F456705

General Info

Members Datasets Scaffolds Average Seq Length
507 253 497 314

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100341604|Ga0307416_1003416042
Length 368
Sequence VRCPTGCSKRFERDIRGGQPLESGPAAHRYIVRVLRDAPLGCVVACASVLWTLSTPLFAAMTVAVATAQTFPSRPIRFIVPVPPGGGADFVARAFASRLTESLGQQVVVDNRGGAAGIIAMEAVAKAAPDGYTLIQTNISTVSINPFIYPKLPYDATRDFAPVTITTLNPLVLVVHPGVPAKSVKELIAYARSKPGELTYASLGSGSVQHLAGHVFSKDAGIQTVHVPYKGAAPATVDLLARQVQMAFSGVGTVAAHVKAGRLRALAVTGSKRIDAFADAPTLAEAGGPDVQMWLWNGVLAPAGTPTPIVRRLNAELVNAARSPELIAAMATQGTAPSSSTPEEFANFIRQEQARFAKIVKESGAKAD

Samples

Sample ID Description Type Environment
1 2643221621 Achromobacter sp. Root83 Isolate Unclassified
2 2855730933 Achromobacter sp. HZ28 Isolate Nodule
3 2855767633 Achromobacter sp. HZ34 Isolate Nodule
4 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
5 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
6 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
7 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
8 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.72
Nodule 0.39
Rhizoplane 3.35
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10083489 3300005295 Bacteria 8984
2 Ga0070658_10209878 3300005327 Bacteria 1645
3 Ga0070658_10302621 3300005327 Bacteria 1363
4 Ga0070676_10252918 3300005328 Bacteria 1177
5 Ga0070690_100239060 3300005330 Bacteria 1280
6 Ga0070670_100012056 3300005331 Bacteria 7396
7 Ga0070670_100020779 3300005331 Bacteria 5645
8 Ga0070670_100022518 3300005331 Bacteria 5422
9 Ga0070670_100038815 3300005331 Bacteria 4095
10 Ga0070670_100060075 3300005331 Bacteria 3263
11 Ga0070670_100068153 3300005331 Bacteria 3054
12 Ga0070670_100270913 3300005331 Bacteria 1481
13 Ga0070670_100397305 3300005331 Bacteria 1217
14 Ga0070677_10141536 3300005333 Bacteria 1110
15 Ga0068869_100001168 3300005334 Bacteria 15386
16 Ga0070666_10049302 3300005335 Bacteria 2829
17 Ga0070666_10203238 3300005335 Bacteria 1394
18 Ga0070666_10215350 3300005335 Bacteria 1354
19 Ga0070680_100177248 3300005336 Bacteria 1794
20 Ga0068868_100024718 3300005338 Bacteria 4561
21 Ga0068868_100104203 3300005338 Bacteria 2299
22 Ga0068868_100116708 3300005338 Unclassified 2174
23 Ga0068868_100204046 3300005338 Unclassified 1649
24 Ga0068868_100248789 3300005338 Bacteria 1496
25 Ga0068868_100300351 3300005338 Bacteria 1363
26 Ga0070660_100282725 3300005339 Bacteria 1358
27 Ga0070689_100135584 3300005340 Unclassified 1976
28 Ga0070689_100236790 3300005340 Bacteria 1502
29 Ga0070691_10054525 3300005341 Bacteria 1914
30 Ga0070687_100000380 3300005343 Bacteria 15140
31 Ga0070687_100024373 3300005343 Unclassified 2888
32 Ga0070661_100058552 3300005344 Bacteria 2823
33 Ga0070692_10065826 3300005345 Bacteria 1919
34 Ga0070669_100259359 3300005353 Bacteria 1387
35 Ga0070675_100017456 3300005354 Bacteria 5702
36 Ga0070675_100018560 3300005354 Bacteria 5538
37 Ga0070675_100046473 3300005354 Bacteria 3554
38 Ga0070675_100090122 3300005354 Bacteria 2568
39 Ga0070675_100121508 3300005354 Bacteria 2219
40 Ga0070675_100172401 3300005354 Bacteria 1866
41 Ga0070675_100188136 3300005354 Bacteria 1788
42 Ga0070675_100206259 3300005354 Bacteria 1707
43 Ga0070671_100020414 3300005355 Bacteria 5403
44 Ga0070671_100038271 3300005355 Bacteria 3981
45 Ga0070671_100119623 3300005355 Bacteria 2216
46 Ga0070671_100488368 3300005355 Bacteria 1058
47 Ga0070674_100008629 3300005356 Bacteria 6074
48 Ga0070674_100034526 3300005356 Bacteria 3379
49 Ga0070673_100017670 3300005364 Bacteria 5078
50 Ga0070673_100025628 3300005364 Bacteria 4344
51 Ga0070673_100045962 3300005364 Bacteria 3389
52 Ga0070673_100047155 3300005364 Bacteria 3351
53 Ga0070673_100081947 3300005364 Bacteria 2617
54 Ga0070673_100087651 3300005364 Unclassified 2537
55 Ga0070673_100230331 3300005364 Bacteria 1607
56 Ga0070688_100054491 3300005365 Unclassified 2505
57 Ga0070688_100168915 3300005365 Bacteria 1508
58 Ga0070667_100304382 3300005367 Bacteria 1436
59 Ga0070703_10019210 3300005406 Bacteria 1981
60 Ga0070701_10004845 3300005438 Bacteria 5502
61 Ga0070705_100003046 3300005440 Bacteria 8258
62 Ga0070705_100054125 3300005440 Bacteria 2352
63 Ga0070700_100050093 3300005441 Bacteria 2595
64 Ga0070694_100053296 3300005444 Bacteria 2737
65 Ga0070678_100010047 3300005456 Bacteria 5761
66 Ga0070678_100021096 3300005456 Unclassified 4288
67 Ga0070662_100190769 3300005457 Bacteria 1621
68 Ga0070681_10109655 3300005458 Bacteria 2700
69 Ga0068867_100018513 3300005459 Bacteria 4950
70 Ga0068867_100026050 3300005459 Bacteria 4196
71 Ga0068867_100038038 3300005459 Bacteria 3502
72 Ga0068867_100054149 3300005459 Bacteria 2964
73 Ga0068867_100134655 3300005459 Bacteria 1924
74 Ga0068867_100202314 3300005459 Bacteria 1590
75 Ga0070679_100024079 3300005530 Bacteria 5964
76 Ga0070672_100036368 3300005543 Bacteria 3751
77 Ga0070672_100078259 3300005543 Unclassified 2645
78 Ga0070672_100150716 3300005543 Bacteria 1923
79 Ga0070672_100213075 3300005543 Unclassified 1618
80 Ga0070672_100365881 3300005543 Bacteria 1231
81 Ga0070686_100062911 3300005544 Bacteria 2402
82 Ga0070695_100000728 3300005545 Bacteria 17589
83 Ga0070695_100188650 3300005545 Bacteria 1466
84 Ga0070696_100006658 3300005546 Bacteria 7718
85 Ga0070693_100000072 3300005547 Bacteria 41480
86 Ga0070693_100168784 3300005547 Bacteria 1400
87 Ga0070665_100152424 3300005548 Bacteria 2314
88 Ga0070704_100003550 3300005549 Bacteria 8965
89 Ga0068855_100575129 3300005563 Bacteria 1217
90 Ga0070664_100036993 3300005564 Bacteria 4102
91 Ga0070664_100148198 3300005564 Unclassified 2070
92 Ga0070664_100344754 3300005564 Bacteria 1354
93 Ga0068857_100076768 3300005577 Bacteria 2980
94 Ga0068854_100000912 3300005578 Bacteria 17764
95 Ga0068854_100081983 3300005578 Bacteria 2384
96 Ga0068856_100138138 3300005614 Bacteria 2443
97 Ga0068856_100513807 3300005614 Bacteria 1219
98 Ga0070702_100000084 3300005615 Bacteria 27525
99 Ga0070702_100017024 3300005615 Unclassified 3742
100 Ga0068852_100045312 3300005616 Bacteria 3740
101 Ga0068859_100005387 3300005617 Bacteria 13012
102 Ga0068859_100335266 3300005617 Bacteria 1607
103 Ga0068864_100044158 3300005618 Bacteria 3818
104 Ga0068864_100078169 3300005618 Unclassified 2895
105 Ga0068864_100117463 3300005618 Unclassified 2374
106 Ga0068864_100119109 3300005618 Bacteria 2358
107 Ga0068864_100202678 3300005618 Bacteria 1823
108 Ga0068864_100418528 3300005618 Bacteria 1276
109 Ga0068866_10002137 3300005718 Bacteria 8225
110 Ga0068861_100126994 3300005719 Unclassified 2065
111 Ga0068861_100225441 3300005719 Bacteria 1586
112 Ga0068861_100231210 3300005719 Unclassified 1568
113 Ga0068870_10037083 3300005840 Bacteria 2511
114 Ga0068870_10040906 3300005840 Unclassified 2406
115 Ga0068870_10074604 3300005840 Bacteria 1859
116 Ga0068870_10077714 3300005840 Bacteria 1827
117 Ga0068870_10112926 3300005840 Bacteria 1554
118 Ga0068863_100083577 3300005841 Unclassified 3025
119 Ga0068863_100327516 3300005841 Bacteria 1489
120 Ga0068858_100024273 3300005842 Bacteria 5651
121 Ga0068860_100059431 3300005843 Unclassified 3634
122 Ga0068860_100093591 3300005843 Bacteria 2864
123 Ga0068862_100007686 3300005844 Bacteria 8918
124 Ga0068862_100009057 3300005844 Bacteria 8242
