F456705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 507 | 253 | 497 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100341604|Ga0307416_1003416042 |
| Length | 368 |
| Sequence | VRCPTGCSKRFERDIRGGQPLESGPAAHRYIVRVLRDAPLGCVVACASVLWTLSTPLFAAMTVAVATAQTFPSRPIRFIVPVPPGGGADFVARAFASRLTESLGQQVVVDNRGGAAGIIAMEAVAKAAPDGYTLIQTNISTVSINPFIYPKLPYDATRDFAPVTITTLNPLVLVVHPGVPAKSVKELIAYARSKPGELTYASLGSGSVQHLAGHVFSKDAGIQTVHVPYKGAAPATVDLLARQVQMAFSGVGTVAAHVKAGRLRALAVTGSKRIDAFADAPTLAEAGGPDVQMWLWNGVLAPAGTPTPIVRRLNAELVNAARSPELIAAMATQGTAPSSSTPEEFANFIRQEQARFAKIVKESGAKAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 2 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 3 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 4 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 5 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 6 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 7 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 8 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 232 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 246 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 247 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 248 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 252 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 253 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.72 |
| Nodule | 0.39 |
| Rhizoplane | 3.35 |
| Rhizosphere | 86.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10083489 | 3300005295 | Bacteria | 8984 |
| 2 | Ga0070658_10209878 | 3300005327 | Bacteria | 1645 |
| 3 | Ga0070658_10302621 | 3300005327 | Bacteria | 1363 |
| 4 | Ga0070676_10252918 | 3300005328 | Bacteria | 1177 |
| 5 | Ga0070690_100239060 | 3300005330 | Bacteria | 1280 |
| 6 | Ga0070670_100012056 | 3300005331 | Bacteria | 7396 |
| 7 | Ga0070670_100020779 | 3300005331 | Bacteria | 5645 |
| 8 | Ga0070670_100022518 | 3300005331 | Bacteria | 5422 |
| 9 | Ga0070670_100038815 | 3300005331 | Bacteria | 4095 |
| 10 | Ga0070670_100060075 | 3300005331 | Bacteria | 3263 |
| 11 | Ga0070670_100068153 | 3300005331 | Bacteria | 3054 |
| 12 | Ga0070670_100270913 | 3300005331 | Bacteria | 1481 |
| 13 | Ga0070670_100397305 | 3300005331 | Bacteria | 1217 |
| 14 | Ga0070677_10141536 | 3300005333 | Bacteria | 1110 |
| 15 | Ga0068869_100001168 | 3300005334 | Bacteria | 15386 |
| 16 | Ga0070666_10049302 | 3300005335 | Bacteria | 2829 |
| 17 | Ga0070666_10203238 | 3300005335 | Bacteria | 1394 |
| 18 | Ga0070666_10215350 | 3300005335 | Bacteria | 1354 |
| 19 | Ga0070680_100177248 | 3300005336 | Bacteria | 1794 |
| 20 | Ga0068868_100024718 | 3300005338 | Bacteria | 4561 |
| 21 | Ga0068868_100104203 | 3300005338 | Bacteria | 2299 |
| 22 | Ga0068868_100116708 | 3300005338 | Unclassified | 2174 |
| 23 | Ga0068868_100204046 | 3300005338 | Unclassified | 1649 |
| 24 | Ga0068868_100248789 | 3300005338 | Bacteria | 1496 |
| 25 | Ga0068868_100300351 | 3300005338 | Bacteria | 1363 |
| 26 | Ga0070660_100282725 | 3300005339 | Bacteria | 1358 |
| 27 | Ga0070689_100135584 | 3300005340 | Unclassified | 1976 |
| 28 | Ga0070689_100236790 | 3300005340 | Bacteria | 1502 |
| 29 | Ga0070691_10054525 | 3300005341 | Bacteria | 1914 |
| 30 | Ga0070687_100000380 | 3300005343 | Bacteria | 15140 |
| 31 | Ga0070687_100024373 | 3300005343 | Unclassified | 2888 |
| 32 | Ga0070661_100058552 | 3300005344 | Bacteria | 2823 |
| 33 | Ga0070692_10065826 | 3300005345 | Bacteria | 1919 |
| 34 | Ga0070669_100259359 | 3300005353 | Bacteria | 1387 |
| 35 | Ga0070675_100017456 | 3300005354 | Bacteria | 5702 |
| 36 | Ga0070675_100018560 | 3300005354 | Bacteria | 5538 |
| 37 | Ga0070675_100046473 | 3300005354 | Bacteria | 3554 |
| 38 | Ga0070675_100090122 | 3300005354 | Bacteria | 2568 |
| 39 | Ga0070675_100121508 | 3300005354 | Bacteria | 2219 |
| 40 | Ga0070675_100172401 | 3300005354 | Bacteria | 1866 |
| 41 | Ga0070675_100188136 | 3300005354 | Bacteria | 1788 |
| 42 | Ga0070675_100206259 | 3300005354 | Bacteria | 1707 |
| 43 | Ga0070671_100020414 | 3300005355 | Bacteria | 5403 |
| 44 | Ga0070671_100038271 | 3300005355 | Bacteria | 3981 |
| 45 | Ga0070671_100119623 | 3300005355 | Bacteria | 2216 |
| 46 | Ga0070671_100488368 | 3300005355 | Bacteria | 1058 |
| 47 | Ga0070674_100008629 | 3300005356 | Bacteria | 6074 |
| 48 | Ga0070674_100034526 | 3300005356 | Bacteria | 3379 |
| 49 | Ga0070673_100017670 | 3300005364 | Bacteria | 5078 |
| 50 | Ga0070673_100025628 | 3300005364 | Bacteria | 4344 |
| 51 | Ga0070673_100045962 | 3300005364 | Bacteria | 3389 |
| 52 | Ga0070673_100047155 | 3300005364 | Bacteria | 3351 |
| 53 | Ga0070673_100081947 | 3300005364 | Bacteria | 2617 |
| 54 | Ga0070673_100087651 | 3300005364 | Unclassified | 2537 |
| 55 | Ga0070673_100230331 | 3300005364 | Bacteria | 1607 |
| 56 | Ga0070688_100054491 | 3300005365 | Unclassified | 2505 |
| 57 | Ga0070688_100168915 | 3300005365 | Bacteria | 1508 |
| 58 | Ga0070667_100304382 | 3300005367 | Bacteria | 1436 |
| 59 | Ga0070703_10019210 | 3300005406 | Bacteria | 1981 |
| 60 | Ga0070701_10004845 | 3300005438 | Bacteria | 5502 |
| 61 | Ga0070705_100003046 | 3300005440 | Bacteria | 8258 |
| 62 | Ga0070705_100054125 | 3300005440 | Bacteria | 2352 |
| 63 | Ga0070700_100050093 | 3300005441 | Bacteria | 2595 |
| 64 | Ga0070694_100053296 | 3300005444 | Bacteria | 2737 |
| 65 | Ga0070678_100010047 | 3300005456 | Bacteria | 5761 |
| 66 | Ga0070678_100021096 | 3300005456 | Unclassified | 4288 |
| 67 | Ga0070662_100190769 | 3300005457 | Bacteria | 1621 |
| 68 | Ga0070681_10109655 | 3300005458 | Bacteria | 2700 |
| 69 | Ga0068867_100018513 | 3300005459 | Bacteria | 4950 |
| 70 | Ga0068867_100026050 | 3300005459 | Bacteria | 4196 |
| 71 | Ga0068867_100038038 | 3300005459 | Bacteria | 3502 |
| 72 | Ga0068867_100054149 | 3300005459 | Bacteria | 2964 |
| 73 | Ga0068867_100134655 | 3300005459 | Bacteria | 1924 |
| 74 | Ga0068867_100202314 | 3300005459 | Bacteria | 1590 |
| 75 | Ga0070679_100024079 | 3300005530 | Bacteria | 5964 |
| 76 | Ga0070672_100036368 | 3300005543 | Bacteria | 3751 |
| 77 | Ga0070672_100078259 | 3300005543 | Unclassified | 2645 |
| 78 | Ga0070672_100150716 | 3300005543 | Bacteria | 1923 |
| 79 | Ga0070672_100213075 | 3300005543 | Unclassified | 1618 |
| 80 | Ga0070672_100365881 | 3300005543 | Bacteria | 1231 |
| 81 | Ga0070686_100062911 | 3300005544 | Bacteria | 2402 |
| 82 | Ga0070695_100000728 | 3300005545 | Bacteria | 17589 |
| 83 | Ga0070695_100188650 | 3300005545 | Bacteria | 1466 |
| 84 | Ga0070696_100006658 | 3300005546 | Bacteria | 7718 |
| 85 | Ga0070693_100000072 | 3300005547 | Bacteria | 41480 |
| 86 | Ga0070693_100168784 | 3300005547 | Bacteria | 1400 |
| 87 | Ga0070665_100152424 | 3300005548 | Bacteria | 2314 |
| 88 | Ga0070704_100003550 | 3300005549 | Bacteria | 8965 |
| 89 | Ga0068855_100575129 | 3300005563 | Bacteria | 1217 |
| 90 | Ga0070664_100036993 | 3300005564 | Bacteria | 4102 |
| 91 | Ga0070664_100148198 | 3300005564 | Unclassified | 2070 |
| 92 | Ga0070664_100344754 | 3300005564 | Bacteria | 1354 |
| 93 | Ga0068857_100076768 | 3300005577 | Bacteria | 2980 |
| 94 | Ga0068854_100000912 | 3300005578 | Bacteria | 17764 |
| 95 | Ga0068854_100081983 | 3300005578 | Bacteria | 2384 |
| 96 | Ga0068856_100138138 | 3300005614 | Bacteria | 2443 |
| 97 | Ga0068856_100513807 | 3300005614 | Bacteria | 1219 |
| 98 | Ga0070702_100000084 | 3300005615 | Bacteria | 27525 |
| 99 | Ga0070702_100017024 | 3300005615 | Unclassified | 3742 |
| 100 | Ga0068852_100045312 | 3300005616 | Bacteria | 3740 |
| 101 | Ga0068859_100005387 | 3300005617 | Bacteria | 13012 |
| 102 | Ga0068859_100335266 | 3300005617 | Bacteria | 1607 |
| 103 | Ga0068864_100044158 | 3300005618 | Bacteria | 3818 |
| 104 | Ga0068864_100078169 | 3300005618 | Unclassified | 2895 |
| 105 | Ga0068864_100117463 | 3300005618 | Unclassified | 2374 |
| 106 | Ga0068864_100119109 | 3300005618 | Bacteria | 2358 |
| 107 | Ga0068864_100202678 | 3300005618 | Bacteria | 1823 |
| 108 | Ga0068864_100418528 | 3300005618 | Bacteria | 1276 |
| 109 | Ga0068866_10002137 | 3300005718 | Bacteria | 8225 |
| 110 | Ga0068861_100126994 | 3300005719 | Unclassified | 2065 |
| 111 | Ga0068861_100225441 | 3300005719 | Bacteria | 1586 |
| 112 | Ga0068861_100231210 | 3300005719 | Unclassified | 1568 |
| 113 | Ga0068870_10037083 | 3300005840 | Bacteria | 2511 |
| 114 | Ga0068870_10040906 | 3300005840 | Unclassified | 2406 |
| 115 | Ga0068870_10074604 | 3300005840 | Bacteria | 1859 |
| 116 | Ga0068870_10077714 | 3300005840 | Bacteria | 1827 |
| 117 | Ga0068870_10112926 | 3300005840 | Bacteria | 1554 |
| 118 | Ga0068863_100083577 | 3300005841 | Unclassified | 3025 |
| 119 | Ga0068863_100327516 | 3300005841 | Bacteria | 1489 |
| 120 | Ga0068858_100024273 | 3300005842 | Bacteria | 5651 |
