F456689

General Info

Members Datasets Scaffolds Average Seq Length
507 221 1014 130

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10623900|Ga0207693_106239002
Length 152
Sequence LTPPPVAVLSDYLDGQLFEISAVIEFHLDSKSGVPAYLQLVQQVRQAIRLGILGPGDQLPTVKEVVTRLTINPNTVLHAYRQLDLEGLIDGRRGVGTFVSSNPAPXXXDDLKGLRSGIERWVGRARAAGLDDEAIGALVAEAVRPSAVSRVA

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.85
Rhizosphere 88.36
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10623900 3300025915 Bacteria 838
2 Ga0058862_12486825 3300004803 Bacteria 768
3 Ga0070683_100003974 3300005329 Bacteria 12108
4 Ga0070683_100006582 3300005329 Bacteria 9757
5 Ga0070683_100052930 3300005329 Bacteria 3761
6 Ga0070683_101246119 3300005329 Bacteria 715
7 Ga0070680_100003241 3300005336 Bacteria 12109
8 Ga0070680_100040496 3300005336 Bacteria 3773
9 Ga0070680_101172964 3300005336 Archaea 664
10 Ga0070682_100070788 3300005337 Bacteria 2231
11 Ga0070682_100192429 3300005337 Bacteria 1433
12 Ga0070682_100445032 3300005337 Bacteria 991
13 Ga0068868_101410067 3300005338 Unclassified 650
14 Ga0070660_100006340 3300005339 Bacteria 8194
15 Ga0070660_100038234 3300005339 Bacteria 3642
16 Ga0070660_100067589 3300005339 Bacteria 2785
17 Ga0070660_100454264 3300005339 Bacteria 1063
18 Ga0070660_101446685 3300005339 Bacteria 584
19 Ga0070691_10190433 3300005341 Bacteria 1073
20 Ga0070691_10382201 3300005341 Bacteria 789
21 Ga0070661_100010913 3300005344 Bacteria 6328
22 Ga0070661_100013428 3300005344 Bacteria 5748
23 Ga0070671_100327543 3300005355 Bacteria 1305
24 Ga0070671_101172294 3300005355 Unclassified 676
25 Ga0070674_100182612 3300005356 Bacteria 1608
26 Ga0070659_100003606 3300005366 Bacteria 11016
27 Ga0070659_100004609 3300005366 Bacteria 9852
28 Ga0070659_100138000 3300005366 Bacteria 1984
29 Ga0070659_101355474 3300005366 Bacteria 632
30 Ga0070709_10114488 3300005434 Bacteria 1818
31 Ga0070709_11143313 3300005434 Bacteria 624
32 Ga0070714_100180976 3300005435 Bacteria 1918
33 Ga0070713_100047652 3300005436 Bacteria 3524
34 Ga0070710_10245328 3300005437 Bacteria 1149
35 Ga0070711_100065598 3300005439 Bacteria 2540
36 Ga0070663_100674463 3300005455 Bacteria 876
37 Ga0070678_100351099 3300005456 Bacteria 1268
38 Ga0070678_101025661 3300005456 Bacteria 759
39 Ga0070681_10001709 3300005458 Bacteria 19668
40 Ga0070681_10004158 3300005458 Bacteria 13697
41 Ga0070681_10081071 3300005458 Bacteria 3201
42 Ga0070681_10091989 3300005458 Bacteria 2983
43 Ga0070681_10257946 3300005458 Bacteria 1655
44 Ga0070699_100033396 3300005518 Bacteria 4445
45 Ga0070679_100001828 3300005530 Bacteria 19174
46 Ga0070679_100009015 3300005530 Bacteria 9411
47 Ga0070679_100275271 3300005530 Bacteria 1636
48 Ga0070679_101204209 3300005530 Archaea 703
49 Ga0070679_101262861 3300005530 Bacteria 684
50 Ga0070684_100010350 3300005535 Bacteria 7384
51 Ga0070684_100046127 3300005535 Bacteria 3775
52 Ga0070684_100298477 3300005535 Bacteria 1478
53 Ga0070684_101538943 3300005535 Bacteria 627
54 Ga0068853_100058235 3300005539 Bacteria 3335
55 Ga0068853_100074045 3300005539 Bacteria 2971
56 Ga0068853_100270698 3300005539 Bacteria 1564
57 Ga0068853_102215652 3300005539 Bacteria 533
58 Ga0070695_101489801 3300005545 Bacteria 563
59 Ga0070693_100437762 3300005547 Bacteria 915
60 Ga0070665_100455572 3300005548 Bacteria 1289
61 Ga0070665_101093793 3300005548 Bacteria 809
62 Ga0070704_100814966 3300005549 Bacteria 835
63 Ga0068855_100057980 3300005563 Bacteria 4537
64 Ga0068855_100069906 3300005563 Bacteria 4085
65 Ga0068855_100335712 3300005563 Bacteria 1667
66 Ga0068855_100869473 3300005563 Bacteria 954
67 Ga0070664_101281936 3300005564 Bacteria 692
68 Ga0068857_100035495 3300005577 Bacteria 4415
69 Ga0068854_100036892 3300005578 Bacteria 3428
70 Ga0068854_100063047 3300005578 Bacteria 2690
71 Ga0068856_100017018 3300005614 Bacteria 7046
72 Ga0068856_100155474 3300005614 Bacteria 2297
73 Ga0068856_100299303 3300005614 Bacteria 1626
74 Ga0068856_100648937 3300005614 Bacteria 1076
75 Ga0068856_101010260 3300005614 Unclassified 850
76 Ga0068856_102103771 3300005614 Bacteria 574
77 Ga0068856_102591068 3300005614 Archaea 513
78 Ga0068852_100011511 3300005616 Bacteria 6663
79 Ga0068852_100084042 3300005616 Bacteria 2832
80 Ga0068852_100416898 3300005616 Bacteria 1324
81 Ga0068864_100901513 3300005618 Bacteria 873
82 Ga0068851_10482426 3300005834 Bacteria 741
83 Ga0081455_10016725 3300005937 Bacteria 7064
84 Ga0070717_10381634 3300006028 Bacteria 1264
85 Ga0070715_10842779 3300006163 Bacteria 560
86 Ga0070716_100441756 3300006173 Bacteria 946
87 Ga0070716_101364368 3300006173 Bacteria 575
88 Ga0070712_100204138 3300006175 Bacteria 1554