125 Ga0068862_100029960 3300005844 Unclassified 4585
126 Ga0068862_100117912 3300005844 Unclassified 2337
127 Ga0068862_100557443 3300005844 Bacteria 1095
128 Ga0081455_10045042 3300005937 Bacteria 3842
129 Ga0081540_1001688 3300005983 Bacteria 18755
130 Ga0081539_10012694 3300005985 Bacteria 6451
131 Ga0075365_10052297 3300006038 Bacteria 2701
132 Ga0075365_10060805 3300006038 Bacteria 2521
133 Ga0075368_10001378 3300006042 Bacteria 7740
134 Ga0075363_100042953 3300006048 Bacteria 2390
135 Ga0075364_10000478 3300006051 Bacteria 20305
136 Ga0075367_10014685 3300006178 Bacteria 4241
137 Ga0075367_10080112 3300006178 Bacteria 1975
138 Ga0075369_10032960 3300006186 Bacteria 2194
139 Ga0075366_10007090 3300006195 Bacteria 6170
140 Ga0075366_10026652 3300006195 Bacteria 3387
141 Ga0097621_100000794 3300006237 Bacteria 22198
142 Ga0097621_100039429 3300006237 Bacteria 3794
143 Ga0097621_100105133 3300006237 Unclassified 2380
144 Ga0068871_100050818 3300006358 Unclassified 3354
145 Ga0068871_100076190 3300006358 Bacteria 2770
146 Ga0068871_100077624 3300006358 Bacteria 2745
147 Ga0068871_100093419 3300006358 Bacteria 2510
148 Ga0068871_100106635 3300006358 Unclassified 2352
149 Ga0068871_100226195 3300006358 Bacteria 1622
150 Ga0075428_100001017 3300006844 Bacteria 29740
151 Ga0075428_100002482 3300006844 Bacteria 20020
152 Ga0075428_100006367 3300006844 Bacteria 13136
153 Ga0075428_100320893 3300006844 Bacteria 1665
154 Ga0075430_100000160 3300006846 Bacteria 44139
155 Ga0075430_100008030 3300006846 Bacteria 8920
156 Ga0075430_100019461 3300006846 Bacteria 5773
157 Ga0075430_100175632 3300006846 Bacteria 1782
158 Ga0075430_100249203 3300006846 Bacteria 1472
159 Ga0075431_100004501 3300006847 Bacteria 13679
160 Ga0075431_100007328 3300006847 Bacteria 10988
161 Ga0075431_100046926 3300006847 Bacteria 4454
162 Ga0075431_100048025 3300006847 Bacteria 4402
163 Ga0075431_100089285 3300006847 Bacteria 3181
164 Ga0075433_10095223 3300006852 Bacteria 2635
165 Ga0075433_10139714 3300006852 Bacteria 2153
166 Ga0075433_10265551 3300006852 Bacteria 1521
167 Ga0075434_100001156 3300006871 Bacteria 21811
168 Ga0075434_100116518 3300006871 Bacteria 2685
169 Ga0075429_100000365 3300006880 Bacteria 33361
170 Ga0075429_100012289 3300006880 Bacteria 7426
171 Ga0075429_100015874 3300006880 Bacteria 6521
172 Ga0075429_100020639 3300006880 Bacteria 5718
173 Ga0075429_100026175 3300006880 Bacteria 5063
174 Ga0075429_100050977 3300006880 Bacteria 3601
175 Ga0075429_100062373 3300006880 Bacteria 3248
176 Ga0068865_100243364 3300006881 Bacteria 1416
177 Ga0075436_100002171 3300006914 Bacteria 13522
178 Ga0075436_100004556 3300006914 Bacteria 9490
179 Ga0097620_100005387 3300006931 Bacteria 13012
180 Ga0097620_100335255 3300006931 Bacteria 1607
181 Ga0075435_100000351 3300007076 Bacteria 28383
182 Ga0075435_100069719 3300007076 Bacteria 2868
183 Ga0099794_10021327 3300007265 Unclassified 2942
184 Ga0099795_10003724 3300007788 Bacteria 3821
185 Ga0105250_10065403 3300009092 Bacteria 1466
186 Ga0105240_10266304 3300009093 Bacteria 1975
187 Ga0111539_10006886 3300009094 Bacteria 14601
188 Ga0111539_10093128 3300009094 Bacteria 3540
189 Ga0111539_10136024 3300009094 Bacteria 2878
190 Ga0111539_10160506 3300009094 Bacteria 2629
191 Ga0111539_10198227 3300009094 Bacteria 2342
192 Ga0111539_10240192 3300009094 Bacteria 2109
193 Ga0105245_10151477 3300009098 Bacteria 2193
194 Ga0114129_10002814 3300009147 Bacteria 24266
195 Ga0105243_10104191 3300009148 Bacteria 2361
196 Ga0105241_10066851 3300009174 Bacteria 2781
197 Ga0105242_10003543 3300009176 Bacteria 12137
198 Ga0105242_10416285 3300009176 Bacteria 1258
199 Ga0105248_10227435 3300009177 Bacteria 2100
200 Ga0105248_10321760 3300009177 Bacteria 1742
201 Ga0105249_10202640 3300009553 Bacteria 1942
202 Ga0099796_10005413 3300010159 Bacteria 3186
203 Ga0105239_10023090 3300010375 Bacteria 6855
204 Ga0105239_10710329 3300010375 Bacteria 1150
205 Ga0157373_10009982 3300013100 Bacteria 6998
206 Ga0157369_10015469 3300013105 Bacteria 8597
207 Ga0157374_10138626 3300013296 Unclassified 2360
208 Ga0157374_10197730 3300013296 Bacteria 1968
209 Ga0157378_10029668 3300013297 Bacteria 4830
210 Ga0157378_10048544 3300013297 Bacteria 3775
211 Ga0157378_10120255 3300013297 Unclassified 2420
212 Ga0157378_10310732 3300013297 Bacteria 1528
213 Ga0157378_10491183 3300013297 Bacteria 1225
214 Ga0163162_10005090 3300013306 Bacteria 12668
215 Ga0163162_10025203 3300013306 Bacteria 5877
216 Ga0163162_10056076 3300013306 Bacteria 3969
217 Ga0163162_10097344 3300013306 Bacteria 3031
218 Ga0163162_10213683 3300013306 Bacteria 2059
219 Ga0157375_10035490 3300013308 Bacteria 4760
220 Ga0157375_10062193 3300013308 Bacteria 3709
221 Ga0157375_10106664 3300013308 Unclassified 2893
222 Ga0157375_10127538 3300013308 Bacteria 2661
223 Ga0157375_10145037 3300013308 Unclassified 2504
224 Ga0157375_10153129 3300013308 Bacteria 2443
225 Ga0157375_10159606 3300013308 Bacteria 2396
226 Ga0157375_10224656 3300013308 Bacteria 2037
227 Ga0163163_10426151 3300014325 Bacteria 1386
228 Ga0157380_10166091 3300014326 Bacteria 1923
229 Ga0157377_10117180 3300014745 Bacteria 1609
230 Ga0157379_10185762 3300014968 Unclassified 1878
231 Ga0157376_10037821 3300014969 Unclassified 3922
232 Ga0157376_10050072 3300014969 Unclassified 3463
233 Ga0157376_10074418 3300014969 Bacteria 2895
234 Ga0157376_10106210 3300014969 Bacteria 2463
235 Ga0157376_10124981 3300014969 Bacteria 2286
236 Ga0163161_10039368 3300017792 Bacteria 3393
237 Ga0163161_10074213 3300017792 Bacteria 2494
238 Ga0163161_10078846 3300017792 Unclassified 2421
239 Ga0163161_10142421 3300017792 Bacteria 1816
240 Ga0213876_10008546 3300021384 Bacteria 5543
241 Ga0207697_10021444 3300025315 Bacteria 2644
242 Ga0207697_10043350 3300025315 Bacteria 1850
243 Ga0207656_10093198 3300025321 Bacteria 1370
244 Ga0207682_10005416 3300025893 Bacteria 5196
245 Ga0207642_10000462 3300025899 Bacteria 12434
246 Ga0207645_10002842 3300025907 Bacteria 13433
247 Ga0207643_10013273 3300025908 Bacteria 4459
248 Ga0207643_10026556 3300025908 Bacteria 3206
249 Ga0207643_10054939 3300025908 Bacteria 2264
250 Ga0207643_10121907 3300025908 Bacteria 1545
251 Ga0207705_10179445 3300025909 Bacteria 1597
252 Ga0207684_10420612 3300025910 Bacteria 1148
253 Ga0207654_10044963 3300025911 Bacteria 2511
254 Ga0207695_10146172 3300025913 Bacteria 2308
255 Ga0207671_10019541 3300025914 Bacteria 5179
256 Ga0207660_10002278 3300025917 Bacteria 12642
257 Ga0207662_10000133 3300025918 Bacteria 35913
258 Ga0207649_10020716 3300025920 Bacteria 3773
259 Ga0207649_10069780 3300025920 Bacteria 2239
260 Ga0207652_10090340 3300025921 Bacteria 2691
261 Ga0207681_10011863 3300025923 Bacteria 5363
262 Ga0207681_10043406 3300025923 Bacteria 3009
263 Ga0207681_10084494 3300025923 Unclassified 2250
264 Ga0207681_10175840 3300025923 Unclassified 1626
265 Ga0207650_10000964 3300025925 Bacteria 21653
266 Ga0207650_10005459 3300025925 Bacteria 8677
267 Ga0207650_10029612 3300025925 Bacteria 3937
268 Ga0207650_10031423 3300025925 Bacteria 3834
269 Ga0207650_10152047 3300025925 Unclassified 1827
270 Ga0207650_10198541 3300025925 Bacteria 1606
271 Ga0207650_10216829 3300025925 Bacteria 1539