| 121 | Ga0068860_100059431 | 3300005843 | Unclassified | 3634 |
| 122 | Ga0068860_100093591 | 3300005843 | Bacteria | 2864 |
| 123 | Ga0068862_100007686 | 3300005844 | Bacteria | 8918 |
| 124 | Ga0068862_100009057 | 3300005844 | Bacteria | 8242 |
| 125 | Ga0068862_100029960 | 3300005844 | Unclassified | 4585 |
| 126 | Ga0068862_100117912 | 3300005844 | Unclassified | 2337 |
| 127 | Ga0068862_100557443 | 3300005844 | Bacteria | 1095 |
| 128 | Ga0081455_10045042 | 3300005937 | Bacteria | 3842 |
| 129 | Ga0081540_1001688 | 3300005983 | Bacteria | 18755 |
| 130 | Ga0081539_10012694 | 3300005985 | Bacteria | 6451 |
| 131 | Ga0075365_10052297 | 3300006038 | Bacteria | 2701 |
| 132 | Ga0075365_10060805 | 3300006038 | Bacteria | 2521 |
| 133 | Ga0075368_10001378 | 3300006042 | Bacteria | 7740 |
| 134 | Ga0075363_100042953 | 3300006048 | Bacteria | 2390 |
| 135 | Ga0075364_10000478 | 3300006051 | Bacteria | 20305 |
| 136 | Ga0075367_10014685 | 3300006178 | Bacteria | 4241 |
| 137 | Ga0075367_10080112 | 3300006178 | Bacteria | 1975 |
| 138 | Ga0075369_10032960 | 3300006186 | Bacteria | 2194 |
| 139 | Ga0075366_10007090 | 3300006195 | Bacteria | 6170 |
| 140 | Ga0075366_10026652 | 3300006195 | Bacteria | 3387 |
| 141 | Ga0097621_100000794 | 3300006237 | Bacteria | 22198 |
| 142 | Ga0097621_100039429 | 3300006237 | Bacteria | 3794 |
| 143 | Ga0097621_100105133 | 3300006237 | Unclassified | 2380 |
| 144 | Ga0068871_100050818 | 3300006358 | Unclassified | 3354 |
| 145 | Ga0068871_100076190 | 3300006358 | Bacteria | 2770 |
| 146 | Ga0068871_100077624 | 3300006358 | Bacteria | 2745 |
| 147 | Ga0068871_100093419 | 3300006358 | Bacteria | 2510 |
| 148 | Ga0068871_100106635 | 3300006358 | Unclassified | 2352 |
| 149 | Ga0068871_100226195 | 3300006358 | Bacteria | 1622 |
| 150 | Ga0075428_100001017 | 3300006844 | Bacteria | 29740 |
| 151 | Ga0075428_100002482 | 3300006844 | Bacteria | 20020 |
| 152 | Ga0075428_100006367 | 3300006844 | Bacteria | 13136 |
| 153 | Ga0075428_100320893 | 3300006844 | Bacteria | 1665 |
| 154 | Ga0075430_100000160 | 3300006846 | Bacteria | 44139 |
| 155 | Ga0075430_100008030 | 3300006846 | Bacteria | 8920 |
| 156 | Ga0075430_100019461 | 3300006846 | Bacteria | 5773 |
| 157 | Ga0075430_100175632 | 3300006846 | Bacteria | 1782 |
| 158 | Ga0075430_100249203 | 3300006846 | Bacteria | 1472 |
| 159 | Ga0075431_100004501 | 3300006847 | Bacteria | 13679 |
| 160 | Ga0075431_100007328 | 3300006847 | Bacteria | 10988 |
| 161 | Ga0075431_100046926 | 3300006847 | Bacteria | 4454 |
| 162 | Ga0075431_100048025 | 3300006847 | Bacteria | 4402 |
| 163 | Ga0075431_100089285 | 3300006847 | Bacteria | 3181 |
| 164 | Ga0075433_10095223 | 3300006852 | Bacteria | 2635 |
| 165 | Ga0075433_10139714 | 3300006852 | Bacteria | 2153 |
| 166 | Ga0075433_10265551 | 3300006852 | Bacteria | 1521 |
| 167 | Ga0075434_100001156 | 3300006871 | Bacteria | 21811 |
| 168 | Ga0075434_100116518 | 3300006871 | Bacteria | 2685 |
| 169 | Ga0075429_100000365 | 3300006880 | Bacteria | 33361 |
| 170 | Ga0075429_100012289 | 3300006880 | Bacteria | 7426 |
| 171 | Ga0075429_100015874 | 3300006880 | Bacteria | 6521 |
| 172 | Ga0075429_100020639 | 3300006880 | Bacteria | 5718 |
| 173 | Ga0075429_100026175 | 3300006880 | Bacteria | 5063 |
| 174 | Ga0075429_100050977 | 3300006880 | Bacteria | 3601 |
| 175 | Ga0075429_100062373 | 3300006880 | Bacteria | 3248 |
| 176 | Ga0068865_100243364 | 3300006881 | Bacteria | 1416 |
| 177 | Ga0075436_100002171 | 3300006914 | Bacteria | 13522 |
| 178 | Ga0075436_100004556 | 3300006914 | Bacteria | 9490 |
| 179 | Ga0097620_100005387 | 3300006931 | Bacteria | 13012 |
| 180 | Ga0097620_100335255 | 3300006931 | Bacteria | 1607 |
| 181 | Ga0075435_100000351 | 3300007076 | Bacteria | 28383 |
| 182 | Ga0075435_100069719 | 3300007076 | Bacteria | 2868 |
| 183 | Ga0099794_10021327 | 3300007265 | Unclassified | 2942 |
| 184 | Ga0099795_10003724 | 3300007788 | Bacteria | 3821 |
| 185 | Ga0105250_10065403 | 3300009092 | Bacteria | 1466 |
| 186 | Ga0105240_10266304 | 3300009093 | Bacteria | 1975 |
| 187 | Ga0111539_10006886 | 3300009094 | Bacteria | 14601 |
| 188 | Ga0111539_10093128 | 3300009094 | Bacteria | 3540 |
| 189 | Ga0111539_10136024 | 3300009094 | Bacteria | 2878 |
| 190 | Ga0111539_10160506 | 3300009094 | Bacteria | 2629 |
| 191 | Ga0111539_10198227 | 3300009094 | Bacteria | 2342 |
| 192 | Ga0111539_10240192 | 3300009094 | Bacteria | 2109 |
| 193 | Ga0105245_10151477 | 3300009098 | Bacteria | 2193 |
| 194 | Ga0114129_10002814 | 3300009147 | Bacteria | 24266 |
| 195 | Ga0105243_10104191 | 3300009148 | Bacteria | 2361 |
| 196 | Ga0105241_10066851 | 3300009174 | Bacteria | 2781 |
| 197 | Ga0105242_10003543 | 3300009176 | Bacteria | 12137 |
| 198 | Ga0105242_10416285 | 3300009176 | Bacteria | 1258 |
| 199 | Ga0105248_10227435 | 3300009177 | Bacteria | 2100 |
| 200 | Ga0105248_10321760 | 3300009177 | Bacteria | 1742 |
| 201 | Ga0105249_10202640 | 3300009553 | Bacteria | 1942 |
| 202 | Ga0099796_10005413 | 3300010159 | Bacteria | 3186 |
| 203 | Ga0105239_10023090 | 3300010375 | Bacteria | 6855 |
| 204 | Ga0105239_10710329 | 3300010375 | Bacteria | 1150 |
| 205 | Ga0157373_10009982 | 3300013100 | Bacteria | 6998 |
| 206 | Ga0157369_10015469 | 3300013105 | Bacteria | 8597 |
| 207 | Ga0157374_10138626 | 3300013296 | Unclassified | 2360 |
| 208 | Ga0157374_10197730 | 3300013296 | Bacteria | 1968 |
| 209 | Ga0157378_10029668 | 3300013297 | Bacteria | 4830 |
| 210 | Ga0157378_10048544 | 3300013297 | Bacteria | 3775 |
| 211 | Ga0157378_10120255 | 3300013297 | Unclassified | 2420 |
| 212 | Ga0157378_10310732 | 3300013297 | Bacteria | 1528 |
| 213 | Ga0157378_10491183 | 3300013297 | Bacteria | 1225 |
| 214 | Ga0163162_10005090 | 3300013306 | Bacteria | 12668 |
| 215 | Ga0163162_10025203 | 3300013306 | Bacteria | 5877 |
| 216 | Ga0163162_10056076 | 3300013306 | Bacteria | 3969 |
| 217 | Ga0163162_10097344 | 3300013306 | Bacteria | 3031 |
| 218 | Ga0163162_10213683 | 3300013306 | Bacteria | 2059 |
| 219 | Ga0157375_10035490 | 3300013308 | Bacteria | 4760 |
| 220 | Ga0157375_10062193 | 3300013308 | Bacteria | 3709 |
| 221 | Ga0157375_10106664 | 3300013308 | Unclassified | 2893 |
| 222 | Ga0157375_10127538 | 3300013308 | Bacteria | 2661 |
| 223 | Ga0157375_10145037 | 3300013308 | Unclassified | 2504 |
| 224 | Ga0157375_10153129 | 3300013308 | Bacteria | 2443 |
| 225 | Ga0157375_10159606 | 3300013308 | Bacteria | 2396 |
| 226 | Ga0157375_10224656 | 3300013308 | Bacteria | 2037 |
| 227 | Ga0163163_10426151 | 3300014325 | Bacteria | 1386 |
| 228 | Ga0157380_10166091 | 3300014326 | Bacteria | 1923 |
| 229 | Ga0157377_10117180 | 3300014745 | Bacteria | 1609 |
| 230 | Ga0157379_10185762 | 3300014968 | Unclassified | 1878 |
| 231 | Ga0157376_10037821 | 3300014969 | Unclassified | 3922 |
| 232 | Ga0157376_10050072 | 3300014969 | Unclassified | 3463 |
| 233 | Ga0157376_10074418 | 3300014969 | Bacteria | 2895 |
| 234 | Ga0157376_10106210 | 3300014969 | Bacteria | 2463 |
| 235 | Ga0157376_10124981 | 3300014969 | Bacteria | 2286 |
| 236 | Ga0163161_10039368 | 3300017792 | Bacteria | 3393 |
| 237 | Ga0163161_10074213 | 3300017792 | Bacteria | 2494 |
| 238 | Ga0163161_10078846 | 3300017792 | Unclassified | 2421 |
| 239 | Ga0163161_10142421 | 3300017792 | Bacteria | 1816 |
| 240 | Ga0213876_10008546 | 3300021384 | Bacteria | 5543 |
| 241 | Ga0207697_10021444 | 3300025315 | Bacteria | 2644 |
| 242 | Ga0207697_10043350 | 3300025315 | Bacteria | 1850 |
| 243 | Ga0207656_10093198 | 3300025321 | Bacteria | 1370 |
| 244 | Ga0207682_10005416 | 3300025893 | Bacteria | 5196 |
| 245 | Ga0207642_10000462 | 3300025899 | Bacteria | 12434 |
| 246 | Ga0207645_10002842 | 3300025907 | Bacteria | 13433 |
| 247 | Ga0207643_10013273 | 3300025908 | Bacteria | 4459 |
| 248 | Ga0207643_10026556 | 3300025908 | Bacteria | 3206 |
| 249 | Ga0207643_10054939 | 3300025908 | Bacteria | 2264 |
| 250 | Ga0207643_10121907 | 3300025908 | Bacteria | 1545 |
| 251 | Ga0207705_10179445 | 3300025909 | Bacteria | 1597 |
| 252 | Ga0207684_10420612 | 3300025910 | Bacteria | 1148 |
| 253 | Ga0207654_10044963 | 3300025911 | Bacteria | 2511 |
| 254 | Ga0207695_10146172 | 3300025913 | Bacteria | 2308 |
| 255 | Ga0207671_10019541 | 3300025914 | Bacteria | 5179 |
| 256 | Ga0207660_10002278 | 3300025917 | Bacteria | 12642 |
| 257 | Ga0207662_10000133 | 3300025918 | Bacteria | 35913 |
| 258 | Ga0207649_10020716 | 3300025920 | Bacteria | 3773 |
| 259 | Ga0207649_10069780 | 3300025920 | Bacteria | 2239 |
| 260 | Ga0207652_10090340 | 3300025921 | Bacteria | 2691 |
| 261 | Ga0207681_10011863 | 3300025923 | Bacteria | 5363 |
| 262 | Ga0207681_10043406 | 3300025923 | Bacteria | 3009 |
