0.7233 100 157
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9647 99 161 3.30.70.860
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9232 9 97 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9173 9 97 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9035 9 93 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.898 9 97 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A259DGR8-F1-model_v4 YajQ family cyclic di-GMP-binding protein 1.001 99 161 GO:0000166
GO:0005829
AF-A0A0F2IX68-F1-model_v4 deleted 0.9982 101 161
AF-A0A520FJA4-F1-model_v4 DUF520 family protein 0.9952 99 161 GO:0000166
GO:0005829
AF-A0A0F2IX68-F1-model_v4 deleted 0.9822 101 161
AF-A0A2V6XXA1-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9814 9 81 GO:0000166
GO:0005829

Map