272 Ga0207659_10011762 3300025926 Bacteria 5539
273 Ga0207659_10035756 3300025926 Unclassified 3436
274 Ga0207659_10038856 3300025926 Bacteria 3313
275 Ga0207659_10099549 3300025926 Unclassified 2189
276 Ga0207659_10205645 3300025926 Bacteria 1575
277 Ga0207659_10265097 3300025926 Bacteria 1399
278 Ga0207644_10061046 3300025931 Bacteria 2729
279 Ga0207706_10007245 3300025933 Bacteria 10255
280 Ga0207706_10319930 3300025933 Bacteria 1350
281 Ga0207686_10107323 3300025934 Bacteria 1876
282 Ga0207670_10262373 3300025936 Bacteria 1340
283 Ga0207704_10025398 3300025938 Bacteria 3231
284 Ga0207704_10099330 3300025938 Bacteria 1936
285 Ga0207691_10001414 3300025940 Bacteria 23977
286 Ga0207691_10005400 3300025940 Bacteria 12340
287 Ga0207691_10013142 3300025940 Bacteria 7926
288 Ga0207691_10016867 3300025940 Bacteria 6930
289 Ga0207691_10074921 3300025940 Bacteria 3052
290 Ga0207691_10192597 3300025940 Bacteria 1778
291 Ga0207711_10265342 3300025941 Bacteria 1579
292 Ga0207689_10089929 3300025942 Bacteria 2522
293 Ga0207661_10191479 3300025944 Bacteria 1793
294 Ga0207679_10013268 3300025945 Bacteria 5400
295 Ga0207679_10040927 3300025945 Unclassified 3320
296 Ga0207679_10051228 3300025945 Bacteria 3021
297 Ga0207679_10182270 3300025945 Bacteria 1738
298 Ga0207679_10222258 3300025945 Bacteria 1589
299 Ga0207679_10267156 3300025945 Bacteria 1461
300 Ga0207667_10299372 3300025949 Bacteria 1643
301 Ga0207651_10005875 3300025960 Bacteria 6348
302 Ga0207651_10022621 3300025960 Bacteria 3848
303 Ga0207651_10070352 3300025960 Bacteria 2475
304 Ga0207651_10162143 3300025960 Bacteria 1754
305 Ga0207712_10093687 3300025961 Bacteria 2217
306 Ga0207640_10033998 3300025981 Bacteria 3178
307 Ga0207658_10085531 3300025986 Bacteria 2429
308 Ga0207658_10183443 3300025986 Bacteria 1734
309 Ga0207658_10379070 3300025986 Bacteria 1238
310 Ga0207677_10020272 3300026023 Bacteria 4034
311 Ga0207677_10110712 3300026023 Bacteria 2044
312 Ga0207703_10027961 3300026035 Bacteria 4441
313 Ga0207703_10096392 3300026035 Bacteria 2497
314 Ga0207703_10412955 3300026035 Unclassified 1255
315 Ga0207639_10348615 3300026041 Bacteria 1322
316 Ga0207708_10000164 3300026075 Bacteria 52172
317 Ga0207708_10110687 3300026075 Bacteria 2131
318 Ga0207708_10343814 3300026075 Bacteria 1222
319 Ga0207702_10207506 3300026078 Bacteria 1820
320 Ga0207641_10110581 3300026088 Bacteria 2435
321 Ga0207641_10113231 3300026088 Bacteria 2409
322 Ga0207641_10117036 3300026088 Unclassified 2372
323 Ga0207641_10298379 3300026088 Bacteria 1521
324 Ga0207641_10385985 3300026088 Bacteria 1342
325 Ga0207648_10018921 3300026089 Bacteria 6221
326 Ga0207648_10026038 3300026089 Bacteria 5202
327 Ga0207648_10139363 3300026089 Unclassified 2137
328 Ga0207648_10140738 3300026089 Bacteria 2126
329 Ga0207648_10175411 3300026089 Bacteria 1896
330 Ga0207648_10183371 3300026089 Bacteria 1853
331 Ga0207648_10191266 3300026089 Unclassified 1814
332 Ga0207648_10338434 3300026089 Bacteria 1355
333 Ga0207676_10013045 3300026095 Bacteria 5967
334 Ga0207676_10045078 3300026095 Bacteria 3405
335 Ga0207676_10121111 3300026095 Bacteria 2207
336 Ga0207676_10141773 3300026095 Bacteria 2058
337 Ga0207676_10269116 3300026095 Bacteria 1542
338 Ga0207675_100001661 3300026118 Bacteria 22258
339 Ga0207675_100012451 3300026118 Bacteria 7948
340 Ga0207675_100593937 3300026118 Unclassified 1109
341 Ga0207683_10000842 3300026121 Bacteria 28118
342 Ga0207683_10009202 3300026121 Bacteria 8417
343 Ga0207683_10019715 3300026121 Bacteria 5762
344 Ga0207683_10070350 3300026121 Bacteria 3091
345 Ga0207683_10088409 3300026121 Unclassified 2757
346 Ga0207683_10123304 3300026121 Bacteria 2328
347 Ga0207683_10254691 3300026121 Bacteria 1602
348 Ga0209983_1008398 3300027665 Bacteria 2113
349 Ga0207428_10002315 3300027907 Bacteria 19077
350 Ga0268266_10306972 3300028379 Bacteria 1482
351 Ga0268265_10132344 3300028380 Unclassified 2075
352 Ga0268264_10043084 3300028381 Bacteria 3739
353 Ga0268264_10255348 3300028381 Bacteria 1630
354 Ga0268264_10420933 3300028381 Bacteria 1288
355 Ga0307515_10000028 3300028794 Bacteria 368467
356 Ga0265330_10052497 3300031235 Bacteria 1786
357 Ga0265332_10027227 3300031238 Bacteria 2504
358 Ga0265328_10003094 3300031239 Bacteria 7428
359 Ga0265320_10018587 3300031240 Bacteria 3823
360 Ga0265329_10015543 3300031242 Bacteria 2657
361 Ga0265331_10007315 3300031250 Bacteria 6397
362 Ga0265331_10073038 3300031250 Bacteria 1602
363 Ga0265327_10136086 3300031251 Bacteria 1152
364 Ga0265316_10020113 3300031344 Bacteria 5690
365 Ga0307513_10255258 3300031456 Bacteria 1547
366 Ga0265314_10004625 3300031711 Bacteria 12676
367 Ga0265342_10008833 3300031712 Bacteria 7184
368 Ga0307413_10119097 3300031824 Bacteria 1784
369 Ga0307406_10063268 3300031901 Bacteria 2396
370 Ga0307406_10401165 3300031901 Bacteria 1087
371 Ga0307416_100056882 3300032002 Bacteria 3160
372 Ga0307416_100082234 3300032002 Bacteria 2727
373 Ga0307416_100341604 3300032002 Bacteria 1510
374 Ga0307414_10010466 3300032004 Bacteria 5384
375 Ga0307414_10111924 3300032004 Bacteria 2080
376 Ga0307411_10022589 3300032005 Bacteria 3707
377 Ga0307507_10057290 3300033179 Bacteria 3671
378 Ga0307507_10072150 3300033179 Bacteria 3114
379 Ga0373938_0002899 3300034957 Bacteria 2770
380 Ga0373944_0001668 3300035089 Bacteria 5612
381 Ga0373949_0009227 3300035090 Bacteria 2161
382 Ga0373952_0003897 3300035092 Bacteria 2700
383 Ga0373932_0002181 3300035112 Bacteria 5054
384 Ga0373939_0003147 3300035114 Bacteria 3881
385 Ga0373941_0023281 3300035115 Bacteria 1766
386 Ga0373945_0004697 3300035116 Bacteria 4349
387 Ga0373960_0092235 3300035121 Bacteria 970
388 Ga0373943_0068938 3300035170 Bacteria 1786
389 Ga0373946_0004763 3300035171 Bacteria 4880
390 Ga0373942_0013227 3300035207 Bacteria 1981
391 Ga0373962_0021669 3300035242 Bacteria 1697
392 Ga0373931_0000219 3300035691 Bacteria 24390
393 Ga0373931_0007275 3300035691 Bacteria 5209
394 Ga0373931_0065085 3300035691 Bacteria 1975
395 Ga0373935_0010195 3300035692 Bacteria 5629
396 Ga0373935_0062228 3300035692 Bacteria 2390
397 Ga0373927_0037748 3300035695 Bacteria 3138
398 Ga0373927_0040650 3300035695 Bacteria 3016
399 Ga0373927_0128369 3300035695 Bacteria 1656
400 Ga0373947_0024353 3300035725 Bacteria 3526
401 Ga0373947_0123187 3300035725 Bacteria 1648
402 Ga0373925_0038809 3300037068 Bacteria 3522
403 Ga0373925_0092179 3300037068 Bacteria 2317
404 Ga0395898_0024791 3300037466 Bacteria 6047
405 Ga0436365_0005825 3300039437 Bacteria 14430
406 Ga0436365_1239789 3300039437 Bacteria 4746
407 Ga0451807_0129364 3300041486 Bacteria 1694
408 Ga0451853_1244909 3300041512 Bacteria 2607
409 Ga0439435_0025032 3300042436 Bacteria 1579
410 Ga0451577_0240145 3300042876 Bacteria 1639
411 Ga0451577_0597146 3300042876 Unclassified 1002
412 Ga0451576_0000360 3300045051 Bacteria 109145
413 Ga0451576_0018486 3300045051 Bacteria 7640
414 Ga0451576_0094604 3300045051 Bacteria 3107
415 Ga0451576_0207239 3300045051 Bacteria 2047
416 Ga0451576_0424522 3300045051 Bacteria 1395
417 Ga0495603_0004135 3300046455 Bacteria 8643
418 Ga0495629_0202138 3300046459 Unclassified 1374
419 Ga0495639_0008792 3300046475 Bacteria 4331