89 Ga0070712_100307498 3300006175 Bacteria 1285
90 Ga0070712_100618476 3300006175 Bacteria 918
91 Ga0070712_101059347 3300006175 Bacteria 703
92 Ga0097621_100223036 3300006237 Bacteria 1643
93 Ga0097621_101881808 3300006237 Bacteria 571
94 Ga0068871_101292580 3300006358 Bacteria 686
95 Ga0068871_101714520 3300006358 Bacteria 596
96 Ga0075428_100121290 3300006844 Bacteria 2847
97 Ga0075430_100241709 3300006846 Bacteria 1496
98 Ga0075431_100011961 3300006847 Bacteria 8754
99 Ga0075431_100278117 3300006847 Bacteria 1695
100 Ga0075433_11141794 3300006852 Bacteria 677
101 Ga0075434_100015545 3300006871 Bacteria 7303
102 Ga0075429_100260878 3300006880 Bacteria 1517
103 Ga0075429_101555312 3300006880 Bacteria 575
104 Ga0075436_100045419 3300006914 Bacteria 3030
105 Ga0075435_100225406 3300007076 Bacteria 1592
106 Ga0105240_10007145 3300009093 Bacteria 16265
107 Ga0105240_10088440 3300009093 Bacteria 3790
108 Ga0105240_10119188 3300009093 Bacteria 3179
109 Ga0105247_10007278 3300009101 Bacteria 6800
110 Ga0114129_11994928 3300009147 Bacteria 702
111 Ga0105243_10074755 3300009148 Bacteria 2749
112 Ga0105241_10037542 3300009174 Bacteria 3650
113 Ga0105241_11862227 3300009174 Bacteria 589
114 Ga0105242_10045015 3300009176 Bacteria 3575
115 Ga0105242_12058377 3300009176 Bacteria 614
116 Ga0105248_10097057 3300009177 Bacteria 3320
117 Ga0105248_10475058 3300009177 Bacteria 1409
118 Ga0105237_10011141 3300009545 Bacteria 9532
119 Ga0105237_10018270 3300009545 Bacteria 7256
120 Ga0105237_10134758 3300009545 Bacteria 2464
121 Ga0105238_10040356 3300009551 Bacteria 4730
122 Ga0105238_10079481 3300009551 Bacteria 3269
123 Ga0105238_11173496 3300009551 Bacteria 792
124 Ga0105238_11577485 3300009551 Archaea 686
125 Ga0105249_12165489 3300009553 Bacteria 629
126 Ga0099796_10316413 3300010159 Bacteria 665
127 Ga0105239_10023938 3300010375 Bacteria 6725
128 Ga0105239_10137599 3300010375 Bacteria 2719
129 Ga0105239_11217117 3300010375 Bacteria 868
130 Ga0157370_10014163 3300013104 Bacteria 8176
131 Ga0157370_10021701 3300013104 Bacteria 6397
132 Ga0157370_10714658 3300013104 Bacteria 914
133 Ga0157370_11344516 3300013104 Archaea 643
134 Ga0157369_10007608 3300013105 Bacteria 12463
135 Ga0157369_10044330 3300013105 Bacteria 4842
136 Ga0157369_10109645 3300013105 Bacteria 2935
137 Ga0157369_11054424 3300013105 Unclassified 832
138 Ga0157374_10079794 3300013296 Bacteria 3102
139 Ga0157374_10536319 3300013296 Bacteria 1177
140 Ga0157374_11167980 3300013296 Bacteria 791
141 Ga0157378_12932402 3300013297 Bacteria 529
142 Ga0163162_12491947 3300013306 Bacteria 595
143 Ga0157372_10012318 3300013307 Bacteria 9113
144 Ga0157372_10014018 3300013307 Bacteria 8564
145 Ga0157372_10089493 3300013307 Bacteria 3497
146 Ga0157372_10285769 3300013307 Bacteria 1918
147 Ga0157372_11725241 3300013307 Bacteria 720
148 Ga0157375_10206483 3300013308 Bacteria 2121
149 Ga0157380_11680252 3300014326 Bacteria 692
150 Ga0182008_10565316 3300014497 Bacteria 634
151 Ga0157379_12057659 3300014968 Bacteria 565
152 Ga0157376_10199657 3300014969 Bacteria 1839
153 Ga0157376_10476448 3300014969 Bacteria 1222
154 Ga0206355_1332842 3300020076 Bacteria 549
155 Ga0206354_10697055 3300020081 Bacteria 1171
156 Ga0206353_11297134 3300020082 Bacteria 3471
157 Ga0154015_1038678 3300020610 Bacteria 545
158 Ga0213873_10035485 3300021358 Bacteria 1262
159 Ga0224712_10139174 3300022467 Bacteria 1067
160 Ga0207692_10160399 3300025898 Bacteria 1295
161 Ga0207692_10194490 3300025898 Bacteria 1189
162 Ga0207710_10071277 3300025900 Bacteria 1594
163 Ga0207705_10273681 3300025909 Bacteria 1291
164 Ga0207654_10016346 3300025911 Bacteria 3863
165 Ga0207707_10002693 3300025912 Bacteria 15869
166 Ga0207707_10004757 3300025912 Bacteria 11905
167 Ga0207707_10077418 3300025912 Bacteria 2903
168 Ga0207707_10094062 3300025912 Bacteria 2618
169 Ga0207695_10287831 3300025913 Bacteria 1536
170 Ga0207695_10462783 3300025913 Bacteria 1151
171 Ga0207671_10022712 3300025914 Bacteria 4739
172 Ga0207671_10416418 3300025914 Bacteria 1069
173 Ga0207693_10079056 3300025915 Bacteria 2574
174 Ga0207693_10263608 3300025915 Bacteria 1351
175 Ga0207693_10281302 3300025915 Bacteria 1304
176 Ga0207693_10439079 3300025915 Bacteria 1020
177 Ga0207663_10157032 3300025916 Bacteria 1601
178 Ga0207663_11559964 3300025916 Unclassified 532
179 Ga0207660_10004036 3300025917 Bacteria 9579
180 Ga0207660_10996639 3300025917 Bacteria 683
181 Ga0207660_11153755 3300025917 Archaea 631
182 Ga0207657_10015597 3300025919 Bacteria 7351
183 Ga0207657_10037469 3300025919 Bacteria 4329
184 Ga0207657_10090436 3300025919 Bacteria 2554
185 Ga0207657_10109981 3300025919 Bacteria 2277
186 Ga0207657_10473492 3300025919 Bacteria 982