| 263 | Ga0207681_10084494 | 3300025923 | Unclassified | 2250 |
| 264 | Ga0207681_10175840 | 3300025923 | Unclassified | 1626 |
| 265 | Ga0207650_10000964 | 3300025925 | Bacteria | 21653 |
| 266 | Ga0207650_10005459 | 3300025925 | Bacteria | 8677 |
| 267 | Ga0207650_10029612 | 3300025925 | Bacteria | 3937 |
| 268 | Ga0207650_10031423 | 3300025925 | Bacteria | 3834 |
| 269 | Ga0207650_10152047 | 3300025925 | Unclassified | 1827 |
| 270 | Ga0207650_10198541 | 3300025925 | Bacteria | 1606 |
| 271 | Ga0207650_10216829 | 3300025925 | Bacteria | 1539 |
| 272 | Ga0207659_10011762 | 3300025926 | Bacteria | 5539 |
| 273 | Ga0207659_10035756 | 3300025926 | Unclassified | 3436 |
| 274 | Ga0207659_10038856 | 3300025926 | Bacteria | 3313 |
| 275 | Ga0207659_10099549 | 3300025926 | Unclassified | 2189 |
| 276 | Ga0207659_10205645 | 3300025926 | Bacteria | 1575 |
| 277 | Ga0207659_10265097 | 3300025926 | Bacteria | 1399 |
| 278 | Ga0207644_10061046 | 3300025931 | Bacteria | 2729 |
| 279 | Ga0207706_10007245 | 3300025933 | Bacteria | 10255 |
| 280 | Ga0207706_10319930 | 3300025933 | Bacteria | 1350 |
| 281 | Ga0207686_10107323 | 3300025934 | Bacteria | 1876 |
| 282 | Ga0207670_10262373 | 3300025936 | Bacteria | 1340 |
| 283 | Ga0207704_10025398 | 3300025938 | Bacteria | 3231 |
| 284 | Ga0207704_10099330 | 3300025938 | Bacteria | 1936 |
| 285 | Ga0207691_10001414 | 3300025940 | Bacteria | 23977 |
| 286 | Ga0207691_10005400 | 3300025940 | Bacteria | 12340 |
| 287 | Ga0207691_10013142 | 3300025940 | Bacteria | 7926 |
| 288 | Ga0207691_10016867 | 3300025940 | Bacteria | 6930 |
| 289 | Ga0207691_10074921 | 3300025940 | Bacteria | 3052 |
| 290 | Ga0207691_10192597 | 3300025940 | Bacteria | 1778 |
| 291 | Ga0207711_10265342 | 3300025941 | Bacteria | 1579 |
| 292 | Ga0207689_10089929 | 3300025942 | Bacteria | 2522 |
| 293 | Ga0207661_10191479 | 3300025944 | Bacteria | 1793 |
| 294 | Ga0207679_10013268 | 3300025945 | Bacteria | 5400 |
| 295 | Ga0207679_10040927 | 3300025945 | Unclassified | 3320 |
| 296 | Ga0207679_10051228 | 3300025945 | Bacteria | 3021 |
| 297 | Ga0207679_10182270 | 3300025945 | Bacteria | 1738 |
| 298 | Ga0207679_10222258 | 3300025945 | Bacteria | 1589 |
| 299 | Ga0207679_10267156 | 3300025945 | Bacteria | 1461 |
| 300 | Ga0207667_10299372 | 3300025949 | Bacteria | 1643 |
| 301 | Ga0207651_10005875 | 3300025960 | Bacteria | 6348 |
| 302 | Ga0207651_10022621 | 3300025960 | Bacteria | 3848 |
| 303 | Ga0207651_10070352 | 3300025960 | Bacteria | 2475 |
| 304 | Ga0207651_10162143 | 3300025960 | Bacteria | 1754 |
| 305 | Ga0207712_10093687 | 3300025961 | Bacteria | 2217 |
| 306 | Ga0207640_10033998 | 3300025981 | Bacteria | 3178 |
| 307 | Ga0207658_10085531 | 3300025986 | Bacteria | 2429 |
| 308 | Ga0207658_10183443 | 3300025986 | Bacteria | 1734 |
| 309 | Ga0207658_10379070 | 3300025986 | Bacteria | 1238 |
| 310 | Ga0207677_10020272 | 3300026023 | Bacteria | 4034 |
| 311 | Ga0207677_10110712 | 3300026023 | Bacteria | 2044 |
| 312 | Ga0207703_10027961 | 3300026035 | Bacteria | 4441 |
| 313 | Ga0207703_10096392 | 3300026035 | Bacteria | 2497 |
| 314 | Ga0207703_10412955 | 3300026035 | Unclassified | 1255 |
| 315 | Ga0207639_10348615 | 3300026041 | Bacteria | 1322 |
| 316 | Ga0207708_10000164 | 3300026075 | Bacteria | 52172 |
| 317 | Ga0207708_10110687 | 3300026075 | Bacteria | 2131 |
| 318 | Ga0207708_10343814 | 3300026075 | Bacteria | 1222 |
| 319 | Ga0207702_10207506 | 3300026078 | Bacteria | 1820 |
| 320 | Ga0207641_10110581 | 3300026088 | Bacteria | 2435 |
| 321 | Ga0207641_10113231 | 3300026088 | Bacteria | 2409 |
| 322 | Ga0207641_10117036 | 3300026088 | Unclassified | 2372 |
| 323 | Ga0207641_10298379 | 3300026088 | Bacteria | 1521 |
| 324 | Ga0207641_10385985 | 3300026088 | Bacteria | 1342 |
| 325 | Ga0207648_10018921 | 3300026089 | Bacteria | 6221 |
| 326 | Ga0207648_10026038 | 3300026089 | Bacteria | 5202 |
| 327 | Ga0207648_10139363 | 3300026089 | Unclassified | 2137 |
| 328 | Ga0207648_10140738 | 3300026089 | Bacteria | 2126 |
| 329 | Ga0207648_10175411 | 3300026089 | Bacteria | 1896 |
| 330 | Ga0207648_10183371 | 3300026089 | Bacteria | 1853 |
| 331 | Ga0207648_10191266 | 3300026089 | Unclassified | 1814 |
| 332 | Ga0207648_10338434 | 3300026089 | Bacteria | 1355 |
| 333 | Ga0207676_10013045 | 3300026095 | Bacteria | 5967 |
| 334 | Ga0207676_10045078 | 3300026095 | Bacteria | 3405 |
| 335 | Ga0207676_10121111 | 3300026095 | Bacteria | 2207 |
| 336 | Ga0207676_10141773 | 3300026095 | Bacteria | 2058 |
| 337 | Ga0207676_10269116 | 3300026095 | Bacteria | 1542 |
| 338 | Ga0207675_100001661 | 3300026118 | Bacteria | 22258 |
| 339 | Ga0207675_100012451 | 3300026118 | Bacteria | 7948 |
| 340 | Ga0207675_100593937 | 3300026118 | Unclassified | 1109 |
| 341 | Ga0207683_10000842 | 3300026121 | Bacteria | 28118 |
| 342 | Ga0207683_10009202 | 3300026121 | Bacteria | 8417 |
| 343 | Ga0207683_10019715 | 3300026121 | Bacteria | 5762 |
| 344 | Ga0207683_10070350 | 3300026121 | Bacteria | 3091 |
| 345 | Ga0207683_10088409 | 3300026121 | Unclassified | 2757 |
| 346 | Ga0207683_10123304 | 3300026121 | Bacteria | 2328 |
| 347 | Ga0207683_10254691 | 3300026121 | Bacteria | 1602 |
| 348 | Ga0209983_1008398 | 3300027665 | Bacteria | 2113 |
| 349 | Ga0207428_10002315 | 3300027907 | Bacteria | 19077 |
| 350 | Ga0268266_10306972 | 3300028379 | Bacteria | 1482 |
| 351 | Ga0268265_10132344 | 3300028380 | Unclassified | 2075 |
| 352 | Ga0268264_10043084 | 3300028381 | Bacteria | 3739 |
| 353 | Ga0268264_10255348 | 3300028381 | Bacteria | 1630 |
| 354 | Ga0268264_10420933 | 3300028381 | Bacteria | 1288 |
| 355 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 356 | Ga0265330_10052497 | 3300031235 | Bacteria | 1786 |
| 357 | Ga0265332_10027227 | 3300031238 | Bacteria | 2504 |
| 358 | Ga0265328_10003094 | 3300031239 | Bacteria | 7428 |
| 359 | Ga0265320_10018587 | 3300031240 | Bacteria | 3823 |
| 360 | Ga0265329_10015543 | 3300031242 | Bacteria | 2657 |
| 361 | Ga0265331_10007315 | 3300031250 | Bacteria | 6397 |
| 362 | Ga0265331_10073038 | 3300031250 | Bacteria | 1602 |
| 363 | Ga0265327_10136086 | 3300031251 | Bacteria | 1152 |
| 364 | Ga0265316_10020113 | 3300031344 | Bacteria | 5690 |
| 365 | Ga0307513_10255258 | 3300031456 | Bacteria | 1547 |
| 366 | Ga0265314_10004625 | 3300031711 | Bacteria | 12676 |
| 367 | Ga0265342_10008833 | 3300031712 | Bacteria | 7184 |
| 368 | Ga0307413_10119097 | 3300031824 | Bacteria | 1784 |
| 369 | Ga0307406_10063268 | 3300031901 | Bacteria | 2396 |
| 370 | Ga0307406_10401165 | 3300031901 | Bacteria | 1087 |
| 371 | Ga0307416_100056882 | 3300032002 | Bacteria | 3160 |
| 372 | Ga0307416_100082234 | 3300032002 | Bacteria | 2727 |
| 373 | Ga0307416_100341604 | 3300032002 | Bacteria | 1510 |
| 374 | Ga0307414_10010466 | 3300032004 | Bacteria | 5384 |
| 375 | Ga0307414_10111924 | 3300032004 | Bacteria | 2080 |
| 376 | Ga0307411_10022589 | 3300032005 | Bacteria | 3707 |
| 377 | Ga0307507_10057290 | 3300033179 | Bacteria | 3671 |
| 378 | Ga0307507_10072150 | 3300033179 | Bacteria | 3114 |
| 379 | Ga0373938_0002899 | 3300034957 | Bacteria | 2770 |
| 380 | Ga0373944_0001668 | 3300035089 | Bacteria | 5612 |
| 381 | Ga0373949_0009227 | 3300035090 | Bacteria | 2161 |
| 382 | Ga0373952_0003897 | 3300035092 | Bacteria | 2700 |
| 383 | Ga0373932_0002181 | 3300035112 | Bacteria | 5054 |
| 384 | Ga0373939_0003147 | 3300035114 | Bacteria | 3881 |
| 385 | Ga0373941_0023281 | 3300035115 | Bacteria | 1766 |
| 386 | Ga0373945_0004697 | 3300035116 | Bacteria | 4349 |
| 387 | Ga0373960_0092235 | 3300035121 | Bacteria | 970 |
| 388 | Ga0373943_0068938 | 3300035170 | Bacteria | 1786 |
| 389 | Ga0373946_0004763 | 3300035171 | Bacteria | 4880 |
| 390 | Ga0373942_0013227 | 3300035207 | Bacteria | 1981 |
| 391 | Ga0373962_0021669 | 3300035242 | Bacteria | 1697 |
| 392 | Ga0373931_0000219 | 3300035691 | Bacteria | 24390 |
| 393 | Ga0373931_0007275 | 3300035691 | Bacteria | 5209 |
| 394 | Ga0373931_0065085 | 3300035691 | Bacteria | 1975 |
| 395 | Ga0373935_0010195 | 3300035692 | Bacteria | 5629 |
| 396 | Ga0373935_0062228 | 3300035692 | Bacteria | 2390 |
| 397 | Ga0373927_0037748 | 3300035695 | Bacteria | 3138 |
| 398 | Ga0373927_0040650 | 3300035695 | Bacteria | 3016 |
| 399 | Ga0373927_0128369 | 3300035695 | Bacteria | 1656 |
| 400 | Ga0373947_0024353 | 3300035725 | Bacteria | 3526 |
| 401 | Ga0373947_0123187 | 3300035725 | Bacteria | 1648 |
| 402 | Ga0373925_0038809 | 3300037068 | Bacteria | 3522 |
| 403 | Ga0373925_0092179 | 3300037068 | Bacteria | 2317 |
| 404 | Ga0395898_0024791 | 3300037466 | Bacteria | 6047 |
| 405 | Ga0436365_0005825 | 3300039437 | Bacteria | 14430 |
| 406 | Ga0436365_1239789 | 3300039437 | Bacteria | 4746 |
| 407 | Ga0451807_0129364 | 3300041486 | Bacteria | 1694 |