420 Ga0495648_0073983 3300046524 Bacteria 1965
421 Ga0495586_0141706 3300046535 Bacteria 1349
422 Ga0495622_0063818 3300046557 Bacteria 1704
423 Ga0495656_0026296 3300046615 Bacteria 2316
424 Ga0495656_0069367 3300046615 Bacteria 1561
425 Ga0495647_0000621 3300046681 Bacteria 10454
426 Ga0495581_0081354 3300047315 Bacteria 1875
427 Ga0495672_0045451 3300047320 Bacteria 2627
428 Ga0495676_0027558 3300047321 Bacteria 4868
429 Ga0496101_0064967 3300048904 Bacteria 2660
430 Ga0496101_0079227 3300048904 Bacteria 2425
431 Ga0496104_0311552 3300048907 Bacteria 1487
432 Ga0496106_0281396 3300048909 Bacteria 1333
433 Ga0496108_0128795 3300048911 Bacteria 2175
434 Ga0496108_0267556 3300048911 Bacteria 1488
435 Ga0496108_0352791 3300048911 Bacteria 1284
436 Ga0496109_0190543 3300048912 Bacteria 1927
437 Ga0496110_0038823 3300048913 Bacteria 4144
438 Ga0496110_0118524 3300048913 Bacteria 2384
439 Ga0496110_0177813 3300048913 Bacteria 1932
440 Ga0496112_0002790 3300048915 Bacteria 14183
441 Ga0496113_0034333 3300048916 Bacteria 3701
442 Ga0496114_0241554 3300048917 Unclassified 1588
443 Ga0496114_0365797 3300048917 Bacteria 1276
444 Ga0496115_0049347 3300048918 Bacteria 3369
445 Ga0496122_0112670 3300048925 Bacteria 1780
446 Ga0496123_0096083 3300048926 Bacteria 1741
447 Ga0496124_0011939 3300048927 Bacteria 8643
448 Ga0496126_0131537 3300048929 Bacteria 2162
449 nmdc:mga03683_3980_c1 3300050489 Bacteria 3775
450 nmdc:mga03683_41752_c1 3300050489 Bacteria 1885
451 nmdc:mga03n38_31288_c1 3300050490 Bacteria 2244
452 nmdc:mga00v17_1674_c1 3300050491 Bacteria 11533
453 nmdc:mga00v17_23049_c1 3300050491 Bacteria 3599
454 nmdc:mga00v17_48966_c1 3300050491 Bacteria 2562
455 nmdc:mga0yw44_109480_c1 3300050492 Bacteria 1769
456 nmdc:mga0yw44_203906_c1 3300050492 Bacteria 1307
457 nmdc:mga0k408_4514_c1 3300050493 Bacteria 7389
458 nmdc:mga06z11_154105_c1 3300050494 Bacteria 1309
459 nmdc:mga06z11_43659_c1 3300050494 Bacteria 2257
460 nmdc:mga05p37_846_c1 3300050507 Bacteria 34377
461 nmdc:mga09592_12829_c1 3300050508 Bacteria 6832
462 nmdc:mga09592_146887_c1 3300050508 Bacteria 2033
463 nmdc:mga09592_46566_c1 3300050508 Bacteria 3653
464 nmdc:mga09592_47965_c1 3300050508 Bacteria 3600
465 nmdc:mga09592_561_c1 3300050508 Bacteria 28236
466 nmdc:mga09592_78080_c1 3300050508 Bacteria 2817
467 nmdc:mga0qj67_15803_c1 3300050509 Bacteria 5717
468 nmdc:mga0qj67_64_c1 3300050509 Bacteria 77795
469 nmdc:mga0qj67_75748_c1 3300050509 Bacteria 2690
470 nmdc:mga0qj67_96934_c1 3300050509 Bacteria 2374
471 nmdc:mga06r32_144056_c1 3300050510 Bacteria 2360
472 nmdc:mga06r32_51213_c1 3300050510 Bacteria 3951
473 nmdc:mga06r32_557216_c1 3300050510 Bacteria 1120
474 nmdc:mga08y16_104655_c1 3300050511 Bacteria 2946
475 nmdc:mga08y16_108901_c1 3300050511 Bacteria 2884
476 nmdc:mga08y16_15302_c1 3300050511 Bacteria 8071
477 nmdc:mga08y16_159679_c1 3300050511 Bacteria 2342
478 nmdc:mga08y16_172002_c1 3300050511 Bacteria 2250
479 nmdc:mga08y16_34567_c1 3300050511 Bacteria 5310
480 nmdc:mga08y16_51234_c1 3300050511 Bacteria 4319
481 nmdc:mga08y16_59130_c1 3300050511 Bacteria 4004
482 nmdc:mga0n895_1039_c1 3300050512 Bacteria 20185
483 nmdc:mga0n895_431834_c1 3300050512 Bacteria 1331
484 nmdc:mga0n895_720781_c1 3300050512 Bacteria 992
485 nmdc:mga0rr50_597_c1 3300050513 Bacteria 19339
486 nmdc:mga08x19_2849_c1 3300050514 Bacteria 10424
487 nmdc:mga08x19_440_c1 3300050514 Bacteria 28562
488 nmdc:mga0a205_160244_c1 3300050515 Bacteria 2147
489 nmdc:mga0a205_432_c1 3300050515 Bacteria 32225
490 nmdc:mga0sz30_15319_c1 3300050516 Bacteria 2795
491 Ga0500641_0002674 3300053096 Bacteria 6295
492 Ga0500557_000021 3300053105 Bacteria 89662
493 Ga0500652_000029 3300053131 Bacteria 91212
494 Ga0500568_0021375 3300053139 Bacteria 2785
495 Ga0500636_0094112 3300053177 Bacteria 1712
496 Ga0500625_046945 3300053729 Bacteria 2011
497 Ga0500645_022866 3300053730 Bacteria 1919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_10412955 Ga0207703_104129552 241
2 3300006844 Ga0075428_100320893 Ga0075428_1003208932 253
3 3300048915 Ga0496112_0002790 Ga0496112_0002790_4679_5620 253
4 3300048916 Ga0496113_0034333 Ga0496113_0034333_2251_3192 253
5 3300005328 Ga0070676_10252918 Ga0070676_102529181 256
6 3300005335 Ga0070666_10215350 Ga0070666_102153503 256
7 3300005355 Ga0070671_100119623 Ga0070671_1001196233 256
8 3300005364 Ga0070673_100045962 Ga0070673_1000459622 256
9 3300005459 Ga0068867_100134655 Ga0068867_1001346553 256
10 3300005618 Ga0068864_100119109 Ga0068864_1001191092 256
11 3300006358 Ga0068871_100226195 Ga0068871_1002261953 256
12 3300025907 Ga0207645_10002842 Ga0207645_100028426 256
13 3300026089 Ga0207648_10175411 Ga0207648_101754111 256
14 3300026095 Ga0207676_10269116 Ga0207676_102691163 256
15 3300028381 Ga0268264_10043084 Ga0268264_100430842 256
16 3300033179 Ga0307507_10057290 Ga0307507_100572902 257
17 3300048904 Ga0496101_0064967 Ga0496101_0064967_238_1155 257
18 3300025940 Ga0207691_10192597 Ga0207691_101925972 259
19 3300025908 Ga0207643_10026556 Ga0207643_100265561 262
20 3300005339 Ga0070660_100282725 Ga0070660_1002827252 265
21 3300010375 Ga0105239_10023090 Ga0105239_100230905 265
22 3300013100 Ga0157373_10009982 Ga0157373_100099822 265
23 3300013105 Ga0157369_10015469 Ga0157369_100154697 265
24 3300025914 Ga0207671_10019541 Ga0207671_100195415 265
25 3300048925 Ga0496122_0112670 Ga0496122_0112670_119_1114 265
26 3300048926 Ga0496123_0096083 Ga0496123_0096083_282_1277 265
27 3300048927 Ga0496124_0011939 Ga0496124_0011939_4011_5006 265
28 3300006847 Ga0075431_100007328 Ga0075431_1000073283 266
29 3300026089 Ga0207648_10183371 Ga0207648_101833712 266
30 3300028794 Ga0307515_10000028 Ga0307515_10000028241 266
31 3300006844 Ga0075428_100006367 Ga0075428_1000063675 269
32 3300006846 Ga0075430_100175632 Ga0075430_1001756322 269
33 3300006880 Ga0075429_100026175 Ga0075429_1000261752 269
34 3300009094 Ga0111539_10136024 Ga0111539_101360243 269
35 3300046615 Ga0495656_0026296 Ga0495656_0026296_725_1720 269
36 3300050508 nmdc:mga09592_47965_c1 nmdc:mga09592_47965_c1_2370_3371 269
37 3300050511 nmdc:mga08y16_15302_c1 nmdc:mga08y16_15302_c1_5564_6565 269
38 3300013308 Ga0157375_10062193 Ga0157375_100621931 272
39 3300042876 Ga0451577_0597146 Ga0451577_0597146_26_892 274
40 iso_pu_bacteria 2881927736 2881927754 274
41 3300005331 Ga0070670_100060075 Ga0070670_1000600751 275
42 3300005338 Ga0068868_100248789 Ga0068868_1002487892 275
43 3300005353 Ga0070669_100259359 Ga0070669_1002593592 275
44 3300005354 Ga0070675_100090122 Ga0070675_1000901222 275
45 3300005354 Ga0070675_100121508 Ga0070675_1001215082 275
46 3300005364 Ga0070673_100047155 Ga0070673_1000471552 275
47 3300005365 Ga0070688_100168915 Ga0070688_1001689152 275
48 3300005457 Ga0070662_100190769 Ga0070662_1001907691 275
49 3300005840 Ga0068870_10037083 Ga0068870_100370832 275
50 3300005844 Ga0068862_100007686 Ga0068862_1000076862 275
51 3300013308 Ga0157375_10127538 Ga0157375_101275382 275
52 3300014325 Ga0163163_10426151 Ga0163163_104261512 275
53 3300014745 Ga0157377_10117180 Ga0157377_101171802 275
54 3300017792 Ga0163161_10142421 Ga0163161_101424212 275
55 3300025315 Ga0207697_10043350 Ga0207697_100433502 275