187 Ga0207649_10011315 3300025920 Bacteria 4917
188 Ga0207649_10363718 3300025920 Bacteria 1074
189 Ga0207652_10010839 3300025921 Bacteria 7346
190 Ga0207652_10014168 3300025921 Bacteria 6456
191 Ga0207652_10049656 3300025921 Bacteria 3592
192 Ga0207652_10246669 3300025921 Bacteria 1610
193 Ga0207652_10308787 3300025921 Bacteria 1427
194 Ga0207694_10113556 3300025924 Bacteria 2157
195 Ga0207694_10121207 3300025924 Bacteria 2088
196 Ga0207694_10161562 3300025924 Bacteria 1809
197 Ga0207694_11210732 3300025924 Bacteria 639
198 Ga0207694_11817561 3300025924 Archaea 512
199 Ga0207664_10069694 3300025929 Bacteria 2828
200 Ga0207644_10142625 3300025931 Bacteria 1846
201 Ga0207644_10982004 3300025931 Unclassified 709
202 Ga0207690_10016274 3300025932 Bacteria 4520
203 Ga0207690_10017161 3300025932 Bacteria 4417
204 Ga0207690_10891781 3300025932 Bacteria 737
205 Ga0207686_10176478 3300025934 Bacteria 1511
206 Ga0207686_11340909 3300025934 Bacteria 588
207 Ga0207709_11742462 3300025935 Unclassified 518
208 Ga0207669_10300864 3300025937 Unclassified 1219
209 Ga0207665_10577529 3300025939 Bacteria 876
210 Ga0207665_11518608 3300025939 Unclassified 532
211 Ga0207711_10089341 3300025941 Bacteria 2707
212 Ga0207661_10002300 3300025944 Bacteria 13163
213 Ga0207661_10231247 3300025944 Bacteria 1637
214 Ga0207661_10242013 3300025944 Bacteria 1601
215 Ga0207661_11252979 3300025944 Bacteria 682
216 Ga0207679_12204240 3300025945 Bacteria 500
217 Ga0207667_10130878 3300025949 Bacteria 2584
218 Ga0207667_10177185 3300025949 Bacteria 2190
219 Ga0207667_10968551 3300025949 Unclassified 839
220 Ga0207639_10028266 3300026041 Bacteria 4092
221 Ga0207639_10232152 3300026041 Bacteria 1600
222 Ga0207639_10717396 3300026041 Bacteria 928
223 Ga0207639_12239523 3300026041 Bacteria 508
224 Ga0207678_10225158 3300026067 Bacteria 1605
225 Ga0207702_10300449 3300026078 Bacteria 1523
226 Ga0207702_10560750 3300026078 Bacteria 1118
227 Ga0207702_10906287 3300026078 Bacteria 874
228 Ga0207676_10537787 3300026095 Bacteria 1115
229 Ga0207674_10117011 3300026116 Bacteria 2636
230 Ga0207683_10273088 3300026121 Bacteria 1544
231 Ga0207683_10296946 3300026121 Bacteria 1478
232 Ga0207683_10927581 3300026121 Bacteria 808
233 Ga0207698_10005858 3300026142 Bacteria 7636
234 Ga0207698_10467862 3300026142 Bacteria 1220
235 Ga0207698_10583333 3300026142 Bacteria 1100
236 Ga0268266_10220691 3300028379 Bacteria 1743
237 Ga0268266_10285065 3300028379 Bacteria 1537
238 Ga0268266_10489347 3300028379 Bacteria 1173
239 Ga0268264_10523192 3300028381 Bacteria 1160
240 Ga0268264_11780854 3300028381 Bacteria 626
241 Ga0265338_10056977 3300028800 Bacteria 3460
242 Ga0265338_10232602 3300028800 Bacteria 1370
243 Ga0265324_10005374 3300029957 Bacteria 5548
244 Ga0307406_10602202 3300031901 Bacteria 906
245 Ga0373933_0347205 3300035724 Bacteria 964
246 Ga0373937_0396981 3300036401 Bacteria 1308
247 Ga0373937_0406811 3300036401 Bacteria 1291
248 Ga0373937_0444223 3300036401 Bacteria 1231
249 Ga0373937_0922971 3300036401 Bacteria 822
250 Ga0373937_1985737 3300036401 Unclassified 528
251 Ga0395900_0295427 3300037418 Bacteria 1608
252 Ga0395900_1286003 3300037418 Bacteria 646
253 Ga0395898_0522426 3300037466 Bacteria 1128
254 Ga0395905_0441199 3300037471 Bacteria 1199
255 Ga0395905_0609106 3300037471 Bacteria 994
256 Ga0395901_0494970 3300038443 Bacteria 1245
257 Ga0395901_1102649 3300038443 Bacteria 764
258 Ga0395901_1449192 3300038443 Bacteria 644
259 Ga0242420_004478 3300038996 Bacteria 2116
260 Ga0436365_1903811 3300039437 Bacteria 922
261 Ga0436360_1165091 3300039438 Bacteria 29560
262 Ga0436363_0246979 3300039450 Bacteria 1419
263 Ga0451800_0145723 3300041459 Bacteria 737
264 Ga0451853_0025252 3300041512 Bacteria 810
265 Ga0451853_3773895 3300041512 Bacteria 958
266 Ga0466972_0562605 3300044658 Bacteria 538
267 Ga0466966_0232237 3300044684 Bacteria 1113
268 Ga0466963_0004490 3300044694 Bacteria 8121
269 Ga0466963_0014614 3300044694 Bacteria 4846
270 Ga0466963_0021777 3300044694 Bacteria 4049
271 Ga0466963_0269064 3300044694 Bacteria 1197
272 Ga0466963_0660877 3300044694 Bacteria 738
273 Ga0466963_0722599 3300044694 Bacteria 703
274 Ga0466964_0001153 3300044706 Bacteria 8928
275 Ga0466964_0023955 3300044706 Bacteria 2376
276 Ga0466964_0024517 3300044706 Bacteria 2351
277 Ga0466964_0258893 3300044706 Bacteria 861
278 Ga0466964_0345279 3300044706 Bacteria 763
279 Ga0466964_0431153 3300044706 Bacteria 695
280 Ga0466971_0587798 3300044719 Bacteria 554
281 Ga0466968_0028234 3300044735 Bacteria 2313
282 Ga0466968_0029197 3300044735 Bacteria 2279
283 Ga0466968_0050331 3300044735 Bacteria 1777
284 Ga0466968_0345199 3300044735 Bacteria 722