| 408 | Ga0451853_1244909 | 3300041512 | Bacteria | 2607 |
| 409 | Ga0439435_0025032 | 3300042436 | Bacteria | 1579 |
| 410 | Ga0451577_0240145 | 3300042876 | Bacteria | 1639 |
| 411 | Ga0451577_0597146 | 3300042876 | Unclassified | 1002 |
| 412 | Ga0451576_0000360 | 3300045051 | Bacteria | 109145 |
| 413 | Ga0451576_0018486 | 3300045051 | Bacteria | 7640 |
| 414 | Ga0451576_0094604 | 3300045051 | Bacteria | 3107 |
| 415 | Ga0451576_0207239 | 3300045051 | Bacteria | 2047 |
| 416 | Ga0451576_0424522 | 3300045051 | Bacteria | 1395 |
| 417 | Ga0495603_0004135 | 3300046455 | Bacteria | 8643 |
| 418 | Ga0495629_0202138 | 3300046459 | Unclassified | 1374 |
| 419 | Ga0495639_0008792 | 3300046475 | Bacteria | 4331 |
| 420 | Ga0495648_0073983 | 3300046524 | Bacteria | 1965 |
| 421 | Ga0495586_0141706 | 3300046535 | Bacteria | 1349 |
| 422 | Ga0495622_0063818 | 3300046557 | Bacteria | 1704 |
| 423 | Ga0495656_0026296 | 3300046615 | Bacteria | 2316 |
| 424 | Ga0495656_0069367 | 3300046615 | Bacteria | 1561 |
| 425 | Ga0495647_0000621 | 3300046681 | Bacteria | 10454 |
| 426 | Ga0495581_0081354 | 3300047315 | Bacteria | 1875 |
| 427 | Ga0495672_0045451 | 3300047320 | Bacteria | 2627 |
| 428 | Ga0495676_0027558 | 3300047321 | Bacteria | 4868 |
| 429 | Ga0496101_0064967 | 3300048904 | Bacteria | 2660 |
| 430 | Ga0496101_0079227 | 3300048904 | Bacteria | 2425 |
| 431 | Ga0496104_0311552 | 3300048907 | Bacteria | 1487 |
| 432 | Ga0496106_0281396 | 3300048909 | Bacteria | 1333 |
| 433 | Ga0496108_0128795 | 3300048911 | Bacteria | 2175 |
| 434 | Ga0496108_0267556 | 3300048911 | Bacteria | 1488 |
| 435 | Ga0496108_0352791 | 3300048911 | Bacteria | 1284 |
| 436 | Ga0496109_0190543 | 3300048912 | Bacteria | 1927 |
| 437 | Ga0496110_0038823 | 3300048913 | Bacteria | 4144 |
| 438 | Ga0496110_0118524 | 3300048913 | Bacteria | 2384 |
| 439 | Ga0496110_0177813 | 3300048913 | Bacteria | 1932 |
| 440 | Ga0496112_0002790 | 3300048915 | Bacteria | 14183 |
| 441 | Ga0496113_0034333 | 3300048916 | Bacteria | 3701 |
| 442 | Ga0496114_0241554 | 3300048917 | Unclassified | 1588 |
| 443 | Ga0496114_0365797 | 3300048917 | Bacteria | 1276 |
| 444 | Ga0496115_0049347 | 3300048918 | Bacteria | 3369 |
| 445 | Ga0496122_0112670 | 3300048925 | Bacteria | 1780 |
| 446 | Ga0496123_0096083 | 3300048926 | Bacteria | 1741 |
| 447 | Ga0496124_0011939 | 3300048927 | Bacteria | 8643 |
| 448 | Ga0496126_0131537 | 3300048929 | Bacteria | 2162 |
| 449 | nmdc:mga03683_3980_c1 | 3300050489 | Bacteria | 3775 |
| 450 | nmdc:mga03683_41752_c1 | 3300050489 | Bacteria | 1885 |
| 451 | nmdc:mga03n38_31288_c1 | 3300050490 | Bacteria | 2244 |
| 452 | nmdc:mga00v17_1674_c1 | 3300050491 | Bacteria | 11533 |
| 453 | nmdc:mga00v17_23049_c1 | 3300050491 | Bacteria | 3599 |
| 454 | nmdc:mga00v17_48966_c1 | 3300050491 | Bacteria | 2562 |
| 455 | nmdc:mga0yw44_109480_c1 | 3300050492 | Bacteria | 1769 |
| 456 | nmdc:mga0yw44_203906_c1 | 3300050492 | Bacteria | 1307 |
| 457 | nmdc:mga0k408_4514_c1 | 3300050493 | Bacteria | 7389 |
| 458 | nmdc:mga06z11_154105_c1 | 3300050494 | Bacteria | 1309 |
| 459 | nmdc:mga06z11_43659_c1 | 3300050494 | Bacteria | 2257 |
| 460 | nmdc:mga05p37_846_c1 | 3300050507 | Bacteria | 34377 |
| 461 | nmdc:mga09592_12829_c1 | 3300050508 | Bacteria | 6832 |
| 462 | nmdc:mga09592_146887_c1 | 3300050508 | Bacteria | 2033 |
| 463 | nmdc:mga09592_46566_c1 | 3300050508 | Bacteria | 3653 |
| 464 | nmdc:mga09592_47965_c1 | 3300050508 | Bacteria | 3600 |
| 465 | nmdc:mga09592_561_c1 | 3300050508 | Bacteria | 28236 |
| 466 | nmdc:mga09592_78080_c1 | 3300050508 | Bacteria | 2817 |
| 467 | nmdc:mga0qj67_15803_c1 | 3300050509 | Bacteria | 5717 |
| 468 | nmdc:mga0qj67_64_c1 | 3300050509 | Bacteria | 77795 |
| 469 | nmdc:mga0qj67_75748_c1 | 3300050509 | Bacteria | 2690 |
| 470 | nmdc:mga0qj67_96934_c1 | 3300050509 | Bacteria | 2374 |
| 471 | nmdc:mga06r32_144056_c1 | 3300050510 | Bacteria | 2360 |
| 472 | nmdc:mga06r32_51213_c1 | 3300050510 | Bacteria | 3951 |
| 473 | nmdc:mga06r32_557216_c1 | 3300050510 | Bacteria | 1120 |
| 474 | nmdc:mga08y16_104655_c1 | 3300050511 | Bacteria | 2946 |
| 475 | nmdc:mga08y16_108901_c1 | 3300050511 | Bacteria | 2884 |
| 476 | nmdc:mga08y16_15302_c1 | 3300050511 | Bacteria | 8071 |
| 477 | nmdc:mga08y16_159679_c1 | 3300050511 | Bacteria | 2342 |
| 478 | nmdc:mga08y16_172002_c1 | 3300050511 | Bacteria | 2250 |
| 479 | nmdc:mga08y16_34567_c1 | 3300050511 | Bacteria | 5310 |
| 480 | nmdc:mga08y16_51234_c1 | 3300050511 | Bacteria | 4319 |
| 481 | nmdc:mga08y16_59130_c1 | 3300050511 | Bacteria | 4004 |
| 482 | nmdc:mga0n895_1039_c1 | 3300050512 | Bacteria | 20185 |
| 483 | nmdc:mga0n895_431834_c1 | 3300050512 | Bacteria | 1331 |
| 484 | nmdc:mga0n895_720781_c1 | 3300050512 | Bacteria | 992 |
| 485 | nmdc:mga0rr50_597_c1 | 3300050513 | Bacteria | 19339 |
| 486 | nmdc:mga08x19_2849_c1 | 3300050514 | Bacteria | 10424 |
| 487 | nmdc:mga08x19_440_c1 | 3300050514 | Bacteria | 28562 |
| 488 | nmdc:mga0a205_160244_c1 | 3300050515 | Bacteria | 2147 |
| 489 | nmdc:mga0a205_432_c1 | 3300050515 | Bacteria | 32225 |
| 490 | nmdc:mga0sz30_15319_c1 | 3300050516 | Bacteria | 2795 |
| 491 | Ga0500641_0002674 | 3300053096 | Bacteria | 6295 |
| 492 | Ga0500557_000021 | 3300053105 | Bacteria | 89662 |
| 493 | Ga0500652_000029 | 3300053131 | Bacteria | 91212 |
| 494 | Ga0500568_0021375 | 3300053139 | Bacteria | 2785 |
| 495 | Ga0500636_0094112 | 3300053177 | Bacteria | 1712 |
| 496 | Ga0500625_046945 | 3300053729 | Bacteria | 2011 |
| 497 | Ga0500645_022866 | 3300053730 | Bacteria | 1919 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026035 | Ga0207703_10412955 | Ga0207703_104129552 | 241 |
| 2 | 3300006844 | Ga0075428_100320893 | Ga0075428_1003208932 | 253 |
| 3 | 3300048915 | Ga0496112_0002790 | Ga0496112_0002790_4679_5620 | 253 |
| 4 | 3300048916 | Ga0496113_0034333 | Ga0496113_0034333_2251_3192 | 253 |
| 5 | 3300005328 | Ga0070676_10252918 | Ga0070676_102529181 | 256 |
| 6 | 3300005335 | Ga0070666_10215350 | Ga0070666_102153503 | 256 |
| 7 | 3300005355 | Ga0070671_100119623 | Ga0070671_1001196233 | 256 |
| 8 | 3300005364 | Ga0070673_100045962 | Ga0070673_1000459622 | 256 |
| 9 | 3300005459 | Ga0068867_100134655 | Ga0068867_1001346553 | 256 |
| 10 | 3300005618 | Ga0068864_100119109 | Ga0068864_1001191092 | 256 |
| 11 | 3300006358 | Ga0068871_100226195 | Ga0068871_1002261953 | 256 |
| 12 | 3300025907 | Ga0207645_10002842 | Ga0207645_100028426 | 256 |
| 13 | 3300026089 | Ga0207648_10175411 | Ga0207648_101754111 | 256 |
| 14 | 3300026095 | Ga0207676_10269116 | Ga0207676_102691163 | 256 |
| 15 | 3300028381 | Ga0268264_10043084 | Ga0268264_100430842 | 256 |
| 16 | 3300033179 | Ga0307507_10057290 | Ga0307507_100572902 | 257 |
| 17 | 3300048904 | Ga0496101_0064967 | Ga0496101_0064967_238_1155 | 257 |
| 18 | 3300025940 | Ga0207691_10192597 | Ga0207691_101925972 | 259 |
| 19 | 3300025908 | Ga0207643_10026556 | Ga0207643_100265561 | 262 |
| 20 | 3300005339 | Ga0070660_100282725 | Ga0070660_1002827252 | 265 |
| 21 | 3300010375 | Ga0105239_10023090 | Ga0105239_100230905 | 265 |
| 22 | 3300013100 | Ga0157373_10009982 | Ga0157373_100099822 | 265 |
| 23 | 3300013105 | Ga0157369_10015469 | Ga0157369_100154697 | 265 |
| 24 | 3300025914 | Ga0207671_10019541 | Ga0207671_100195415 | 265 |
| 25 | 3300048925 | Ga0496122_0112670 | Ga0496122_0112670_119_1114 | 265 |
| 26 | 3300048926 | Ga0496123_0096083 | Ga0496123_0096083_282_1277 | 265 |
| 27 | 3300048927 | Ga0496124_0011939 | Ga0496124_0011939_4011_5006 | 265 |
| 28 | 3300006847 | Ga0075431_100007328 | Ga0075431_1000073283 | 266 |
| 29 | 3300026089 | Ga0207648_10183371 | Ga0207648_101833712 | 266 |
| 30 | 3300028794 | Ga0307515_10000028 | Ga0307515_10000028241 | 266 |
| 31 | 3300006844 | Ga0075428_100006367 | Ga0075428_1000063675 | 269 |
| 32 | 3300006846 | Ga0075430_100175632 | Ga0075430_1001756322 | 269 |
| 33 | 3300006880 | Ga0075429_100026175 | Ga0075429_1000261752 | 269 |
| 34 | 3300009094 | Ga0111539_10136024 | Ga0111539_101360243 | 269 |
| 35 | 3300046615 | Ga0495656_0026296 | Ga0495656_0026296_725_1720 | 269 |
| 36 | 3300050508 | nmdc:mga09592_47965_c1 | nmdc:mga09592_47965_c1_2370_3371 | 269 |
| 37 | 3300050511 | nmdc:mga08y16_15302_c1 | nmdc:mga08y16_15302_c1_5564_6565 | 269 |
| 38 | 3300013308 | Ga0157375_10062193 | Ga0157375_100621931 | 272 |
| 39 | 3300042876 | Ga0451577_0597146 | Ga0451577_0597146_26_892 | 274 |
| 40 | iso_pu_bacteria | 2881927736 | 2881927754 | 274 |
| 41 | 3300005331 | Ga0070670_100060075 | Ga0070670_1000600751 | 275 |
| 42 | 3300005338 | Ga0068868_100248789 | Ga0068868_1002487892 | 275 |
| 43 | 3300005353 | Ga0070669_100259359 | Ga0070669_1002593592 | 275 |
| 44 | 3300005354 | Ga0070675_100090122 | Ga0070675_1000901222 | 275 |