56 3300025893 Ga0207682_10005416 Ga0207682_100054161 275
57 3300025908 Ga0207643_10013273 Ga0207643_100132733 275
58 3300025923 Ga0207681_10011863 Ga0207681_100118632 275
59 3300025925 Ga0207650_10031423 Ga0207650_100314232 275
60 3300025926 Ga0207659_10011762 Ga0207659_100117625 275
61 3300025926 Ga0207659_10038856 Ga0207659_100388563 275
62 3300025933 Ga0207706_10007245 Ga0207706_100072458 275
63 3300025942 Ga0207689_10089929 Ga0207689_100899292 275
64 3300025945 Ga0207679_10222258 Ga0207679_102222582 275
65 3300025960 Ga0207651_10005875 Ga0207651_100058754 275
66 3300025960 Ga0207651_10070352 Ga0207651_100703522 275
67 3300025986 Ga0207658_10379070 Ga0207658_103790702 275
68 3300026118 Ga0207675_100012451 Ga0207675_1000124517 275
69 3300026121 Ga0207683_10009202 Ga0207683_100092028 275
70 3300028379 Ga0268266_10306972 Ga0268266_103069722 275
71 3300031235 Ga0265330_10052497 Ga0265330_100524972 275
72 3300031238 Ga0265332_10027227 Ga0265332_100272272 275
73 3300031239 Ga0265328_10003094 Ga0265328_100030946 275
74 3300031240 Ga0265320_10018587 Ga0265320_100185874 275
75 3300031242 Ga0265329_10015543 Ga0265329_100155433 275
76 3300031250 Ga0265331_10007315 Ga0265331_100073153 275
77 3300031344 Ga0265316_10020113 Ga0265316_100201135 275
78 3300031711 Ga0265314_10004625 Ga0265314_100046258 275
79 3300031712 Ga0265342_10008833 Ga0265342_100088335 275
80 3300005334 Ga0068869_100001168 Ga0068869_10000116814 276
81 3300005336 Ga0070680_100177248 Ga0070680_1001772482 276
82 3300005341 Ga0070691_10054525 Ga0070691_100545252 276
83 3300005343 Ga0070687_100000380 Ga0070687_10000038014 276
84 3300005345 Ga0070692_10065826 Ga0070692_100658262 276
85 3300005354 Ga0070675_100188136 Ga0070675_1001881361 276
86 3300005406 Ga0070703_10019210 Ga0070703_100192102 276
87 3300005438 Ga0070701_10004845 Ga0070701_100048452 276
88 3300005440 Ga0070705_100003046 Ga0070705_1000030469 276
89 3300005441 Ga0070700_100050093 Ga0070700_1000500932 276
90 3300005444 Ga0070694_100053296 Ga0070694_1000532963 276
91 3300005459 Ga0068867_100202314 Ga0068867_1002023142 276
92 3300005530 Ga0070679_100024079 Ga0070679_1000240792 276
93 3300005544 Ga0070686_100062911 Ga0070686_1000629112 276
94 3300005545 Ga0070695_100000728 Ga0070695_1000007285 276
95 3300005546 Ga0070696_100006658 Ga0070696_1000066582 276
96 3300005547 Ga0070693_100000072 Ga0070693_10000007225 276
97 3300005549 Ga0070704_100003550 Ga0070704_1000035502 276
98 3300005563 Ga0068855_100575129 Ga0068855_1005751292 276
99 3300005578 Ga0068854_100000912 Ga0068854_10000091218 276
100 3300005614 Ga0068856_100138138 Ga0068856_1001381382 276
101 3300005615 Ga0070702_100000084 Ga0070702_10000008419 276
102 3300005617 Ga0068859_100005387 Ga0068859_1000053872 276
103 3300005718 Ga0068866_10002137 Ga0068866_100021379 276
104 3300005719 Ga0068861_100225441 Ga0068861_1002254412 276
105 3300005840 Ga0068870_10112926 Ga0068870_101129262 276
106 3300005843 Ga0068860_100093591 Ga0068860_1000935913 276
107 3300005844 Ga0068862_100009057 Ga0068862_1000090579 276
108 3300006237 Ga0097621_100000794 Ga0097621_10000079412 276
109 3300006847 Ga0075431_100089285 Ga0075431_1000892852 276
110 3300006880 Ga0075429_100062373 Ga0075429_1000623731 276
111 3300006881 Ga0068865_100243364 Ga0068865_1002433642 276
112 3300006931 Ga0097620_100005387 Ga0097620_1000053872 276
113 3300009092 Ga0105250_10065403 Ga0105250_100654032 276
114 3300009094 Ga0111539_10198227 Ga0111539_101982272 276
115 3300009094 Ga0111539_10240192 Ga0111539_102401922 276
116 3300009098 Ga0105245_10151477 Ga0105245_101514773 276
117 3300009148 Ga0105243_10104191 Ga0105243_101041912 276
118 3300009174 Ga0105241_10066851 Ga0105241_100668512 276
119 3300009176 Ga0105242_10003543 Ga0105242_100035434 276
120 3300009177 Ga0105248_10321760 Ga0105248_103217602 276
121 3300010375 Ga0105239_10710329 Ga0105239_107103291 276
122 3300013297 Ga0157378_10491183 Ga0157378_104911832 276
123 3300014969 Ga0157376_10124981 Ga0157376_101249813 276
124 3300025899 Ga0207642_10000462 Ga0207642_1000046215 276
125 3300025911 Ga0207654_10044963 Ga0207654_100449632 276
126 3300025917 Ga0207660_10002278 Ga0207660_1000227815 276
127 3300025918 Ga0207662_10000133 Ga0207662_1000013337 276
128 3300025921 Ga0207652_10090340 Ga0207652_100903402 276
129 3300025934 Ga0207686_10107323 Ga0207686_101073232 276
130 3300025938 Ga0207704_10025398 Ga0207704_100253982 276
131 3300025941 Ga0207711_10265342 Ga0207711_102653422 276
132 3300025949 Ga0207667_10299372 Ga0207667_102993722 276
133 3300025961 Ga0207712_10093687 Ga0207712_100936872 276
134 3300026035 Ga0207703_10096392 Ga0207703_100963923 276
135 3300026075 Ga0207708_10000164 Ga0207708_1000016436 276
136 3300026078 Ga0207702_10207506 Ga0207702_102075062 276
137 3300026089 Ga0207648_10140738 Ga0207648_101407382 276
138 3300026118 Ga0207675_100001661 Ga0207675_1000016612 276
139 3300027665 Ga0209983_1008398 Ga0209983_10083982 276
140 3300032004 Ga0307414_10111924 Ga0307414_101119242 276
141 3300035691 Ga0373931_0007275 Ga0373931_0007275_549_1421 276
142 3300035692 Ga0373935_0062228 Ga0373935_0062228_183_1136 276
143 3300035695 Ga0373927_0128369 Ga0373927_0128369_533_1486 276
144 3300042436 Ga0439435_0025032 Ga0439435_0025032_446_1450 276
145 3300045051 Ga0451576_0207239 Ga0451576_0207239_456_1433 276
146 3300048909 Ga0496106_0281396 Ga0496106_0281396_252_1256 276
147 3300048917 Ga0496114_0241554 Ga0496114_0241554_279_1259 276
148 3300050492 nmdc:mga0yw44_203906_c1 nmdc:mga0yw44_203906_c1_79_1068 276
149 3300050509 nmdc:mga0qj67_15803_c1 nmdc:mga0qj67_15803_c1_260_1189 276
150 3300050510 nmdc:mga06r32_144056_c1 nmdc:mga06r32_144056_c1_264_1193 276
151 3300050511 nmdc:mga08y16_159679_c1 nmdc:mga08y16_159679_c1_566_1531 276
152 3300050511 nmdc:mga08y16_59130_c1 nmdc:mga08y16_59130_c1_11_994 276
153 3300053139 Ga0500568_0021375 Ga0500568_0021375_1335_2336 276
154 3300005331 Ga0070670_100038815 Ga0070670_1000388153 277
155 3300005331 Ga0070670_100068153 Ga0070670_1000681532 277
156 3300005338 Ga0068868_100024718 Ga0068868_1000247183 277
157 3300005344 Ga0070661_100058552 Ga0070661_1000585522 277
158 3300005354 Ga0070675_100046473 Ga0070675_1000464734 277
159 3300005356 Ga0070674_100034526 Ga0070674_1000345263 277
160 3300005456 Ga0070678_100010047 Ga0070678_1000100473 277
161 3300005459 Ga0068867_100038038 Ga0068867_1000380382 277
162 3300006051 Ga0075364_10000478 Ga0075364_1000047817 277
163 3300006195 Ga0075366_10026652 Ga0075366_100266524 277
164 3300025933 Ga0207706_10319930 Ga0207706_103199302 277
165 3300025945 Ga0207679_10267156 Ga0207679_102671562 277
166 3300032002 Ga0307416_100056882 Ga0307416_1000568822 277
167 3300035089 Ga0373944_0001668 Ga0373944_0001668_4234_5220 277
168 3300035116 Ga0373945_0004697 Ga0373945_0004697_1829_2815 277
169 3300035121 Ga0373960_0092235 Ga0373960_0092235_41_913 277
170 3300035170 Ga0373943_0068938 Ga0373943_0068938_651_1637 277
171 3300035171 Ga0373946_0004763 Ga0373946_0004763_675_1661 277
172 3300035691 Ga0373931_0065085 Ga0373931_0065085_94_1056 277
173 3300035692 Ga0373935_0010195 Ga0373935_0010195_650_1636 277
174 3300035695 Ga0373927_0040650 Ga0373927_0040650_559_1545 277
175 3300035725 Ga0373947_0123187 Ga0373947_0123187_140_1126 277