285 Ga0466970_0210234 3300044765 Bacteria 1084
286 Ga0466970_0782547 3300044765 Bacteria 558
287 Ga0466970_0800767 3300044765 Bacteria 552
288 Ga0466970_0960504 3300044765 Bacteria 504
289 Ga0466957_0600781 3300044842 Bacteria 770
290 Ga0466960_0145284 3300044901 Bacteria 1263
291 Ga0466958_0097684 3300045836 Bacteria 1823
292 Ga0466967_0000773 3300045976 Bacteria 16608
293 Ga0466967_0002136 3300045976 Bacteria 12121
294 Ga0466967_0019174 3300045976 Bacteria 5493
295 Ga0466967_0019339 3300045976 Bacteria 5473
296 Ga0466967_0080113 3300045976 Bacteria 2946
297 Ga0466967_0088973 3300045976 Bacteria 2803
298 Ga0466967_0103041 3300045976 Bacteria 2611
299 Ga0466967_0104446 3300045976 Bacteria 2594
300 Ga0466967_0114160 3300045976 Bacteria 2486
301 Ga0466967_0163965 3300045976 Bacteria 2088
302 Ga0466967_0185868 3300045976 Bacteria 1962
303 Ga0466967_0216274 3300045976 Bacteria 1819
304 Ga0466967_0323683 3300045976 Bacteria 1487
305 Ga0466967_0630027 3300045976 Bacteria 1060
306 Ga0466967_0659051 3300045976 Bacteria 1035
307 Ga0466967_0744410 3300045976 Bacteria 972
308 Ga0466967_0816579 3300045976 Bacteria 926
309 Ga0466967_0851039 3300045976 Bacteria 906
310 Ga0466967_1190087 3300045976 Bacteria 759
311 Ga0466967_1801198 3300045976 Bacteria 609
312 Ga0495629_0102481 3300046459 Bacteria 1997
313 Ga0495651_0243270 3300046462 Bacteria 1233
314 Ga0495651_0583555 3300046462 Bacteria 707
315 Ga0495651_0846668 3300046462 Bacteria 562
316 Ga0495653_0006377 3300046463 Bacteria 9673
317 Ga0495653_0099369 3300046463 Bacteria 2111
318 Ga0495653_0168063 3300046463 Bacteria 1517
319 Ga0495653_0354529 3300046463 Bacteria 943
320 Ga0495582_0168116 3300046473 Bacteria 1248
321 Ga0495639_0021584 3300046475 Bacteria 2820
322 Ga0495664_0094019 3300046477 Bacteria 1804
323 Ga0495664_0194898 3300046477 Bacteria 1228
324 Ga0495608_0015289 3300046511 Bacteria 5325
325 Ga0495608_0019588 3300046511 Bacteria 4656
326 Ga0495608_0290086 3300046511 Bacteria 1014
327 Ga0495618_0144570 3300046514 Bacteria 1521
328 Ga0495628_0191500 3300046516 Bacteria 1544
329 Ga0495628_0218687 3300046516 Bacteria 1431
330 Ga0495628_0349894 3300046516 Bacteria 1086
331 Ga0495628_0406515 3300046516 Bacteria 994
332 Ga0495630_0016116 3300046517 Bacteria 5461
333 Ga0495630_0199660 3300046517 Bacteria 1526
334 Ga0495630_0502829 3300046517 Bacteria 929
335 Ga0495652_0086306 3300046529 Bacteria 2577
336 Ga0495652_0106781 3300046529 Bacteria 2260
337 Ga0495652_0146650 3300046529 Bacteria 1849
338 Ga0495652_0189043 3300046529 Unclassified 1573
339 Ga0495652_0467372 3300046529 Bacteria 880
340 Ga0495652_0891935 3300046529 Bacteria 587
341 Ga0495640_0024833 3300046533 Bacteria 4354
342 Ga0495640_0270049 3300046533 Bacteria 1061
343 Ga0495587_0104147 3300046536 Unclassified 1633
344 Ga0495587_0422033 3300046536 Bacteria 740
345 Ga0495645_0049637 3300046543 Bacteria 3055
346 Ga0495645_0292708 3300046543 Bacteria 1067
347 Ga0495645_0789671 3300046543 Bacteria 570
348 Ga0495667_0042517 3300046559 Bacteria 3013
349 Ga0495667_0074372 3300046559 Bacteria 2212
350 Ga0495667_0220600 3300046559 Bacteria 1210
351 Ga0495634_0034716 3300046642 Bacteria 3459
352 Ga0495635_0357217 3300046663 Bacteria 974
353 Ga0495635_0401119 3300046663 Bacteria 911
354 Ga0495635_0612126 3300046663 Bacteria 711
355 Ga0495588_0192943 3300046674 Bacteria 1076
356 Ga0495657_0015899 3300046675 Bacteria 5493
357 Ga0495657_0038748 3300046675 Bacteria 3278
358 Ga0495599_0256663 3300046678 Bacteria 1063
359 Ga0495599_0406618 3300046678 Bacteria 810
360 Ga0495623_0436971 3300046679 Bacteria 699
361 Ga0495624_0179943 3300046690 Bacteria 1289
362 Ga0495624_0643256 3300046690 Bacteria 631
363 Ga0495600_0006640 3300046809 Bacteria 7046
364 Ga0495600_0477012 3300046809 Bacteria 769
365 Ga0495604_0082108 3300047317 Bacteria 2411
366 Ga0495604_0554357 3300047317 Bacteria 741
367 Ga0495604_0794787 3300047317 Bacteria 596
368 Ga0495674_0001155 3300047319 Bacteria 25441
369 Ga0495674_0036280 3300047319 Bacteria 4439
370 Ga0495674_0048072 3300047319 Bacteria 3778
371 Ga0495674_0131246 3300047319 Bacteria 2111
372 Ga0495674_0404747 3300047319 Bacteria 1101
373 Ga0495676_0376719 3300047321 Bacteria 945
374 Ga0495676_0728686 3300047321 Bacteria 641
375 Ga0495680_0003516 3300047322 Bacteria 15373
376 Ga0495680_0011199 3300047322 Bacteria 7964
377 Ga0495680_0023338 3300047322 Bacteria 5146
378 Ga0495680_0077742 3300047322 Bacteria 2513
379 Ga0495680_0342957 3300047322 Bacteria 1042
380 Ga0495675_0078113 3300047444 Bacteria 2085
381 Ga0495675_0170924 3300047444 Bacteria 1335
382 Ga0495684_0083658 3300047471 Bacteria 2420
383 Ga0495684_0922287 3300047471 Bacteria 561
384 Ga0495602_0099130 3300048088 Bacteria 2396