| 45 | 3300005354 | Ga0070675_100121508 | Ga0070675_1001215082 | 275 |
| 46 | 3300005364 | Ga0070673_100047155 | Ga0070673_1000471552 | 275 |
| 47 | 3300005365 | Ga0070688_100168915 | Ga0070688_1001689152 | 275 |
| 48 | 3300005457 | Ga0070662_100190769 | Ga0070662_1001907691 | 275 |
| 49 | 3300005840 | Ga0068870_10037083 | Ga0068870_100370832 | 275 |
| 50 | 3300005844 | Ga0068862_100007686 | Ga0068862_1000076862 | 275 |
| 51 | 3300013308 | Ga0157375_10127538 | Ga0157375_101275382 | 275 |
| 52 | 3300014325 | Ga0163163_10426151 | Ga0163163_104261512 | 275 |
| 53 | 3300014745 | Ga0157377_10117180 | Ga0157377_101171802 | 275 |
| 54 | 3300017792 | Ga0163161_10142421 | Ga0163161_101424212 | 275 |
| 55 | 3300025315 | Ga0207697_10043350 | Ga0207697_100433502 | 275 |
| 56 | 3300025893 | Ga0207682_10005416 | Ga0207682_100054161 | 275 |
| 57 | 3300025908 | Ga0207643_10013273 | Ga0207643_100132733 | 275 |
| 58 | 3300025923 | Ga0207681_10011863 | Ga0207681_100118632 | 275 |
| 59 | 3300025925 | Ga0207650_10031423 | Ga0207650_100314232 | 275 |
| 60 | 3300025926 | Ga0207659_10011762 | Ga0207659_100117625 | 275 |
| 61 | 3300025926 | Ga0207659_10038856 | Ga0207659_100388563 | 275 |
| 62 | 3300025933 | Ga0207706_10007245 | Ga0207706_100072458 | 275 |
| 63 | 3300025942 | Ga0207689_10089929 | Ga0207689_100899292 | 275 |
| 64 | 3300025945 | Ga0207679_10222258 | Ga0207679_102222582 | 275 |
| 65 | 3300025960 | Ga0207651_10005875 | Ga0207651_100058754 | 275 |
| 66 | 3300025960 | Ga0207651_10070352 | Ga0207651_100703522 | 275 |
| 67 | 3300025986 | Ga0207658_10379070 | Ga0207658_103790702 | 275 |
| 68 | 3300026118 | Ga0207675_100012451 | Ga0207675_1000124517 | 275 |
| 69 | 3300026121 | Ga0207683_10009202 | Ga0207683_100092028 | 275 |
| 70 | 3300028379 | Ga0268266_10306972 | Ga0268266_103069722 | 275 |
| 71 | 3300031235 | Ga0265330_10052497 | Ga0265330_100524972 | 275 |
| 72 | 3300031238 | Ga0265332_10027227 | Ga0265332_100272272 | 275 |
| 73 | 3300031239 | Ga0265328_10003094 | Ga0265328_100030946 | 275 |
| 74 | 3300031240 | Ga0265320_10018587 | Ga0265320_100185874 | 275 |
| 75 | 3300031242 | Ga0265329_10015543 | Ga0265329_100155433 | 275 |
| 76 | 3300031250 | Ga0265331_10007315 | Ga0265331_100073153 | 275 |
| 77 | 3300031344 | Ga0265316_10020113 | Ga0265316_100201135 | 275 |
| 78 | 3300031711 | Ga0265314_10004625 | Ga0265314_100046258 | 275 |
| 79 | 3300031712 | Ga0265342_10008833 | Ga0265342_100088335 | 275 |
| 80 | 3300005334 | Ga0068869_100001168 | Ga0068869_10000116814 | 276 |
| 81 | 3300005336 | Ga0070680_100177248 | Ga0070680_1001772482 | 276 |
| 82 | 3300005341 | Ga0070691_10054525 | Ga0070691_100545252 | 276 |
| 83 | 3300005343 | Ga0070687_100000380 | Ga0070687_10000038014 | 276 |
| 84 | 3300005345 | Ga0070692_10065826 | Ga0070692_100658262 | 276 |
| 85 | 3300005354 | Ga0070675_100188136 | Ga0070675_1001881361 | 276 |
| 86 | 3300005406 | Ga0070703_10019210 | Ga0070703_100192102 | 276 |
| 87 | 3300005438 | Ga0070701_10004845 | Ga0070701_100048452 | 276 |
| 88 | 3300005440 | Ga0070705_100003046 | Ga0070705_1000030469 | 276 |
| 89 | 3300005441 | Ga0070700_100050093 | Ga0070700_1000500932 | 276 |
| 90 | 3300005444 | Ga0070694_100053296 | Ga0070694_1000532963 | 276 |
| 91 | 3300005459 | Ga0068867_100202314 | Ga0068867_1002023142 | 276 |
| 92 | 3300005530 | Ga0070679_100024079 | Ga0070679_1000240792 | 276 |
| 93 | 3300005544 | Ga0070686_100062911 | Ga0070686_1000629112 | 276 |
| 94 | 3300005545 | Ga0070695_100000728 | Ga0070695_1000007285 | 276 |
| 95 | 3300005546 | Ga0070696_100006658 | Ga0070696_1000066582 | 276 |
| 96 | 3300005547 | Ga0070693_100000072 | Ga0070693_10000007225 | 276 |
| 97 | 3300005549 | Ga0070704_100003550 | Ga0070704_1000035502 | 276 |
| 98 | 3300005563 | Ga0068855_100575129 | Ga0068855_1005751292 | 276 |
| 99 | 3300005578 | Ga0068854_100000912 | Ga0068854_10000091218 | 276 |
| 100 | 3300005614 | Ga0068856_100138138 | Ga0068856_1001381382 | 276 |
| 101 | 3300005615 | Ga0070702_100000084 | Ga0070702_10000008419 | 276 |
| 102 | 3300005617 | Ga0068859_100005387 | Ga0068859_1000053872 | 276 |
| 103 | 3300005718 | Ga0068866_10002137 | Ga0068866_100021379 | 276 |
| 104 | 3300005719 | Ga0068861_100225441 | Ga0068861_1002254412 | 276 |
| 105 | 3300005840 | Ga0068870_10112926 | Ga0068870_101129262 | 276 |
| 106 | 3300005843 | Ga0068860_100093591 | Ga0068860_1000935913 | 276 |
| 107 | 3300005844 | Ga0068862_100009057 | Ga0068862_1000090579 | 276 |
| 108 | 3300006237 | Ga0097621_100000794 | Ga0097621_10000079412 | 276 |
| 109 | 3300006847 | Ga0075431_100089285 | Ga0075431_1000892852 | 276 |
| 110 | 3300006880 | Ga0075429_100062373 | Ga0075429_1000623731 | 276 |
| 111 | 3300006881 | Ga0068865_100243364 | Ga0068865_1002433642 | 276 |
| 112 | 3300006931 | Ga0097620_100005387 | Ga0097620_1000053872 | 276 |
| 113 | 3300009092 | Ga0105250_10065403 | Ga0105250_100654032 | 276 |
| 114 | 3300009094 | Ga0111539_10198227 | Ga0111539_101982272 | 276 |
| 115 | 3300009094 | Ga0111539_10240192 | Ga0111539_102401922 | 276 |
| 116 | 3300009098 | Ga0105245_10151477 | Ga0105245_101514773 | 276 |
| 117 | 3300009148 | Ga0105243_10104191 | Ga0105243_101041912 | 276 |
| 118 | 3300009174 | Ga0105241_10066851 | Ga0105241_100668512 | 276 |
| 119 | 3300009176 | Ga0105242_10003543 | Ga0105242_100035434 | 276 |
| 120 | 3300009177 | Ga0105248_10321760 | Ga0105248_103217602 | 276 |
| 121 | 3300010375 | Ga0105239_10710329 | Ga0105239_107103291 | 276 |
| 122 | 3300013297 | Ga0157378_10491183 | Ga0157378_104911832 | 276 |
| 123 | 3300014969 | Ga0157376_10124981 | Ga0157376_101249813 | 276 |
| 124 | 3300025899 | Ga0207642_10000462 | Ga0207642_1000046215 | 276 |
| 125 | 3300025911 | Ga0207654_10044963 | Ga0207654_100449632 | 276 |
| 126 | 3300025917 | Ga0207660_10002278 | Ga0207660_1000227815 | 276 |
| 127 | 3300025918 | Ga0207662_10000133 | Ga0207662_1000013337 | 276 |
| 128 | 3300025921 | Ga0207652_10090340 | Ga0207652_100903402 | 276 |
| 129 | 3300025934 | Ga0207686_10107323 | Ga0207686_101073232 | 276 |
| 130 | 3300025938 | Ga0207704_10025398 | Ga0207704_100253982 | 276 |
| 131 | 3300025941 | Ga0207711_10265342 | Ga0207711_102653422 | 276 |
| 132 | 3300025949 | Ga0207667_10299372 | Ga0207667_102993722 | 276 |
| 133 | 3300025961 | Ga0207712_10093687 | Ga0207712_100936872 | 276 |
| 134 | 3300026035 | Ga0207703_10096392 | Ga0207703_100963923 | 276 |
| 135 | 3300026075 | Ga0207708_10000164 | Ga0207708_1000016436 | 276 |
| 136 | 3300026078 | Ga0207702_10207506 | Ga0207702_102075062 | 276 |
| 137 | 3300026089 | Ga0207648_10140738 | Ga0207648_101407382 | 276 |
| 138 | 3300026118 | Ga0207675_100001661 | Ga0207675_1000016612 | 276 |
| 139 | 3300027665 | Ga0209983_1008398 | Ga0209983_10083982 | 276 |
| 140 | 3300032004 | Ga0307414_10111924 | Ga0307414_101119242 | 276 |
| 141 | 3300035691 | Ga0373931_0007275 | Ga0373931_0007275_549_1421 | 276 |
| 142 | 3300035692 | Ga0373935_0062228 | Ga0373935_0062228_183_1136 | 276 |
| 143 | 3300035695 | Ga0373927_0128369 | Ga0373927_0128369_533_1486 | 276 |
| 144 | 3300042436 | Ga0439435_0025032 | Ga0439435_0025032_446_1450 | 276 |
| 145 | 3300045051 | Ga0451576_0207239 | Ga0451576_0207239_456_1433 | 276 |
| 146 | 3300048909 | Ga0496106_0281396 | Ga0496106_0281396_252_1256 | 276 |
| 147 | 3300048917 | Ga0496114_0241554 | Ga0496114_0241554_279_1259 | 276 |
| 148 | 3300050492 | nmdc:mga0yw44_203906_c1 | nmdc:mga0yw44_203906_c1_79_1068 | 276 |
| 149 | 3300050509 | nmdc:mga0qj67_15803_c1 | nmdc:mga0qj67_15803_c1_260_1189 | 276 |
| 150 | 3300050510 | nmdc:mga06r32_144056_c1 | nmdc:mga06r32_144056_c1_264_1193 | 276 |
| 151 | 3300050511 | nmdc:mga08y16_159679_c1 | nmdc:mga08y16_159679_c1_566_1531 | 276 |
| 152 | 3300050511 | nmdc:mga08y16_59130_c1 | nmdc:mga08y16_59130_c1_11_994 | 276 |
| 153 | 3300053139 | Ga0500568_0021375 | Ga0500568_0021375_1335_2336 | 276 |
| 154 | 3300005331 | Ga0070670_100038815 | Ga0070670_1000388153 | 277 |
| 155 | 3300005331 | Ga0070670_100068153 | Ga0070670_1000681532 | 277 |
| 156 | 3300005338 | Ga0068868_100024718 | Ga0068868_1000247183 | 277 |
| 157 | 3300005344 | Ga0070661_100058552 | Ga0070661_1000585522 | 277 |
| 158 | 3300005354 | Ga0070675_100046473 | Ga0070675_1000464734 | 277 |
| 159 | 3300005356 | Ga0070674_100034526 | Ga0070674_1000345263 | 277 |
| 160 | 3300005456 | Ga0070678_100010047 | Ga0070678_1000100473 | 277 |
| 161 | 3300005459 | Ga0068867_100038038 | Ga0068867_1000380382 | 277 |
| 162 | 3300006051 | Ga0075364_10000478 | Ga0075364_1000047817 | 277 |
| 163 | 3300006195 | Ga0075366_10026652 | Ga0075366_100266524 | 277 |
| 164 | 3300025933 | Ga0207706_10319930 | Ga0207706_103199302 | 277 |
| 165 | 3300025945 | Ga0207679_10267156 | Ga0207679_102671562 | 277 |
| 166 | 3300032002 | Ga0307416_100056882 | Ga0307416_1000568822 | 277 |