176 3300037068 Ga0373925_0092179 Ga0373925_0092179_268_1254 277
177 3300046455 Ga0495603_0004135 Ga0495603_0004135_2154_3140 277
178 3300046475 Ga0495639_0008792 Ga0495639_0008792_2150_3136 277
179 3300046535 Ga0495586_0141706 Ga0495586_0141706_267_1253 277
180 3300046557 Ga0495622_0063818 Ga0495622_0063818_795_1667 277
181 3300046681 Ga0495647_0000621 Ga0495647_0000621_3474_4460 277
182 3300047315 Ga0495581_0081354 Ga0495581_0081354_68_1054 277
183 3300047321 Ga0495676_0027558 Ga0495676_0027558_285_1271 277
184 3300050491 nmdc:mga00v17_1674_c1 nmdc:mga00v17_1674_c1_466_1449 277
185 3300050491 nmdc:mga00v17_48966_c1 nmdc:mga00v17_48966_c1_333_1307 277
186 3300050493 nmdc:mga0k408_4514_c1 nmdc:mga0k408_4514_c1_4580_5533 277
187 3300050509 nmdc:mga0qj67_96934_c1 nmdc:mga0qj67_96934_c1_311_1180 277
188 iso_pu_bacteria 2643221621 2644123935 277
189 iso_pu_bacteria 2857537821 2857539369 277
190 3300005331 Ga0070670_100012056 Ga0070670_1000120562 278
191 3300005331 Ga0070670_100020779 Ga0070670_1000207792 278
192 3300005331 Ga0070670_100397305 Ga0070670_1003973051 278
193 3300005333 Ga0070677_10141536 Ga0070677_101415361 278
194 3300005335 Ga0070666_10049302 Ga0070666_100493022 278
195 3300005338 Ga0068868_100104203 Ga0068868_1001042032 278
196 3300005338 Ga0068868_100204046 Ga0068868_1002040461 278
197 3300005340 Ga0070689_100236790 Ga0070689_1002367902 278
198 3300005354 Ga0070675_100017456 Ga0070675_1000174562 278
199 3300005354 Ga0070675_100018560 Ga0070675_1000185602 278
200 3300005355 Ga0070671_100488368 Ga0070671_1004883681 278
201 3300005364 Ga0070673_100017670 Ga0070673_1000176703 278
202 3300005364 Ga0070673_100081947 Ga0070673_1000819472 278
203 3300005364 Ga0070673_100230331 Ga0070673_1002303312 278
204 3300005440 Ga0070705_100054125 Ga0070705_1000541252 278
205 3300005458 Ga0070681_10109655 Ga0070681_101096553 278
206 3300005459 Ga0068867_100018513 Ga0068867_1000185133 278
207 3300005543 Ga0070672_100213075 Ga0070672_1002130752 278
208 3300005547 Ga0070693_100168784 Ga0070693_1001687841 278
209 3300005564 Ga0070664_100148198 Ga0070664_1001481982 278
210 3300005564 Ga0070664_100344754 Ga0070664_1003447541 278
211 3300005577 Ga0068857_100076768 Ga0068857_1000767682 278
212 3300005616 Ga0068852_100045312 Ga0068852_1000453124 278
213 3300005617 Ga0068859_100335266 Ga0068859_1003352662 278
214 3300005618 Ga0068864_100117463 Ga0068864_1001174632 278
215 3300005618 Ga0068864_100202678 Ga0068864_1002026782 278
216 3300005840 Ga0068870_10040906 Ga0068870_100409062 278
217 3300005840 Ga0068870_10074604 Ga0068870_100746041 278
218 3300005841 Ga0068863_100083577 Ga0068863_1000835772 278
219 3300005844 Ga0068862_100557443 Ga0068862_1005574431 278
220 3300005937 Ga0081455_10045042 Ga0081455_100450424 278
221 3300005983 Ga0081540_1001688 Ga0081540_100168815 278
222 3300006038 Ga0075365_10060805 Ga0075365_100608051 278
223 3300006042 Ga0075368_10001378 Ga0075368_100013783 278
224 3300006186 Ga0075369_10032960 Ga0075369_100329603 278
225 3300006195 Ga0075366_10007090 Ga0075366_100070905 278
226 3300006237 Ga0097621_100039429 Ga0097621_1000394291 278
227 3300006237 Ga0097621_100105133 Ga0097621_1001051332 278
228 3300006358 Ga0068871_100076190 Ga0068871_1000761902 278
229 3300006358 Ga0068871_100077624 Ga0068871_1000776243 278
230 3300006358 Ga0068871_100106635 Ga0068871_1001066352 278
231 3300006846 Ga0075430_100249203 Ga0075430_1002492031 278
232 3300006847 Ga0075431_100046926 Ga0075431_1000469262 278
233 3300006931 Ga0097620_100335255 Ga0097620_1003352552 278
234 3300009093 Ga0105240_10266304 Ga0105240_102663042 278
235 3300009094 Ga0111539_10093128 Ga0111539_100931283 278
236 3300009176 Ga0105242_10416285 Ga0105242_104162852 278
237 3300009177 Ga0105248_10227435 Ga0105248_102274353 278
238 3300013297 Ga0157378_10029668 Ga0157378_100296684 278
239 3300013306 Ga0163162_10056076 Ga0163162_100560764 278
240 3300013306 Ga0163162_10213683 Ga0163162_102136832 278
241 3300013308 Ga0157375_10035490 Ga0157375_100354904 278
242 3300013308 Ga0157375_10106664 Ga0157375_101066642 278
243 3300013308 Ga0157375_10159606 Ga0157375_101596062 278
244 3300014969 Ga0157376_10037821 Ga0157376_100378212 278
245 3300014969 Ga0157376_10074418 Ga0157376_100744182 278
246 3300017792 Ga0163161_10039368 Ga0163161_100393683 278
247 3300017792 Ga0163161_10074213 Ga0163161_100742131 278
248 3300017792 Ga0163161_10078846 Ga0163161_100788462 278
249 3300025908 Ga0207643_10121907 Ga0207643_101219071 278
250 3300025910 Ga0207684_10420612 Ga0207684_104206121 278
251 3300025913 Ga0207695_10146172 Ga0207695_101461722 278
252 3300025923 Ga0207681_10043406 Ga0207681_100434061 278
253 3300025923 Ga0207681_10084494 Ga0207681_100844942 278
254 3300025925 Ga0207650_10000964 Ga0207650_1000096421 278
255 3300025925 Ga0207650_10005459 Ga0207650_100054593 278
256 3300025925 Ga0207650_10152047 Ga0207650_101520472 278
257 3300025925 Ga0207650_10216829 Ga0207650_102168292 278
258 3300025926 Ga0207659_10035756 Ga0207659_100357562 278
259 3300025926 Ga0207659_10205645 Ga0207659_102056452 278
260 3300025926 Ga0207659_10265097 Ga0207659_102650972 278
261 3300025931 Ga0207644_10061046 Ga0207644_100610463 278
262 3300025936 Ga0207670_10262373 Ga0207670_102623731 278
263 3300025938 Ga0207704_10099330 Ga0207704_100993302 278
264 3300025940 Ga0207691_10013142 Ga0207691_100131425 278
265 3300025945 Ga0207679_10051228 Ga0207679_100512283 278
266 3300025945 Ga0207679_10182270 Ga0207679_101822702 278
267 3300025960 Ga0207651_10022621 Ga0207651_100226214 278
268 3300025960 Ga0207651_10162143 Ga0207651_101621432 278
269 3300025986 Ga0207658_10085531 Ga0207658_100855312 278
270 3300026041 Ga0207639_10348615 Ga0207639_103486151 278
271 3300026075 Ga0207708_10110687 Ga0207708_101106871 278
272 3300026075 Ga0207708_10343814 Ga0207708_103438142 278
273 3300026088 Ga0207641_10110581 Ga0207641_101105812 278
274 3300026088 Ga0207641_10117036 Ga0207641_101170362 278
275 3300026089 Ga0207648_10026038 Ga0207648_100260384 278
276 3300026089 Ga0207648_10191266 Ga0207648_101912662 278
277 3300026095 Ga0207676_10045078 Ga0207676_100450782 278
278 3300026121 Ga0207683_10019715 Ga0207683_100197155 278
279 3300026121 Ga0207683_10123304 Ga0207683_101233042 278
280 3300026121 Ga0207683_10254691 Ga0207683_102546912 278
281 3300028381 Ga0268264_10255348 Ga0268264_102553482 278
282 3300028381 Ga0268264_10420933 Ga0268264_104209332 278
283 3300031251 Ga0265327_10136086 Ga0265327_101360862 278
284 3300033179 Ga0307507_10072150 Ga0307507_100721503 278
285 3300039437 Ga0436365_1239789 Ga0436365_1239789_1107_2072 278
286 3300041486 Ga0451807_0129364 Ga0451807_0129364_669_1670 278
287 3300042876 Ga0451577_0240145 Ga0451577_0240145_647_1624 278
288 3300046459 Ga0495629_0202138 Ga0495629_0202138_43_1017 278
289 3300046524 Ga0495648_0073983 Ga0495648_0073983_329_1345 278
290 3300047320 Ga0495672_0045451 Ga0495672_0045451_1012_1980 278
291 3300048911 Ga0496108_0267556 Ga0496108_0267556_388_1389 278
292 3300048911 Ga0496108_0352791 Ga0496108_0352791_100_1017 278
293 3300048913 Ga0496110_0177813 Ga0496110_0177813_449_1465 278
294 3300050489 nmdc:mga03683_3980_c1 nmdc:mga03683_3980_c1_2883_3755 278