385 Ga0495602_0158602 3300048088 Bacteria 1769
386 Ga0495602_0305191 3300048088 Bacteria 1163
387 Ga0495602_0357725 3300048088 Bacteria 1052
388 Ga0495602_0612562 3300048088 Bacteria 747
389 Ga0495602_0646420 3300048088 Bacteria 723
390 Ga0496100_0021546 3300048903 Bacteria 3883
391 Ga0496100_0063014 3300048903 Bacteria 2449
392 Ga0496100_0678247 3300048903 Bacteria 803
393 Ga0496101_0009912 3300048904 Bacteria 6277
394 Ga0496101_0018559 3300048904 Bacteria 4732
395 Ga0496101_0022335 3300048904 Bacteria 4354
396 Ga0496101_0199207 3300048904 Bacteria 1547
397 Ga0496101_0559100 3300048904 Bacteria 905
398 Ga0496102_0157728 3300048905 Bacteria 2134
399 Ga0496102_0171165 3300048905 Bacteria 2044
400 Ga0496102_0174403 3300048905 Bacteria 2024
401 Ga0496102_0740715 3300048905 Bacteria 906
402 Ga0496102_1303669 3300048905 Bacteria 645
403 Ga0496103_0026198 3300048906 Bacteria 3530
404 Ga0496104_0062304 3300048907 Bacteria 3536
405 Ga0496104_0445272 3300048907 Bacteria 1207
406 Ga0496104_0600842 3300048907 Bacteria 1010
407 Ga0496104_1014648 3300048907 Bacteria 734
408 Ga0496105_0002319 3300048908 Bacteria 13794
409 Ga0496105_0179334 3300048908 Bacteria 1735
410 Ga0496105_0258375 3300048908 Bacteria 1409
411 Ga0496106_0054874 3300048909 Bacteria 3011
412 Ga0496106_0454883 3300048909 Bacteria 1028
413 Ga0496107_0081783 3300048910 Bacteria 2355
414 Ga0496107_0131138 3300048910 Bacteria 1850
415 Ga0496107_0516655 3300048910 Bacteria 885
416 Ga0496108_0413327 3300048911 Bacteria 1178
417 Ga0496108_0439414 3300048911 Bacteria 1140
418 Ga0496108_0481237 3300048911 Bacteria 1084
419 Ga0496108_0848964 3300048911 Unclassified 786
420 Ga0496109_0036671 3300048912 Bacteria 4426
421 Ga0496109_0263314 3300048912 Bacteria 1624
422 Ga0496109_0904939 3300048912 Bacteria 820
423 Ga0496110_0088337 3300048913 Bacteria 2768
424 Ga0496110_0156802 3300048913 Bacteria 2062
425 Ga0496110_0970137 3300048913 Bacteria 757
426 Ga0496111_0061387 3300048914 Bacteria 2725
427 Ga0496111_0172810 3300048914 Bacteria 1605
428 Ga0496112_0002060 3300048915 Bacteria 15937
429 Ga0496112_0067918 3300048915 Bacteria 3520
430 Ga0496112_0087006 3300048915 Bacteria 3092
431 Ga0496112_0130755 3300048915 Bacteria 2481
432 Ga0496112_0163649 3300048915 Bacteria 2191
433 Ga0496113_1098392 3300048916 Unclassified 624
434 Ga0496113_1237177 3300048916 Unclassified 582
435 Ga0496114_0005911 3300048917 Bacteria 9616
436 Ga0496114_0015092 3300048917 Bacteria 6212
437 Ga0496114_0113649 3300048917 Unclassified 2321
438 Ga0496114_0677700 3300048917 Bacteria 905
439 Ga0496115_0001970 3300048918 Bacteria 14659
440 Ga0496115_0050805 3300048918 Bacteria 3323
441 Ga0496115_0131876 3300048918 Bacteria 2060
442 Ga0496115_0313743 3300048918 Bacteria 1284
443 Ga0496115_1137485 3300048918 Bacteria 590
444 Ga0501036_0074493 3300049572 Bacteria 2871
445 Ga0501037_0461259 3300049573 Bacteria 866
446 Ga0501038_0111463 3300049574 Bacteria 2266
447 Ga0501038_0324525 3300049574 Bacteria 1204
448 Ga0501039_0063431 3300049575 Bacteria 2863
449 Ga0501040_0576539 3300049576 Bacteria 812
450 Ga0501042_0044832 3300049578 Bacteria 3151
451 Ga0501042_0607400 3300049578 Bacteria 795
452 Ga0501046_0699660 3300049580 Bacteria 714
453 Ga0501047_0025150 3300049581 Bacteria 5720
454 Ga0501047_0243028 3300049581 Bacteria 1650
455 Ga0501068_0114466 3300049584 Bacteria 1679
456 Ga0501069_0286914 3300049585 Bacteria 964
457 Ga0501070_0265409 3300049586 Bacteria 1403
458 Ga0501071_0921264 3300049587 Bacteria 674
459 Ga0501072_0637113 3300049588 Bacteria 839
460 Ga0501072_0988797 3300049588 Bacteria 656
461 Ga0501074_0107910 3300049590 Bacteria 1993
462 Ga0501075_0011055 3300049591 Bacteria 6371
463 Ga0501076_0882770 3300049592 Bacteria 737
464 Ga0501077_0162821 3300049593 Bacteria 1417
465 Ga0501077_0292680 3300049593 Bacteria 1037
466 Ga0501079_0047502 3300049741 Bacteria 3312
467 Ga0501080_0071758 3300049742 Bacteria 3221
468 Ga0501080_0656422 3300049742 Bacteria 928
469 Ga0501044_0651428 3300049823 Bacteria 942
470 Ga0501045_0007789 3300049824 Bacteria 7450
471 nmdc:mga09592_116681_c1 3300050508 Bacteria 2291
472 nmdc:mga09592_1388692_c1 3300050508 Bacteria 575
473 nmdc:mga0qj67_225994_c1 3300050509 Bacteria 1519
474 nmdc:mga0qj67_459428_c1 3300050509 Bacteria 1025
475 nmdc:mga0qj67_99132_c1 3300050509 Bacteria 2347
476 nmdc:mga06r32_152_c1 3300050510 Bacteria 52842
477 nmdc:mga06r32_266369_c1 3300050510 Bacteria 1701
478 nmdc:mga0n895_33700_c1 3300050512 Bacteria 4923
479 nmdc:mga0rr50_135930_c1 3300050513 Bacteria 1973
480 nmdc:mga08x19_348939_c1 3300050514 Bacteria 1033
481 nmdc:mga08x19_9737_c1 3300050514 Bacteria 5756
482 nmdc:mga0a205_231237_c1 3300050515 Bacteria 1732