| 167 | 3300035089 | Ga0373944_0001668 | Ga0373944_0001668_4234_5220 | 277 |
| 168 | 3300035116 | Ga0373945_0004697 | Ga0373945_0004697_1829_2815 | 277 |
| 169 | 3300035121 | Ga0373960_0092235 | Ga0373960_0092235_41_913 | 277 |
| 170 | 3300035170 | Ga0373943_0068938 | Ga0373943_0068938_651_1637 | 277 |
| 171 | 3300035171 | Ga0373946_0004763 | Ga0373946_0004763_675_1661 | 277 |
| 172 | 3300035691 | Ga0373931_0065085 | Ga0373931_0065085_94_1056 | 277 |
| 173 | 3300035692 | Ga0373935_0010195 | Ga0373935_0010195_650_1636 | 277 |
| 174 | 3300035695 | Ga0373927_0040650 | Ga0373927_0040650_559_1545 | 277 |
| 175 | 3300035725 | Ga0373947_0123187 | Ga0373947_0123187_140_1126 | 277 |
| 176 | 3300037068 | Ga0373925_0092179 | Ga0373925_0092179_268_1254 | 277 |
| 177 | 3300046455 | Ga0495603_0004135 | Ga0495603_0004135_2154_3140 | 277 |
| 178 | 3300046475 | Ga0495639_0008792 | Ga0495639_0008792_2150_3136 | 277 |
| 179 | 3300046535 | Ga0495586_0141706 | Ga0495586_0141706_267_1253 | 277 |
| 180 | 3300046557 | Ga0495622_0063818 | Ga0495622_0063818_795_1667 | 277 |
| 181 | 3300046681 | Ga0495647_0000621 | Ga0495647_0000621_3474_4460 | 277 |
| 182 | 3300047315 | Ga0495581_0081354 | Ga0495581_0081354_68_1054 | 277 |
| 183 | 3300047321 | Ga0495676_0027558 | Ga0495676_0027558_285_1271 | 277 |
| 184 | 3300050491 | nmdc:mga00v17_1674_c1 | nmdc:mga00v17_1674_c1_466_1449 | 277 |
| 185 | 3300050491 | nmdc:mga00v17_48966_c1 | nmdc:mga00v17_48966_c1_333_1307 | 277 |
| 186 | 3300050493 | nmdc:mga0k408_4514_c1 | nmdc:mga0k408_4514_c1_4580_5533 | 277 |
| 187 | 3300050509 | nmdc:mga0qj67_96934_c1 | nmdc:mga0qj67_96934_c1_311_1180 | 277 |
| 188 | iso_pu_bacteria | 2643221621 | 2644123935 | 277 |
| 189 | iso_pu_bacteria | 2857537821 | 2857539369 | 277 |
| 190 | 3300005331 | Ga0070670_100012056 | Ga0070670_1000120562 | 278 |
| 191 | 3300005331 | Ga0070670_100020779 | Ga0070670_1000207792 | 278 |
| 192 | 3300005331 | Ga0070670_100397305 | Ga0070670_1003973051 | 278 |
| 193 | 3300005333 | Ga0070677_10141536 | Ga0070677_101415361 | 278 |
| 194 | 3300005335 | Ga0070666_10049302 | Ga0070666_100493022 | 278 |
| 195 | 3300005338 | Ga0068868_100104203 | Ga0068868_1001042032 | 278 |
| 196 | 3300005338 | Ga0068868_100204046 | Ga0068868_1002040461 | 278 |
| 197 | 3300005340 | Ga0070689_100236790 | Ga0070689_1002367902 | 278 |
| 198 | 3300005354 | Ga0070675_100017456 | Ga0070675_1000174562 | 278 |
| 199 | 3300005354 | Ga0070675_100018560 | Ga0070675_1000185602 | 278 |
| 200 | 3300005355 | Ga0070671_100488368 | Ga0070671_1004883681 | 278 |
| 201 | 3300005364 | Ga0070673_100017670 | Ga0070673_1000176703 | 278 |
| 202 | 3300005364 | Ga0070673_100081947 | Ga0070673_1000819472 | 278 |
| 203 | 3300005364 | Ga0070673_100230331 | Ga0070673_1002303312 | 278 |
| 204 | 3300005440 | Ga0070705_100054125 | Ga0070705_1000541252 | 278 |
| 205 | 3300005458 | Ga0070681_10109655 | Ga0070681_101096553 | 278 |
| 206 | 3300005459 | Ga0068867_100018513 | Ga0068867_1000185133 | 278 |
| 207 | 3300005543 | Ga0070672_100213075 | Ga0070672_1002130752 | 278 |
| 208 | 3300005547 | Ga0070693_100168784 | Ga0070693_1001687841 | 278 |
| 209 | 3300005564 | Ga0070664_100148198 | Ga0070664_1001481982 | 278 |
| 210 | 3300005564 | Ga0070664_100344754 | Ga0070664_1003447541 | 278 |
| 211 | 3300005577 | Ga0068857_100076768 | Ga0068857_1000767682 | 278 |
| 212 | 3300005616 | Ga0068852_100045312 | Ga0068852_1000453124 | 278 |
| 213 | 3300005617 | Ga0068859_100335266 | Ga0068859_1003352662 | 278 |
| 214 | 3300005618 | Ga0068864_100117463 | Ga0068864_1001174632 | 278 |
| 215 | 3300005618 | Ga0068864_100202678 | Ga0068864_1002026782 | 278 |
| 216 | 3300005840 | Ga0068870_10040906 | Ga0068870_100409062 | 278 |
| 217 | 3300005840 | Ga0068870_10074604 | Ga0068870_100746041 | 278 |
| 218 | 3300005841 | Ga0068863_100083577 | Ga0068863_1000835772 | 278 |
| 219 | 3300005844 | Ga0068862_100557443 | Ga0068862_1005574431 | 278 |
| 220 | 3300005937 | Ga0081455_10045042 | Ga0081455_100450424 | 278 |
| 221 | 3300005983 | Ga0081540_1001688 | Ga0081540_100168815 | 278 |
| 222 | 3300006038 | Ga0075365_10060805 | Ga0075365_100608051 | 278 |
| 223 | 3300006042 | Ga0075368_10001378 | Ga0075368_100013783 | 278 |
| 224 | 3300006186 | Ga0075369_10032960 | Ga0075369_100329603 | 278 |
| 225 | 3300006195 | Ga0075366_10007090 | Ga0075366_100070905 | 278 |
| 226 | 3300006237 | Ga0097621_100039429 | Ga0097621_1000394291 | 278 |
| 227 | 3300006237 | Ga0097621_100105133 | Ga0097621_1001051332 | 278 |
| 228 | 3300006358 | Ga0068871_100076190 | Ga0068871_1000761902 | 278 |
| 229 | 3300006358 | Ga0068871_100077624 | Ga0068871_1000776243 | 278 |
| 230 | 3300006358 | Ga0068871_100106635 | Ga0068871_1001066352 | 278 |
| 231 | 3300006846 | Ga0075430_100249203 | Ga0075430_1002492031 | 278 |
| 232 | 3300006847 | Ga0075431_100046926 | Ga0075431_1000469262 | 278 |
| 233 | 3300006931 | Ga0097620_100335255 | Ga0097620_1003352552 | 278 |
| 234 | 3300009093 | Ga0105240_10266304 | Ga0105240_102663042 | 278 |
| 235 | 3300009094 | Ga0111539_10093128 | Ga0111539_100931283 | 278 |
| 236 | 3300009176 | Ga0105242_10416285 | Ga0105242_104162852 | 278 |
| 237 | 3300009177 | Ga0105248_10227435 | Ga0105248_102274353 | 278 |
| 238 | 3300013297 | Ga0157378_10029668 | Ga0157378_100296684 | 278 |
| 239 | 3300013306 | Ga0163162_10056076 | Ga0163162_100560764 | 278 |
| 240 | 3300013306 | Ga0163162_10213683 | Ga0163162_102136832 | 278 |
| 241 | 3300013308 | Ga0157375_10035490 | Ga0157375_100354904 | 278 |
| 242 | 3300013308 | Ga0157375_10106664 | Ga0157375_101066642 | 278 |
| 243 | 3300013308 | Ga0157375_10159606 | Ga0157375_101596062 | 278 |
| 244 | 3300014969 | Ga0157376_10037821 | Ga0157376_100378212 | 278 |
| 245 | 3300014969 | Ga0157376_10074418 | Ga0157376_100744182 | 278 |
| 246 | 3300017792 | Ga0163161_10039368 | Ga0163161_100393683 | 278 |
| 247 | 3300017792 | Ga0163161_10074213 | Ga0163161_100742131 | 278 |
| 248 | 3300017792 | Ga0163161_10078846 | Ga0163161_100788462 | 278 |
| 249 | 3300025908 | Ga0207643_10121907 | Ga0207643_101219071 | 278 |
| 250 | 3300025910 | Ga0207684_10420612 | Ga0207684_104206121 | 278 |
| 251 | 3300025913 | Ga0207695_10146172 | Ga0207695_101461722 | 278 |
| 252 | 3300025923 | Ga0207681_10043406 | Ga0207681_100434061 | 278 |
| 253 | 3300025923 | Ga0207681_10084494 | Ga0207681_100844942 | 278 |
| 254 | 3300025925 | Ga0207650_10000964 | Ga0207650_1000096421 | 278 |
| 255 | 3300025925 | Ga0207650_10005459 | Ga0207650_100054593 | 278 |
| 256 | 3300025925 | Ga0207650_10152047 | Ga0207650_101520472 | 278 |
| 257 | 3300025925 | Ga0207650_10216829 | Ga0207650_102168292 | 278 |
| 258 | 3300025926 | Ga0207659_10035756 | Ga0207659_100357562 | 278 |
| 259 | 3300025926 | Ga0207659_10205645 | Ga0207659_102056452 | 278 |
| 260 | 3300025926 | Ga0207659_10265097 | Ga0207659_102650972 | 278 |
| 261 | 3300025931 | Ga0207644_10061046 | Ga0207644_100610463 | 278 |
| 262 | 3300025936 | Ga0207670_10262373 | Ga0207670_102623731 | 278 |
| 263 | 3300025938 | Ga0207704_10099330 | Ga0207704_100993302 | 278 |
| 264 | 3300025940 | Ga0207691_10013142 | Ga0207691_100131425 | 278 |
| 265 | 3300025945 | Ga0207679_10051228 | Ga0207679_100512283 | 278 |
| 266 | 3300025945 | Ga0207679_10182270 | Ga0207679_101822702 | 278 |
| 267 | 3300025960 | Ga0207651_10022621 | Ga0207651_100226214 | 278 |
| 268 | 3300025960 | Ga0207651_10162143 | Ga0207651_101621432 | 278 |
| 269 | 3300025986 | Ga0207658_10085531 | Ga0207658_100855312 | 278 |
| 270 | 3300026041 | Ga0207639_10348615 | Ga0207639_103486151 | 278 |
| 271 | 3300026075 | Ga0207708_10110687 | Ga0207708_101106871 | 278 |
| 272 | 3300026075 | Ga0207708_10343814 | Ga0207708_103438142 | 278 |
| 273 | 3300026088 | Ga0207641_10110581 | Ga0207641_101105812 | 278 |
| 274 | 3300026088 | Ga0207641_10117036 | Ga0207641_101170362 | 278 |
| 275 | 3300026089 | Ga0207648_10026038 | Ga0207648_100260384 | 278 |
| 276 | 3300026089 | Ga0207648_10191266 | Ga0207648_101912662 | 278 |
| 277 | 3300026095 | Ga0207676_10045078 | Ga0207676_100450782 | 278 |
| 278 | 3300026121 | Ga0207683_10019715 | Ga0207683_100197155 | 278 |
| 279 | 3300026121 | Ga0207683_10123304 | Ga0207683_101233042 | 278 |
| 280 | 3300026121 | Ga0207683_10254691 | Ga0207683_102546912 | 278 |
| 281 | 3300028381 | Ga0268264_10255348 | Ga0268264_102553482 | 278 |
| 282 | 3300028381 | Ga0268264_10420933 | Ga0268264_104209332 | 278 |
| 283 | 3300031251 | Ga0265327_10136086 | Ga0265327_101360862 | 278 |
| 284 | 3300033179 | Ga0307507_10072150 | Ga0307507_100721503 | 278 |
| 285 | 3300039437 | Ga0436365_1239789 | Ga0436365_1239789_1107_2072 | 278 |
| 286 | 3300041486 | Ga0451807_0129364 | Ga0451807_0129364_669_1670 | 278 |
| 287 | 3300042876 | Ga0451577_0240145 | Ga0451577_0240145_647_1624 | 278 |