295 3300050489 nmdc:mga03683_41752_c1 nmdc:mga03683_41752_c1_403_1356 278
296 3300050490 nmdc:mga03n38_31288_c1 nmdc:mga03n38_31288_c1_205_1158 278
297 3300050491 nmdc:mga00v17_23049_c1 nmdc:mga00v17_23049_c1_620_1591 278
298 3300050494 nmdc:mga06z11_154105_c1 nmdc:mga06z11_154105_c1_160_1131 278
299 3300050510 nmdc:mga06r32_557216_c1 nmdc:mga06r32_557216_c1_38_922 278
300 3300050511 nmdc:mga08y16_172002_c1 nmdc:mga08y16_172002_c1_883_1863 278
301 3300050512 nmdc:mga0n895_431834_c1 nmdc:mga0n895_431834_c1_15_941 278
302 3300053105 Ga0500557_000021 Ga0500557_000021_79503_80426 278
303 3300053729 Ga0500625_046945 Ga0500625_046945_819_1787 278
304 iso_pu_bacteria 2855730933 2855731597 278
305 iso_pu_bacteria 2855767633 2855768303 278
306 iso_pu_bacteria 2857542790 2857544453 278
307 iso_pu_bacteria 2885192300 2885194250 278
308 3300005295 Ga0065707_10083489 Ga0065707_100834895 279
309 3300005327 Ga0070658_10209878 Ga0070658_102098782 279
310 3300005327 Ga0070658_10302621 Ga0070658_103026211 279
311 3300005330 Ga0070690_100239060 Ga0070690_1002390602 279
312 3300005331 Ga0070670_100022518 Ga0070670_1000225183 279
313 3300005331 Ga0070670_100270913 Ga0070670_1002709132 279
314 3300005335 Ga0070666_10203238 Ga0070666_102032382 279
315 3300005338 Ga0068868_100116708 Ga0068868_1001167082 279
316 3300005338 Ga0068868_100300351 Ga0068868_1003003511 279
317 3300005340 Ga0070689_100135584 Ga0070689_1001355842 279
318 3300005343 Ga0070687_100024373 Ga0070687_1000243732 279
319 3300005354 Ga0070675_100172401 Ga0070675_1001724012 279
320 3300005354 Ga0070675_100206259 Ga0070675_1002062592 279
321 3300005355 Ga0070671_100020414 Ga0070671_1000204144 279
322 3300005355 Ga0070671_100038271 Ga0070671_1000382714 279
323 3300005356 Ga0070674_100008629 Ga0070674_1000086292 279
324 3300005364 Ga0070673_100025628 Ga0070673_1000256284 279
325 3300005364 Ga0070673_100087651 Ga0070673_1000876512 279
326 3300005365 Ga0070688_100054491 Ga0070688_1000544912 279
327 3300005367 Ga0070667_100304382 Ga0070667_1003043821 279
328 3300005456 Ga0070678_100021096 Ga0070678_1000210962 279
329 3300005459 Ga0068867_100026050 Ga0068867_1000260502 279
330 3300005459 Ga0068867_100054149 Ga0068867_1000541491 279
331 3300005543 Ga0070672_100036368 Ga0070672_1000363682 279
332 3300005543 Ga0070672_100078259 Ga0070672_1000782593 279
333 3300005543 Ga0070672_100150716 Ga0070672_1001507162 279
334 3300005543 Ga0070672_100365881 Ga0070672_1003658812 279
335 3300005545 Ga0070695_100188650 Ga0070695_1001886502 279
336 3300005548 Ga0070665_100152424 Ga0070665_1001524242 279
337 3300005564 Ga0070664_100036993 Ga0070664_1000369933 279
338 3300005578 Ga0068854_100081983 Ga0068854_1000819832 279
339 3300005614 Ga0068856_100513807 Ga0068856_1005138072 279
340 3300005615 Ga0070702_100017024 Ga0070702_1000170242 279
341 3300005618 Ga0068864_100044158 Ga0068864_1000441583 279
342 3300005618 Ga0068864_100078169 Ga0068864_1000781692 279
343 3300005618 Ga0068864_100418528 Ga0068864_1004185281 279
344 3300005719 Ga0068861_100126994 Ga0068861_1001269942 279
345 3300005719 Ga0068861_100231210 Ga0068861_1002312102 279
346 3300005840 Ga0068870_10077714 Ga0068870_100777141 279
347 3300005841 Ga0068863_100327516 Ga0068863_1003275162 279
348 3300005842 Ga0068858_100024273 Ga0068858_1000242734 279
349 3300005843 Ga0068860_100059431 Ga0068860_1000594312 279
350 3300005844 Ga0068862_100029960 Ga0068862_1000299602 279
351 3300005844 Ga0068862_100117912 Ga0068862_1001179122 279
352 3300005985 Ga0081539_10012694 Ga0081539_100126944 279
353 3300006038 Ga0075365_10052297 Ga0075365_100522974 279
354 3300006048 Ga0075363_100042953 Ga0075363_1000429532 279
355 3300006178 Ga0075367_10014685 Ga0075367_100146855 279
356 3300006178 Ga0075367_10080112 Ga0075367_100801122 279
357 3300006358 Ga0068871_100050818 Ga0068871_1000508182 279
358 3300006358 Ga0068871_100093419 Ga0068871_1000934192 279
359 3300006844 Ga0075428_100001017 Ga0075428_10000101731 279
360 3300006844 Ga0075428_100002482 Ga0075428_1000024824 279
361 3300006846 Ga0075430_100000160 Ga0075430_1000001604 279
362 3300006846 Ga0075430_100008030 Ga0075430_10000803011 279
363 3300006846 Ga0075430_100019461 Ga0075430_1000194615 279
364 3300006847 Ga0075431_100004501 Ga0075431_10000450115 279
365 3300006847 Ga0075431_100048025 Ga0075431_1000480256 279
366 3300006852 Ga0075433_10095223 Ga0075433_100952232 279
367 3300006852 Ga0075433_10139714 Ga0075433_101397141 279
368 3300006852 Ga0075433_10265551 Ga0075433_102655512 279
369 3300006871 Ga0075434_100001156 Ga0075434_10000115610 279
370 3300006871 Ga0075434_100116518 Ga0075434_1001165181 279
371 3300006880 Ga0075429_100000365 Ga0075429_10000036517 279
372 3300006880 Ga0075429_100012289 Ga0075429_1000122899 279
373 3300006880 Ga0075429_100015874 Ga0075429_1000158748 279
374 3300006880 Ga0075429_100020639 Ga0075429_1000206394 279
375 3300006880 Ga0075429_100050977 Ga0075429_1000509772 279
376 3300006914 Ga0075436_100002171 Ga0075436_1000021718 279
377 3300006914 Ga0075436_100004556 Ga0075436_1000045567 279
378 3300007076 Ga0075435_100000351 Ga0075435_10000035124 279
379 3300007076 Ga0075435_100069719 Ga0075435_1000697193 279
380 3300007265 Ga0099794_10021327 Ga0099794_100213274 279
381 3300007788 Ga0099795_10003724 Ga0099795_100037243 279
382 3300009094 Ga0111539_10006886 Ga0111539_1000688616 279
383 3300009094 Ga0111539_10160506 Ga0111539_101605061 279
384 3300009147 Ga0114129_10002814 Ga0114129_1000281419 279
385 3300009553 Ga0105249_10202640 Ga0105249_102026402 279
386 3300010159 Ga0099796_10005413 Ga0099796_100054132 279
387 3300013296 Ga0157374_10138626 Ga0157374_101386262 279
388 3300013296 Ga0157374_10197730 Ga0157374_101977302 279
389 3300013297 Ga0157378_10048544 Ga0157378_100485443 279
390 3300013297 Ga0157378_10120255 Ga0157378_101202552 279
391 3300013297 Ga0157378_10310732 Ga0157378_103107321 279
392 3300013306 Ga0163162_10005090 Ga0163162_1000509014 279
393 3300013306 Ga0163162_10025203 Ga0163162_100252032 279
394 3300013306 Ga0163162_10097344 Ga0163162_100973441 279
395 3300013308 Ga0157375_10145037 Ga0157375_101450372 279
396 3300013308 Ga0157375_10153129 Ga0157375_101531292 279
397 3300013308 Ga0157375_10224656 Ga0157375_102246562 279
398 3300014326 Ga0157380_10166091 Ga0157380_101660912 279
399 3300014968 Ga0157379_10185762 Ga0157379_101857622 279
400 3300014969 Ga0157376_10050072 Ga0157376_100500722 279
401 3300014969 Ga0157376_10106210 Ga0157376_101062102 279
402 3300021384 Ga0213876_10008546 Ga0213876_100085463 279
403 3300025315 Ga0207697_10021444 Ga0207697_100214442 279
404 3300025321 Ga0207656_10093198 Ga0207656_100931982 279
405 3300025908 Ga0207643_10054939 Ga0207643_100549392 279
406 3300025909 Ga0207705_10179445 Ga0207705_101794452 279
407 3300025920 Ga0207649_10020716 Ga0207649_100207162 279
408 3300025920 Ga0207649_10069780 Ga0207649_100697802 279
409 3300025923 Ga0207681_10175840 Ga0207681_101758402 279
410 3300025925 Ga0207650_10029612 Ga0207650_100296123 279
411 3300025925 Ga0207650_10198541 Ga0207650_101985411 279
412 3300025926 Ga0207659_10099549 Ga0207659_100995492 279
413 3300025940 Ga0207691_10001414 Ga0207691_1000141412 279
414 3300025940 Ga0207691_10005400 Ga0207691_100054003 279