483 Ga0495601_0008540 3300053077 Bacteria 6050
484 Ga0495601_0016720 3300053077 Bacteria 4448
485 Ga0495601_0050082 3300053077 Bacteria 2634
486 Ga0495601_0059378 3300053077 Bacteria 2425
487 Ga0495601_0198884 3300053077 Bacteria 1310
488 Ga0495601_0385203 3300053077 Bacteria 910
489 Ga0495612_0046219 3300053078 Bacteria 1783
490 Ga0495612_0101009 3300053078 Bacteria 1228
491 Ga0495612_0238685 3300053078 Bacteria 807
492 Ga0495612_0239985 3300053078 Bacteria 805
493 Ga0495595_0001982 3300053084 Bacteria 7956
494 Ga0495595_0014598 3300053084 Bacteria 3336
495 Ga0495595_0063165 3300053084 Bacteria 1738
496 Ga0495595_0189043 3300053084 Bacteria 1023
497 Ga0495595_0294870 3300053084 Bacteria 815
498 Ga0495619_0012522 3300053085 Bacteria 5343
499 Ga0495619_0478697 3300053085 Bacteria 857
500 Ga0495619_0546245 3300053085 Bacteria 795
501 Ga0495619_0870237 3300053085 Bacteria 607
502 Ga0501084_0024928 3300054114 Bacteria 4991
503 Ga0501082_0473864 3300060353 Bacteria 1094
504 Ga0466962_0078891 3300061719 Bacteria 1574
505 Ga0530510_0080194 3300061734 Bacteria 2375
506 Ga0530510_0170488 3300061734 Bacteria 1612
507 Ga0530510_0355983 3300061734 Bacteria 1100
508 Ga0207693_10623900
509 Ga0058862_12486825
510 Ga0070683_100003974
511 Ga0070683_100006582
512 Ga0070683_100052930
513 Ga0070683_101246119
514 Ga0070680_100003241
515 Ga0070680_100040496
516 Ga0070680_101172964
517 Ga0070682_100070788
518 Ga0070682_100192429
519 Ga0070682_100445032
520 Ga0068868_101410067
521 Ga0070660_100006340
522 Ga0070660_100038234
523 Ga0070660_100067589
524 Ga0070660_100454264
525 Ga0070660_101446685
526 Ga0070691_10190433
527 Ga0070691_10382201
528 Ga0070661_100010913
529 Ga0070661_100013428
530 Ga0070671_100327543
531 Ga0070671_101172294
532 Ga0070674_100182612
533 Ga0070659_100003606
534 Ga0070659_100004609
535 Ga0070659_100138000
536 Ga0070659_101355474
537 Ga0070709_10114488
538 Ga0070709_11143313
539 Ga0070714_100180976
540 Ga0070713_100047652
541 Ga0070710_10245328
542 Ga0070711_100065598
543 Ga0070663_100674463
544 Ga0070678_100351099
545 Ga0070678_101025661
546 Ga0070681_10001709
547 Ga0070681_10004158
548 Ga0070681_10081071
549 Ga0070681_10091989
550 Ga0070681_10257946
551 Ga0070699_100033396
552 Ga0070679_100001828
553 Ga0070679_100009015
554 Ga0070679_100275271
555 Ga0070679_101204209
556 Ga0070679_101262861
557 Ga0070684_100010350
558 Ga0070684_100046127
559 Ga0070684_100298477
560 Ga0070684_101538943
561 Ga0068853_100058235
562 Ga0068853_100074045
563 Ga0068853_100270698
564 Ga0068853_102215652
565 Ga0070695_101489801
566 Ga0070693_100437762
567 Ga0070665_100455572
568 Ga0070665_101093793
569 Ga0070704_100814966
570 Ga0068855_100057980
571 Ga0068855_100069906
572 Ga0068855_100335712
573 Ga0068855_100869473
574 Ga0070664_101281936
575 Ga0068857_100035495
576 Ga0068854_100036892
577 Ga0068854_100063047
578 Ga0068856_100017018
579 Ga0068856_100155474
580 Ga0068856_100299303
581 Ga0068856_100648937
582 Ga0068856_101010260
583 Ga0068856_102103771
584 Ga0068856_102591068
585 Ga0068852_100011511
586 Ga0068852_100084042
587 Ga0068852_100416898
588 Ga0068864_100901513
589 Ga0068851_10482426
590 Ga0081455_10016725
591 Ga0070717_10381634
592 Ga0070715_10842779
593 Ga0070716_100441756
594 Ga0070716_101364368
595 Ga0070712_100204138
596 Ga0070712_100307498
597 Ga0070712_100618476
598 Ga0070712_101059347
599 Ga0097621_100223036
600 Ga0097621_101881808
601 Ga0068871_101292580
602 Ga0068871_101714520
603 Ga0075428_100121290
604 Ga0075430_100241709
605 Ga0075431_100011961
606 Ga0075431_100278117
607 Ga0075433_11141794
608 Ga0075434_100015545
609 Ga0075429_100260878
610 Ga0075429_101555312
611 Ga0075436_100045419
612 Ga0075435_100225406
613 Ga0105240_10007145
614 Ga0105240_10088440
615 Ga0105240_10119188
616 Ga0105247_10007278
617 Ga0114129_11994928
618 Ga0105243_10074755
619 Ga0105241_10037542
620 Ga0105241_11862227
621 Ga0105242_10045015
622 Ga0105242_12058377
623 Ga0105248_10097057
624 Ga0105248_10475058
625 Ga0105237_10011141
626 Ga0105237_10018270
627 Ga0105237_10134758
628 Ga0105238_10040356
629 Ga0105238_10079481
630 Ga0105238_11173496
631 Ga0105238_11577485
632 Ga0105249_12165489
633 Ga0099796_10316413
634 Ga0105239_10023938
635 Ga0105239_10137599
636 Ga0105239_11217117
637 Ga0157370_10014163
638 Ga0157370_10021701
639 Ga0157370_10714658
640 Ga0157370_11344516
641 Ga0157369_10007608
642 Ga0157369_10044330
643 Ga0157369_10109645
644 Ga0157369_11054424
645 Ga0157374_10079794
646 Ga0157374_10536319
647 Ga0157374_11167980
648 Ga0157378_12932402
649 Ga0163162_12491947
650 Ga0157372_10012318
651 Ga0157372_10014018
652 Ga0157372_10089493
653 Ga0157372_10285769
654 Ga0157372_11725241