| 288 | 3300046459 | Ga0495629_0202138 | Ga0495629_0202138_43_1017 | 278 |
| 289 | 3300046524 | Ga0495648_0073983 | Ga0495648_0073983_329_1345 | 278 |
| 290 | 3300047320 | Ga0495672_0045451 | Ga0495672_0045451_1012_1980 | 278 |
| 291 | 3300048911 | Ga0496108_0267556 | Ga0496108_0267556_388_1389 | 278 |
| 292 | 3300048911 | Ga0496108_0352791 | Ga0496108_0352791_100_1017 | 278 |
| 293 | 3300048913 | Ga0496110_0177813 | Ga0496110_0177813_449_1465 | 278 |
| 294 | 3300050489 | nmdc:mga03683_3980_c1 | nmdc:mga03683_3980_c1_2883_3755 | 278 |
| 295 | 3300050489 | nmdc:mga03683_41752_c1 | nmdc:mga03683_41752_c1_403_1356 | 278 |
| 296 | 3300050490 | nmdc:mga03n38_31288_c1 | nmdc:mga03n38_31288_c1_205_1158 | 278 |
| 297 | 3300050491 | nmdc:mga00v17_23049_c1 | nmdc:mga00v17_23049_c1_620_1591 | 278 |
| 298 | 3300050494 | nmdc:mga06z11_154105_c1 | nmdc:mga06z11_154105_c1_160_1131 | 278 |
| 299 | 3300050510 | nmdc:mga06r32_557216_c1 | nmdc:mga06r32_557216_c1_38_922 | 278 |
| 300 | 3300050511 | nmdc:mga08y16_172002_c1 | nmdc:mga08y16_172002_c1_883_1863 | 278 |
| 301 | 3300050512 | nmdc:mga0n895_431834_c1 | nmdc:mga0n895_431834_c1_15_941 | 278 |
| 302 | 3300053105 | Ga0500557_000021 | Ga0500557_000021_79503_80426 | 278 |
| 303 | 3300053729 | Ga0500625_046945 | Ga0500625_046945_819_1787 | 278 |
| 304 | iso_pu_bacteria | 2855730933 | 2855731597 | 278 |
| 305 | iso_pu_bacteria | 2855767633 | 2855768303 | 278 |
| 306 | iso_pu_bacteria | 2857542790 | 2857544453 | 278 |
| 307 | iso_pu_bacteria | 2885192300 | 2885194250 | 278 |
| 308 | 3300005295 | Ga0065707_10083489 | Ga0065707_100834895 | 279 |
| 309 | 3300005327 | Ga0070658_10209878 | Ga0070658_102098782 | 279 |
| 310 | 3300005327 | Ga0070658_10302621 | Ga0070658_103026211 | 279 |
| 311 | 3300005330 | Ga0070690_100239060 | Ga0070690_1002390602 | 279 |
| 312 | 3300005331 | Ga0070670_100022518 | Ga0070670_1000225183 | 279 |
| 313 | 3300005331 | Ga0070670_100270913 | Ga0070670_1002709132 | 279 |
| 314 | 3300005335 | Ga0070666_10203238 | Ga0070666_102032382 | 279 |
| 315 | 3300005338 | Ga0068868_100116708 | Ga0068868_1001167082 | 279 |
| 316 | 3300005338 | Ga0068868_100300351 | Ga0068868_1003003511 | 279 |
| 317 | 3300005340 | Ga0070689_100135584 | Ga0070689_1001355842 | 279 |
| 318 | 3300005343 | Ga0070687_100024373 | Ga0070687_1000243732 | 279 |
| 319 | 3300005354 | Ga0070675_100172401 | Ga0070675_1001724012 | 279 |
| 320 | 3300005354 | Ga0070675_100206259 | Ga0070675_1002062592 | 279 |
| 321 | 3300005355 | Ga0070671_100020414 | Ga0070671_1000204144 | 279 |
| 322 | 3300005355 | Ga0070671_100038271 | Ga0070671_1000382714 | 279 |
| 323 | 3300005356 | Ga0070674_100008629 | Ga0070674_1000086292 | 279 |
| 324 | 3300005364 | Ga0070673_100025628 | Ga0070673_1000256284 | 279 |
| 325 | 3300005364 | Ga0070673_100087651 | Ga0070673_1000876512 | 279 |
| 326 | 3300005365 | Ga0070688_100054491 | Ga0070688_1000544912 | 279 |
| 327 | 3300005367 | Ga0070667_100304382 | Ga0070667_1003043821 | 279 |
| 328 | 3300005456 | Ga0070678_100021096 | Ga0070678_1000210962 | 279 |
| 329 | 3300005459 | Ga0068867_100026050 | Ga0068867_1000260502 | 279 |
| 330 | 3300005459 | Ga0068867_100054149 | Ga0068867_1000541491 | 279 |
| 331 | 3300005543 | Ga0070672_100036368 | Ga0070672_1000363682 | 279 |
| 332 | 3300005543 | Ga0070672_100078259 | Ga0070672_1000782593 | 279 |
| 333 | 3300005543 | Ga0070672_100150716 | Ga0070672_1001507162 | 279 |
| 334 | 3300005543 | Ga0070672_100365881 | Ga0070672_1003658812 | 279 |
| 335 | 3300005545 | Ga0070695_100188650 | Ga0070695_1001886502 | 279 |
| 336 | 3300005548 | Ga0070665_100152424 | Ga0070665_1001524242 | 279 |
| 337 | 3300005564 | Ga0070664_100036993 | Ga0070664_1000369933 | 279 |
| 338 | 3300005578 | Ga0068854_100081983 | Ga0068854_1000819832 | 279 |
| 339 | 3300005614 | Ga0068856_100513807 | Ga0068856_1005138072 | 279 |
| 340 | 3300005615 | Ga0070702_100017024 | Ga0070702_1000170242 | 279 |
| 341 | 3300005618 | Ga0068864_100044158 | Ga0068864_1000441583 | 279 |
| 342 | 3300005618 | Ga0068864_100078169 | Ga0068864_1000781692 | 279 |
| 343 | 3300005618 | Ga0068864_100418528 | Ga0068864_1004185281 | 279 |
| 344 | 3300005719 | Ga0068861_100126994 | Ga0068861_1001269942 | 279 |
| 345 | 3300005719 | Ga0068861_100231210 | Ga0068861_1002312102 | 279 |
| 346 | 3300005840 | Ga0068870_10077714 | Ga0068870_100777141 | 279 |
| 347 | 3300005841 | Ga0068863_100327516 | Ga0068863_1003275162 | 279 |
| 348 | 3300005842 | Ga0068858_100024273 | Ga0068858_1000242734 | 279 |
| 349 | 3300005843 | Ga0068860_100059431 | Ga0068860_1000594312 | 279 |
| 350 | 3300005844 | Ga0068862_100029960 | Ga0068862_1000299602 | 279 |
| 351 | 3300005844 | Ga0068862_100117912 | Ga0068862_1001179122 | 279 |
| 352 | 3300005985 | Ga0081539_10012694 | Ga0081539_100126944 | 279 |
| 353 | 3300006038 | Ga0075365_10052297 | Ga0075365_100522974 | 279 |
| 354 | 3300006048 | Ga0075363_100042953 | Ga0075363_1000429532 | 279 |
| 355 | 3300006178 | Ga0075367_10014685 | Ga0075367_100146855 | 279 |
| 356 | 3300006178 | Ga0075367_10080112 | Ga0075367_100801122 | 279 |
| 357 | 3300006358 | Ga0068871_100050818 | Ga0068871_1000508182 | 279 |
| 358 | 3300006358 | Ga0068871_100093419 | Ga0068871_1000934192 | 279 |
| 359 | 3300006844 | Ga0075428_100001017 | Ga0075428_10000101731 | 279 |
| 360 | 3300006844 | Ga0075428_100002482 | Ga0075428_1000024824 | 279 |
| 361 | 3300006846 | Ga0075430_100000160 | Ga0075430_1000001604 | 279 |
| 362 | 3300006846 | Ga0075430_100008030 | Ga0075430_10000803011 | 279 |
| 363 | 3300006846 | Ga0075430_100019461 | Ga0075430_1000194615 | 279 |
| 364 | 3300006847 | Ga0075431_100004501 | Ga0075431_10000450115 | 279 |
| 365 | 3300006847 | Ga0075431_100048025 | Ga0075431_1000480256 | 279 |
| 366 | 3300006852 | Ga0075433_10095223 | Ga0075433_100952232 | 279 |
| 367 | 3300006852 | Ga0075433_10139714 | Ga0075433_101397141 | 279 |
| 368 | 3300006852 | Ga0075433_10265551 | Ga0075433_102655512 | 279 |
| 369 | 3300006871 | Ga0075434_100001156 | Ga0075434_10000115610 | 279 |
| 370 | 3300006871 | Ga0075434_100116518 | Ga0075434_1001165181 | 279 |
| 371 | 3300006880 | Ga0075429_100000365 | Ga0075429_10000036517 | 279 |
| 372 | 3300006880 | Ga0075429_100012289 | Ga0075429_1000122899 | 279 |
| 373 | 3300006880 | Ga0075429_100015874 | Ga0075429_1000158748 | 279 |
| 374 | 3300006880 | Ga0075429_100020639 | Ga0075429_1000206394 | 279 |
| 375 | 3300006880 | Ga0075429_100050977 | Ga0075429_1000509772 | 279 |
| 376 | 3300006914 | Ga0075436_100002171 | Ga0075436_1000021718 | 279 |
| 377 | 3300006914 | Ga0075436_100004556 | Ga0075436_1000045567 | 279 |
| 378 | 3300007076 | Ga0075435_100000351 | Ga0075435_10000035124 | 279 |
| 379 | 3300007076 | Ga0075435_100069719 | Ga0075435_1000697193 | 279 |
| 380 | 3300007265 | Ga0099794_10021327 | Ga0099794_100213274 | 279 |
| 381 | 3300007788 | Ga0099795_10003724 | Ga0099795_100037243 | 279 |
| 382 | 3300009094 | Ga0111539_10006886 | Ga0111539_1000688616 | 279 |
| 383 | 3300009094 | Ga0111539_10160506 | Ga0111539_101605061 | 279 |
| 384 | 3300009147 | Ga0114129_10002814 | Ga0114129_1000281419 | 279 |
| 385 | 3300009553 | Ga0105249_10202640 | Ga0105249_102026402 | 279 |
| 386 | 3300010159 | Ga0099796_10005413 | Ga0099796_100054132 | 279 |
| 387 | 3300013296 | Ga0157374_10138626 | Ga0157374_101386262 | 279 |
| 388 | 3300013296 | Ga0157374_10197730 | Ga0157374_101977302 | 279 |
| 389 | 3300013297 | Ga0157378_10048544 | Ga0157378_100485443 | 279 |
| 390 | 3300013297 | Ga0157378_10120255 | Ga0157378_101202552 | 279 |
| 391 | 3300013297 | Ga0157378_10310732 | Ga0157378_103107321 | 279 |
| 392 | 3300013306 | Ga0163162_10005090 | Ga0163162_1000509014 | 279 |
| 393 | 3300013306 | Ga0163162_10025203 | Ga0163162_100252032 | 279 |
| 394 | 3300013306 | Ga0163162_10097344 | Ga0163162_100973441 | 279 |
| 395 | 3300013308 | Ga0157375_10145037 | Ga0157375_101450372 | 279 |
| 396 | 3300013308 | Ga0157375_10153129 | Ga0157375_101531292 | 279 |
| 397 | 3300013308 | Ga0157375_10224656 | Ga0157375_102246562 | 279 |
| 398 | 3300014326 | Ga0157380_10166091 | Ga0157380_101660912 | 279 |
| 399 | 3300014968 | Ga0157379_10185762 | Ga0157379_101857622 | 279 |
| 400 | 3300014969 | Ga0157376_10050072 | Ga0157376_100500722 | 279 |
| 401 | 3300014969 | Ga0157376_10106210 | Ga0157376_101062102 | 279 |
| 402 | 3300021384 | Ga0213876_10008546 | Ga0213876_100085463 | 279 |
| 403 | 3300025315 | Ga0207697_10021444 | Ga0207697_100214442 | 279 |
| 404 | 3300025321 | Ga0207656_10093198 | Ga0207656_100931982 | 279 |
| 405 | 3300025908 | Ga0207643_10054939 | Ga0207643_100549392 | 279 |
| 406 | 3300025909 | Ga0207705_10179445 | Ga0207705_101794452 | 279 |
| 407 | 3300025920 | Ga0207649_10020716 | Ga0207649_100207162 | 279 |