415 3300025940 Ga0207691_10016867 Ga0207691_100168677 279
416 3300025940 Ga0207691_10074921 Ga0207691_100749212 279
417 3300025944 Ga0207661_10191479 Ga0207661_101914792 279
418 3300025945 Ga0207679_10013268 Ga0207679_100132684 279
419 3300025945 Ga0207679_10040927 Ga0207679_100409273 279
420 3300025981 Ga0207640_10033998 Ga0207640_100339983 279
421 3300025986 Ga0207658_10183443 Ga0207658_101834432 279
422 3300026023 Ga0207677_10020272 Ga0207677_100202723 279
423 3300026023 Ga0207677_10110712 Ga0207677_101107122 279
424 3300026035 Ga0207703_10027961 Ga0207703_100279613 279
425 3300026088 Ga0207641_10113231 Ga0207641_101132312 279
426 3300026088 Ga0207641_10298379 Ga0207641_102983792 279
427 3300026088 Ga0207641_10385985 Ga0207641_103859851 279
428 3300026089 Ga0207648_10018921 Ga0207648_100189213 279
429 3300026089 Ga0207648_10139363 Ga0207648_101393632 279
430 3300026089 Ga0207648_10338434 Ga0207648_103384342 279
431 3300026095 Ga0207676_10013045 Ga0207676_100130452 279
432 3300026095 Ga0207676_10121111 Ga0207676_101211111 279
433 3300026095 Ga0207676_10141773 Ga0207676_101417732 279
434 3300026118 Ga0207675_100593937 Ga0207675_1005939371 279
435 3300026121 Ga0207683_10000842 Ga0207683_1000084213 279
436 3300026121 Ga0207683_10070350 Ga0207683_100703503 279
437 3300026121 Ga0207683_10088409 Ga0207683_100884092 279
438 3300027907 Ga0207428_10002315 Ga0207428_100023154 279
439 3300028380 Ga0268265_10132344 Ga0268265_101323442 279
440 3300031250 Ga0265331_10073038 Ga0265331_100730382 279
441 3300031456 Ga0307513_10255258 Ga0307513_102552582 279
442 3300031824 Ga0307413_10119097 Ga0307413_101190972 279
443 3300031901 Ga0307406_10063268 Ga0307406_100632682 279
444 3300031901 Ga0307406_10401165 Ga0307406_104011651 279
445 3300032002 Ga0307416_100082234 Ga0307416_1000822342 279
446 3300032002 Ga0307416_100341604 Ga0307416_1003416042 279
447 3300032004 Ga0307414_10010466 Ga0307414_100104663 279
448 3300032005 Ga0307411_10022589 Ga0307411_100225892 279
449 3300034957 Ga0373938_0002899 Ga0373938_0002899_529_1401 279
450 3300035090 Ga0373949_0009227 Ga0373949_0009227_1167_2039 279
451 3300035092 Ga0373952_0003897 Ga0373952_0003897_1714_2586 279
452 3300035112 Ga0373932_0002181 Ga0373932_0002181_970_1842 279
453 3300035114 Ga0373939_0003147 Ga0373939_0003147_2842_3714 279
454 3300035115 Ga0373941_0023281 Ga0373941_0023281_276_1148 279
455 3300035207 Ga0373942_0013227 Ga0373942_0013227_184_1056 279
456 3300035242 Ga0373962_0021669 Ga0373962_0021669_418_1290 279
457 3300035691 Ga0373931_0000219 Ga0373931_0000219_16754_17626 279
458 3300035695 Ga0373927_0037748 Ga0373927_0037748_1691_2677 279
459 3300035725 Ga0373947_0024353 Ga0373947_0024353_676_1662 279
460 3300037068 Ga0373925_0038809 Ga0373925_0038809_1865_2851 279
461 3300037466 Ga0395898_0024791 Ga0395898_0024791_5028_5999 279
462 3300039437 Ga0436365_0005825 Ga0436365_0005825_337_1317 279
463 3300041512 Ga0451853_1244909 Ga0451853_1244909_260_1231 279
464 3300045051 Ga0451576_0000360 Ga0451576_0000360_67007_67981 279
465 3300045051 Ga0451576_0018486 Ga0451576_0018486_5934_6896 279
466 3300045051 Ga0451576_0094604 Ga0451576_0094604_745_1617 279
467 3300045051 Ga0451576_0424522 Ga0451576_0424522_221_1195 279
468 3300046615 Ga0495656_0069367 Ga0495656_0069367_116_1078 279
469 3300048904 Ga0496101_0079227 Ga0496101_0079227_419_1390 279
470 3300048907 Ga0496104_0311552 Ga0496104_0311552_166_1137 279
471 3300048911 Ga0496108_0128795 Ga0496108_0128795_189_1154 279
472 3300048912 Ga0496109_0190543 Ga0496109_0190543_304_1293 279
473 3300048913 Ga0496110_0038823 Ga0496110_0038823_768_1739 279
474 3300048913 Ga0496110_0118524 Ga0496110_0118524_51_1016 279
475 3300048917 Ga0496114_0365797 Ga0496114_0365797_143_1114 279
476 3300048918 Ga0496115_0049347 Ga0496115_0049347_787_1839 279
477 3300048929 Ga0496126_0131537 Ga0496126_0131537_780_1832 279
478 3300050492 nmdc:mga0yw44_109480_c1 nmdc:mga0yw44_109480_c1_693_1664 279
479 3300050494 nmdc:mga06z11_43659_c1 nmdc:mga06z11_43659_c1_84_1055 279
480 3300050507 nmdc:mga05p37_846_c1 nmdc:mga05p37_846_c1_18086_18958 279
481 3300050508 nmdc:mga09592_12829_c1 nmdc:mga09592_12829_c1_4914_5864 279
482 3300050508 nmdc:mga09592_146887_c1 nmdc:mga09592_146887_c1_549_1499 279
483 3300050508 nmdc:mga09592_46566_c1 nmdc:mga09592_46566_c1_1101_2075 279
484 3300050508 nmdc:mga09592_561_c1 nmdc:mga09592_561_c1_23762_24634 279
485 3300050508 nmdc:mga09592_78080_c1 nmdc:mga09592_78080_c1_1638_2645 279
486 3300050509 nmdc:mga0qj67_64_c1 nmdc:mga0qj67_64_c1_16932_17909 279
487 3300050509 nmdc:mga0qj67_75748_c1 nmdc:mga0qj67_75748_c1_1173_2147 279
488 3300050510 nmdc:mga06r32_51213_c1 nmdc:mga06r32_51213_c1_916_1923 279
489 3300050511 nmdc:mga08y16_104655_c1 nmdc:mga08y16_104655_c1_13_975 279
490 3300050511 nmdc:mga08y16_108901_c1 nmdc:mga08y16_108901_c1_241_1215 279
491 3300050511 nmdc:mga08y16_34567_c1 nmdc:mga08y16_34567_c1_211_1185 279
492 3300050511 nmdc:mga08y16_51234_c1 nmdc:mga08y16_51234_c1_484_1434 279
493 3300050512 nmdc:mga0n895_1039_c1 nmdc:mga0n895_1039_c1_6113_7075 279
494 3300050512 nmdc:mga0n895_720781_c1 nmdc:mga0n895_720781_c1_104_976 279
495 3300050513 nmdc:mga0rr50_597_c1 nmdc:mga0rr50_597_c1_8905_9867 279
496 3300050514 nmdc:mga08x19_2849_c1 nmdc:mga08x19_2849_c1_2956_3936 279
497 3300050514 nmdc:mga08x19_440_c1 nmdc:mga08x19_440_c1_5364_6326 279
498 3300050515 nmdc:mga0a205_160244_c1 nmdc:mga0a205_160244_c1_340_1284 279
499 3300050515 nmdc:mga0a205_432_c1 nmdc:mga0a205_432_c1_23113_24075 279
500 3300050516 nmdc:mga0sz30_15319_c1 nmdc:mga0sz30_15319_c1_1247_2218 279
501 3300053096 Ga0500641_0002674 Ga0500641_0002674_1419_2390 279
502 3300053131 Ga0500652_000029 Ga0500652_000029_63768_64742 279
503 3300053177 Ga0500636_0094112 Ga0500636_0094112_375_1349 279
504 3300053730 Ga0500645_022866 Ga0500645_022866_993_1898 279
505 iso_pu_bacteria 2643221621 2644123519 279
506 iso_pu_bacteria 2929199973 2929205129 279
507 iso_pu_bacteria 8055909800 8055915183 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

91

365

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9662 2 279
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9646 2 277
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9634 2 279
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9595 2 279
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9566 2 279
ID Description Score Start End Superfamily
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9506 93 191 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9467 92 188 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9179 92 204 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9124 2 279 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9035 2 279 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A537AE94-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9855 2 179
AF-A0A845BC47-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9822 2 279
AF-A0A317HXN3-F1-model_v4 deleted 0.9815 2 279
AF-A0A096FIP4-F1-model_v4 MFS transporter 0.981 2 279
AF-A0A2M8U4Y9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9808 2 191

Feature Viewer

pLDDT pTM Quality
92.71 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map