655 Ga0157375_10206483
656 Ga0157380_11680252
657 Ga0182008_10565316
658 Ga0157379_12057659
659 Ga0157376_10199657
660 Ga0157376_10476448
661 Ga0206355_1332842
662 Ga0206354_10697055
663 Ga0206353_11297134
664 Ga0154015_1038678
665 Ga0213873_10035485
666 Ga0224712_10139174
667 Ga0207692_10160399
668 Ga0207692_10194490
669 Ga0207710_10071277
670 Ga0207705_10273681
671 Ga0207654_10016346
672 Ga0207707_10002693
673 Ga0207707_10004757
674 Ga0207707_10077418
675 Ga0207707_10094062
676 Ga0207695_10287831
677 Ga0207695_10462783
678 Ga0207671_10022712
679 Ga0207671_10416418
680 Ga0207693_10079056
681 Ga0207693_10263608
682 Ga0207693_10281302
683 Ga0207693_10439079
684 Ga0207663_10157032
685 Ga0207663_11559964
686 Ga0207660_10004036
687 Ga0207660_10996639
688 Ga0207660_11153755
689 Ga0207657_10015597
690 Ga0207657_10037469
691 Ga0207657_10090436
692 Ga0207657_10109981
693 Ga0207657_10473492
694 Ga0207649_10011315
695 Ga0207649_10363718
696 Ga0207652_10010839
697 Ga0207652_10014168
698 Ga0207652_10049656
699 Ga0207652_10246669
700 Ga0207652_10308787
701 Ga0207694_10113556
702 Ga0207694_10121207
703 Ga0207694_10161562
704 Ga0207694_11210732
705 Ga0207694_11817561
706 Ga0207664_10069694
707 Ga0207644_10142625
708 Ga0207644_10982004
709 Ga0207690_10016274
710 Ga0207690_10017161
711 Ga0207690_10891781
712 Ga0207686_10176478
713 Ga0207686_11340909
714 Ga0207709_11742462
715 Ga0207669_10300864
716 Ga0207665_10577529
717 Ga0207665_11518608
718 Ga0207711_10089341
719 Ga0207661_10002300
720 Ga0207661_10231247
721 Ga0207661_10242013
722 Ga0207661_11252979
723 Ga0207679_12204240
724 Ga0207667_10130878
725 Ga0207667_10177185
726 Ga0207667_10968551
727 Ga0207639_10028266
728 Ga0207639_10232152
729 Ga0207639_10717396
730 Ga0207639_12239523
731 Ga0207678_10225158
732 Ga0207702_10300449
733 Ga0207702_10560750
734 Ga0207702_10906287
735 Ga0207676_10537787
736 Ga0207674_10117011
737 Ga0207683_10273088
738 Ga0207683_10296946
739 Ga0207683_10927581
740 Ga0207698_10005858
741 Ga0207698_10467862
742 Ga0207698_10583333
743 Ga0268266_10220691
744 Ga0268266_10285065
745 Ga0268266_10489347
746 Ga0268264_10523192
747 Ga0268264_11780854
748 Ga0265338_10056977
749 Ga0265338_10232602
750 Ga0265324_10005374
751 Ga0307406_10602202
752 Ga0373933_0347205
753 Ga0373937_0396981
754 Ga0373937_0406811
755 Ga0373937_0444223
756 Ga0373937_0922971
757 Ga0373937_1985737
758 Ga0395900_0295427
759 Ga0395900_1286003
760 Ga0395898_0522426
761 Ga0395905_0441199
762 Ga0395905_0609106
763 Ga0395901_0494970
764 Ga0395901_1102649
765 Ga0395901_1449192
766 Ga0242420_004478
767 Ga0436365_1903811
768 Ga0436360_1165091
769 Ga0436363_0246979
770 Ga0451800_0145723
771 Ga0451853_0025252
772 Ga0451853_3773895
773 Ga0466972_0562605
774 Ga0466966_0232237
775 Ga0466963_0004490
776 Ga0466963_0014614
777 Ga0466963_0021777
778 Ga0466963_0269064
779 Ga0466963_0660877
780 Ga0466963_0722599
781 Ga0466964_0001153
782 Ga0466964_0023955
783 Ga0466964_0024517
784 Ga0466964_0258893
785 Ga0466964_0345279
786 Ga0466964_0431153
787 Ga0466971_0587798
788 Ga0466968_0028234
789 Ga0466968_0029197
790 Ga0466968_0050331
791 Ga0466968_0345199
792 Ga0466970_0210234
793 Ga0466970_0782547
794 Ga0466970_0800767
795 Ga0466970_0960504
796 Ga0466957_0600781
797 Ga0466960_0145284
798 Ga0466958_0097684
799 Ga0466967_0000773
800 Ga0466967_0002136
801 Ga0466967_0019174
802 Ga0466967_0019339
803 Ga0466967_0080113
804 Ga0466967_0088973
805 Ga0466967_0103041
806 Ga0466967_0104446
807 Ga0466967_0114160
808 Ga0466967_0163965
809 Ga0466967_0185868
810 Ga0466967_0216274
811 Ga0466967_0323683
812 Ga0466967_0630027
813 Ga0466967_0659051
814 Ga0466967_0744410
815 Ga0466967_0816579
816 Ga0466967_0851039
817 Ga0466967_1190087
818 Ga0466967_1801198
819 Ga0495629_0102481
820 Ga0495651_0243270
821 Ga0495651_0583555
822 Ga0495651_0846668
823 Ga0495653_0006377
824 Ga0495653_0099369
825 Ga0495653_0168063
826 Ga0495653_0354529
827 Ga0495582_0168116
828 Ga0495639_0021584
829 Ga0495664_0094019
830 Ga0495664_0194898
831 Ga0495608_0015289
832 Ga0495608_0019588
833 Ga0495608_0290086
834 Ga0495618_0144570
835 Ga0495628_0191500
836 Ga0495628_0218687
837 Ga0495628_0349894
838 Ga0495628_0406515
839 Ga0495630_0016116
840 Ga0495630_0199660
841 Ga0495630_0502829
842 Ga0495652_0086306
843 Ga0495652_0106781
844 Ga0495652_0146650
845 Ga0495652_0189043
846 Ga0495652_0467372
847 Ga0495652_0891935
848 Ga0495640_0024833
849 Ga0495640_0270049
850 Ga0495587_0104147
851 Ga0495587_0422033
852 Ga0495645_0049637
853 Ga0495645_0292708
854 Ga0495645_0789671
855 Ga0495667_0042517
856 Ga0495667_0074372
857 Ga0495667_0220600
858 Ga0495634_0034716
859 Ga0495635_0357217
860 Ga0495635_0401119
861 Ga0495635_0612126
862 Ga0495588_0192943
863 Ga0495657_0015899
864 Ga0495657_0038748
865 Ga0495599_0256663
866 Ga0495599_0406618
867 Ga0495623_0436971
868 Ga0495624_0179943
869 Ga0495624_0643256
870 Ga0495600_0006640
871 Ga0495600_0477012
872 Ga0495604_0082108
873 Ga0495604_0554357
874 Ga0495604_0794787
875 Ga0495674_0001155
876 Ga0495674_0036280
877 Ga0495674_0048072
878 Ga0495674_0131246
879 Ga0495674_0404747
880 Ga0495676_0376719
881 Ga0495676_0728686
882 Ga0495680_0003516
883 Ga0495680_0011199
884 Ga0495680_0023338
885 Ga0495680_0077742
886 Ga0495680_0342957
887 Ga0495675_0078113
888 Ga0495675_0170924
889 Ga0495684_0083658
890 Ga0495684_0922287
891 Ga0495602_0099130
892 Ga0495602_0158602
893 Ga0495602_0305191
894 Ga0495602_0357725
895 Ga0495602_0612562
896 Ga0495602_0646420
897 Ga0496100_0021546
898 Ga0496100_0063014
899 Ga0496100_0678247
900 Ga0496101_0009912
901 Ga0496101_0018559
902 Ga0496101_0022335
903 Ga0496101_0199207
904 Ga0496101_0559100
905 Ga0496102_0157728
906 Ga0496102_0171165
907 Ga0496102_0174403
908 Ga0496102_0740715
909 Ga0496102_1303669
910 Ga0496103_0026198
911 Ga0496104_0062304
912 Ga0496104_0445272
913 Ga0496104_0600842
914 Ga0496104_1014648
915 Ga0496105_0002319
916 Ga0496105_0179334
917 Ga0496105_0258375
918 Ga0496106_0054874
919 Ga0496106_0454883
920 Ga0496107_0081783
921 Ga0496107_0131138
922 Ga0496107_0516655
923 Ga0496108_0413327
924 Ga0496108_0439414
925 Ga0496108_0481237
926 Ga0496108_0848964
927 Ga0496109_0036671
928 Ga0496109_0263314
929 Ga0496109_0904939
930 Ga0496110_0088337
931 Ga0496110_0156802
932 Ga0496110_0970137
933 Ga0496111_0061387
934 Ga0496111_0172810
935 Ga0496112_0002060
936 Ga0496112_0067918
937 Ga0496112_0087006
938 Ga0496112_0130755
939 Ga0496112_0163649
940 Ga0496113_1098392
941 Ga0496113_1237177
942 Ga0496114_0005911
943 Ga0496114_0015092
944 Ga0496114_0113649
945 Ga0496114_0677700
946 Ga0496115_0001970
947 Ga0496115_0050805
948 Ga0496115_0131876
949 Ga0496115_0313743
950 Ga0496115_1137485
951 Ga0501036_0074493
952 Ga0501037_0461259
953 Ga0501038_0111463
954 Ga0501038_0324525
955 Ga0501039_0063431
956 Ga0501040_0576539
957 Ga0501042_0044832
958 Ga0501042_0607400
959 Ga0501046_0699660
960 Ga0501047_0025150
961 Ga0501047_0243028
962 Ga0501068_0114466
963 Ga0501069_0286914
964 Ga0501070_0265409
965 Ga0501071_0921264
966 Ga0501072_0637113
967 Ga0501072_0988797
968 Ga0501074_0107910
969 Ga0501075_0011055
970 Ga0501076_0882770
971 Ga0501077_0162821
972 Ga0501077_0292680
973 Ga0501079_0047502
974 Ga0501080_0071758
975 Ga0501080_0656422
976 Ga0501044_0651428
977 Ga0501045_0007789
978 nmdc:mga09592_116681_c1
979 nmdc:mga09592_1388692_c1
980 nmdc:mga0qj67_225994_c1
981 nmdc:mga0qj67_459428_c1
982 nmdc:mga0qj67_99132_c1
983 nmdc:mga06r32_152_c1
984 nmdc:mga06r32_266369_c1
985 nmdc:mga0n895_33700_c1
986 nmdc:mga0rr50_135930_c1
987 nmdc:mga08x19_348939_c1
988 nmdc:mga08x19_9737_c1
989 nmdc:mga0a205_231237_c1
990 Ga0495601_0008540
991 Ga0495601_0016720
992 Ga0495601_0050082
993 Ga0495601_0059378
994 Ga0495601_0198884
995 Ga0495601_0385203
996 Ga0495612_0046219
997 Ga0495612_0101009
998 Ga0495612_0238685
999 Ga0495612_0239985
1000 Ga0495595_0001982
1001 Ga0495595_0014598
1002 Ga0495595_0063165
1003 Ga0495595_0189043
1004 Ga0495595_0294870
1005 Ga0495619_0012522
1006 Ga0495619_0478697
1007 Ga0495619_0546245
1008 Ga0495619_0870237
1009 Ga0501084_0024928
1010 Ga0501082_0473864
1011 Ga0466962_0078891
1012 Ga0530510_0080194
1013 Ga0530510_0170488
1014 Ga0530510_0355983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

36

99

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9232 4 78
4wwc-assembly1.cif.gz_B crystal structure of full length yvoa in complex with palindromic operator dna 0.9127 3 81
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9118 4 78
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9087 4 81
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.8965 9 78
ID Description Score Start End Superfamily
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9328 12 81 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9321 35 77 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 3 78 1.10.10.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 3 78 1.10.10.10
4u0wA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9252 3 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3Q2D1-F1-model_v4 deleted 0.9868 5 79
AF-A0A2A5GQ75-F1-model_v4 Transcriptional regulator 0.9843 5 78 GO:0003677
GO:0003700
GO:0005737
AF-A0A4Q3PPI7-F1-model_v4 deleted 0.9822 5 79
AF-A0A355IQM0-F1-model_v4 Transcriptional regulator 0.9805 6 78 GO:0003677
GO:0003700
GO:0005737
AF-A0A1C5CIU2-F1-model_v4 GntR family transcriptional regulator 0.962 1 81 GO:0003677
GO:0003700

Map