| 408 | 3300025920 | Ga0207649_10069780 | Ga0207649_100697802 | 279 |
| 409 | 3300025923 | Ga0207681_10175840 | Ga0207681_101758402 | 279 |
| 410 | 3300025925 | Ga0207650_10029612 | Ga0207650_100296123 | 279 |
| 411 | 3300025925 | Ga0207650_10198541 | Ga0207650_101985411 | 279 |
| 412 | 3300025926 | Ga0207659_10099549 | Ga0207659_100995492 | 279 |
| 413 | 3300025940 | Ga0207691_10001414 | Ga0207691_1000141412 | 279 |
| 414 | 3300025940 | Ga0207691_10005400 | Ga0207691_100054003 | 279 |
| 415 | 3300025940 | Ga0207691_10016867 | Ga0207691_100168677 | 279 |
| 416 | 3300025940 | Ga0207691_10074921 | Ga0207691_100749212 | 279 |
| 417 | 3300025944 | Ga0207661_10191479 | Ga0207661_101914792 | 279 |
| 418 | 3300025945 | Ga0207679_10013268 | Ga0207679_100132684 | 279 |
| 419 | 3300025945 | Ga0207679_10040927 | Ga0207679_100409273 | 279 |
| 420 | 3300025981 | Ga0207640_10033998 | Ga0207640_100339983 | 279 |
| 421 | 3300025986 | Ga0207658_10183443 | Ga0207658_101834432 | 279 |
| 422 | 3300026023 | Ga0207677_10020272 | Ga0207677_100202723 | 279 |
| 423 | 3300026023 | Ga0207677_10110712 | Ga0207677_101107122 | 279 |
| 424 | 3300026035 | Ga0207703_10027961 | Ga0207703_100279613 | 279 |
| 425 | 3300026088 | Ga0207641_10113231 | Ga0207641_101132312 | 279 |
| 426 | 3300026088 | Ga0207641_10298379 | Ga0207641_102983792 | 279 |
| 427 | 3300026088 | Ga0207641_10385985 | Ga0207641_103859851 | 279 |
| 428 | 3300026089 | Ga0207648_10018921 | Ga0207648_100189213 | 279 |
| 429 | 3300026089 | Ga0207648_10139363 | Ga0207648_101393632 | 279 |
| 430 | 3300026089 | Ga0207648_10338434 | Ga0207648_103384342 | 279 |
| 431 | 3300026095 | Ga0207676_10013045 | Ga0207676_100130452 | 279 |
| 432 | 3300026095 | Ga0207676_10121111 | Ga0207676_101211111 | 279 |
| 433 | 3300026095 | Ga0207676_10141773 | Ga0207676_101417732 | 279 |
| 434 | 3300026118 | Ga0207675_100593937 | Ga0207675_1005939371 | 279 |
| 435 | 3300026121 | Ga0207683_10000842 | Ga0207683_1000084213 | 279 |
| 436 | 3300026121 | Ga0207683_10070350 | Ga0207683_100703503 | 279 |
| 437 | 3300026121 | Ga0207683_10088409 | Ga0207683_100884092 | 279 |
| 438 | 3300027907 | Ga0207428_10002315 | Ga0207428_100023154 | 279 |
| 439 | 3300028380 | Ga0268265_10132344 | Ga0268265_101323442 | 279 |
| 440 | 3300031250 | Ga0265331_10073038 | Ga0265331_100730382 | 279 |
| 441 | 3300031456 | Ga0307513_10255258 | Ga0307513_102552582 | 279 |
| 442 | 3300031824 | Ga0307413_10119097 | Ga0307413_101190972 | 279 |
| 443 | 3300031901 | Ga0307406_10063268 | Ga0307406_100632682 | 279 |
| 444 | 3300031901 | Ga0307406_10401165 | Ga0307406_104011651 | 279 |
| 445 | 3300032002 | Ga0307416_100082234 | Ga0307416_1000822342 | 279 |
| 446 | 3300032002 | Ga0307416_100341604 | Ga0307416_1003416042 | 279 |
| 447 | 3300032004 | Ga0307414_10010466 | Ga0307414_100104663 | 279 |
| 448 | 3300032005 | Ga0307411_10022589 | Ga0307411_100225892 | 279 |
| 449 | 3300034957 | Ga0373938_0002899 | Ga0373938_0002899_529_1401 | 279 |
| 450 | 3300035090 | Ga0373949_0009227 | Ga0373949_0009227_1167_2039 | 279 |
| 451 | 3300035092 | Ga0373952_0003897 | Ga0373952_0003897_1714_2586 | 279 |
| 452 | 3300035112 | Ga0373932_0002181 | Ga0373932_0002181_970_1842 | 279 |
| 453 | 3300035114 | Ga0373939_0003147 | Ga0373939_0003147_2842_3714 | 279 |
| 454 | 3300035115 | Ga0373941_0023281 | Ga0373941_0023281_276_1148 | 279 |
| 455 | 3300035207 | Ga0373942_0013227 | Ga0373942_0013227_184_1056 | 279 |
| 456 | 3300035242 | Ga0373962_0021669 | Ga0373962_0021669_418_1290 | 279 |
| 457 | 3300035691 | Ga0373931_0000219 | Ga0373931_0000219_16754_17626 | 279 |
| 458 | 3300035695 | Ga0373927_0037748 | Ga0373927_0037748_1691_2677 | 279 |
| 459 | 3300035725 | Ga0373947_0024353 | Ga0373947_0024353_676_1662 | 279 |
| 460 | 3300037068 | Ga0373925_0038809 | Ga0373925_0038809_1865_2851 | 279 |
| 461 | 3300037466 | Ga0395898_0024791 | Ga0395898_0024791_5028_5999 | 279 |
| 462 | 3300039437 | Ga0436365_0005825 | Ga0436365_0005825_337_1317 | 279 |
| 463 | 3300041512 | Ga0451853_1244909 | Ga0451853_1244909_260_1231 | 279 |
| 464 | 3300045051 | Ga0451576_0000360 | Ga0451576_0000360_67007_67981 | 279 |
| 465 | 3300045051 | Ga0451576_0018486 | Ga0451576_0018486_5934_6896 | 279 |
| 466 | 3300045051 | Ga0451576_0094604 | Ga0451576_0094604_745_1617 | 279 |
| 467 | 3300045051 | Ga0451576_0424522 | Ga0451576_0424522_221_1195 | 279 |
| 468 | 3300046615 | Ga0495656_0069367 | Ga0495656_0069367_116_1078 | 279 |
| 469 | 3300048904 | Ga0496101_0079227 | Ga0496101_0079227_419_1390 | 279 |
| 470 | 3300048907 | Ga0496104_0311552 | Ga0496104_0311552_166_1137 | 279 |
| 471 | 3300048911 | Ga0496108_0128795 | Ga0496108_0128795_189_1154 | 279 |
| 472 | 3300048912 | Ga0496109_0190543 | Ga0496109_0190543_304_1293 | 279 |
| 473 | 3300048913 | Ga0496110_0038823 | Ga0496110_0038823_768_1739 | 279 |
| 474 | 3300048913 | Ga0496110_0118524 | Ga0496110_0118524_51_1016 | 279 |
| 475 | 3300048917 | Ga0496114_0365797 | Ga0496114_0365797_143_1114 | 279 |
| 476 | 3300048918 | Ga0496115_0049347 | Ga0496115_0049347_787_1839 | 279 |
| 477 | 3300048929 | Ga0496126_0131537 | Ga0496126_0131537_780_1832 | 279 |
| 478 | 3300050492 | nmdc:mga0yw44_109480_c1 | nmdc:mga0yw44_109480_c1_693_1664 | 279 |
| 479 | 3300050494 | nmdc:mga06z11_43659_c1 | nmdc:mga06z11_43659_c1_84_1055 | 279 |
| 480 | 3300050507 | nmdc:mga05p37_846_c1 | nmdc:mga05p37_846_c1_18086_18958 | 279 |
| 481 | 3300050508 | nmdc:mga09592_12829_c1 | nmdc:mga09592_12829_c1_4914_5864 | 279 |
| 482 | 3300050508 | nmdc:mga09592_146887_c1 | nmdc:mga09592_146887_c1_549_1499 | 279 |
| 483 | 3300050508 | nmdc:mga09592_46566_c1 | nmdc:mga09592_46566_c1_1101_2075 | 279 |
| 484 | 3300050508 | nmdc:mga09592_561_c1 | nmdc:mga09592_561_c1_23762_24634 | 279 |
| 485 | 3300050508 | nmdc:mga09592_78080_c1 | nmdc:mga09592_78080_c1_1638_2645 | 279 |
| 486 | 3300050509 | nmdc:mga0qj67_64_c1 | nmdc:mga0qj67_64_c1_16932_17909 | 279 |
| 487 | 3300050509 | nmdc:mga0qj67_75748_c1 | nmdc:mga0qj67_75748_c1_1173_2147 | 279 |
| 488 | 3300050510 | nmdc:mga06r32_51213_c1 | nmdc:mga06r32_51213_c1_916_1923 | 279 |
| 489 | 3300050511 | nmdc:mga08y16_104655_c1 | nmdc:mga08y16_104655_c1_13_975 | 279 |
| 490 | 3300050511 | nmdc:mga08y16_108901_c1 | nmdc:mga08y16_108901_c1_241_1215 | 279 |
| 491 | 3300050511 | nmdc:mga08y16_34567_c1 | nmdc:mga08y16_34567_c1_211_1185 | 279 |
| 492 | 3300050511 | nmdc:mga08y16_51234_c1 | nmdc:mga08y16_51234_c1_484_1434 | 279 |
| 493 | 3300050512 | nmdc:mga0n895_1039_c1 | nmdc:mga0n895_1039_c1_6113_7075 | 279 |
| 494 | 3300050512 | nmdc:mga0n895_720781_c1 | nmdc:mga0n895_720781_c1_104_976 | 279 |
| 495 | 3300050513 | nmdc:mga0rr50_597_c1 | nmdc:mga0rr50_597_c1_8905_9867 | 279 |
| 496 | 3300050514 | nmdc:mga08x19_2849_c1 | nmdc:mga08x19_2849_c1_2956_3936 | 279 |
| 497 | 3300050514 | nmdc:mga08x19_440_c1 | nmdc:mga08x19_440_c1_5364_6326 | 279 |
| 498 | 3300050515 | nmdc:mga0a205_160244_c1 | nmdc:mga0a205_160244_c1_340_1284 | 279 |
| 499 | 3300050515 | nmdc:mga0a205_432_c1 | nmdc:mga0a205_432_c1_23113_24075 | 279 |
| 500 | 3300050516 | nmdc:mga0sz30_15319_c1 | nmdc:mga0sz30_15319_c1_1247_2218 | 279 |
| 501 | 3300053096 | Ga0500641_0002674 | Ga0500641_0002674_1419_2390 | 279 |
| 502 | 3300053131 | Ga0500652_000029 | Ga0500652_000029_63768_64742 | 279 |
| 503 | 3300053177 | Ga0500636_0094112 | Ga0500636_0094112_375_1349 | 279 |
| 504 | 3300053730 | Ga0500645_022866 | Ga0500645_022866_993_1898 | 279 |
| 505 | iso_pu_bacteria | 2643221621 | 2644123519 | 279 |
| 506 | iso_pu_bacteria | 2929199973 | 2929205129 | 279 |
| 507 | iso_pu_bacteria | 8055909800 | 8055915183 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9662 | 2 | 279 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9646 | 2 | 277 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9634 | 2 | 279 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9595 | 2 | 279 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9566 | 2 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9506 | 93 | 191 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9467 | 92 | 188 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9179 | 92 | 204 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9124 | 2 | 279 | 3.40.190.150 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9035 | 2 | 279 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537AE94-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9855 | 2 | 179 |
|
| AF-A0A845BC47-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9822 | 2 | 279 |
|
| AF-A0A317HXN3-F1-model_v4 | deleted | 0.9815 | 2 | 279 |
|
| AF-A0A096FIP4-F1-model_v4 | MFS transporter | 0.981 | 2 | 279 |
|
| AF-A0A2M8U4Y9-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9808 | 2 | 191 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar