F456658

General Info

Members Datasets Scaffolds Average Seq Length
507 249 1014 252

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000012|Ga0081539_10000012163
Length 290
Sequence MNMSRNREPELEPLEPGIGNSERGTSRAASCVALIPARQGSKRVPGKNVRVLSGHPMLAYTIRLAIESGVFESVIVSTDSDEIADIARHYGAEVPFLRPSPFASDTSPDIEWLEYTLEELARQGRTWDAFSLLRPTSPFRSAETIRRAWTRFISQEGIDSLRAVEKCAQHPGKMWVLRGDRMLPLLPFGDPPWHSTPYQALPPVYIQNASLEIAWTRVVFERRTIAGDVIVPFLTEGYEGFDINDAYDWIVAERLLADGAVNLPPVTTSAYQNPVKSQIPSPKSQTPIGA

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0.59
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 13.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10000012 3300005985 Bacteria 440369
2 JGI24750J21931_1013770 3300002070 Unclassified 1083
3 JGI25406J46586_10001234 3300003203 Bacteria 12025
4 JGI25406J46586_10004167 3300003203 Bacteria 6748
5 rootL2_10195292 3300003322 Bacteria 1084
6 Ga0065712_10034131 3300005290 Bacteria 1406
7 Ga0065715_10122967 3300005293 Bacteria 2190
8 Ga0065715_10420906 3300005293 Bacteria 804
9 Ga0070658_10123375 3300005327 Bacteria 2154
10 Ga0070676_10006702 3300005328 Bacteria 6171
11 Ga0070676_10009696 3300005328 Bacteria 5208
12 Ga0070676_10221556 3300005328 Bacteria 1250
13 Ga0070683_100165179 3300005329 Bacteria 2100
14 Ga0070683_100493051 3300005329 Bacteria 1170
15 Ga0070683_100665052 3300005329 Bacteria 997
16 Ga0070690_100000699 3300005330 Bacteria 17200
17 Ga0070690_100018411 3300005330 Bacteria 4219
18 Ga0070690_100019592 3300005330 Bacteria 4110
19 Ga0070690_100099915 3300005330 Bacteria 1922
20 Ga0070690_100179164 3300005330 Unclassified 1463
21 Ga0070670_100001479 3300005331 Bacteria 18919
22 Ga0070670_100173011 3300005331 Unclassified 1873
23 Ga0070677_10000288 3300005333 Bacteria 17652
24 Ga0068869_100009540 3300005334 Bacteria 6300
25 Ga0068869_100012302 3300005334 Bacteria 5650
26 Ga0068869_100026481 3300005334 Bacteria 4037
27 Ga0068869_100369758 3300005334 Bacteria 1173
28 Ga0070666_10001698 3300005335 Bacteria 13427
29 Ga0070666_10153648 3300005335 Bacteria 1606
30 Ga0070680_100024106 3300005336 Bacteria 4855
31 Ga0070680_100206504 3300005336 Unclassified 1657
32 Ga0070682_100002183 3300005337 Bacteria 10844
33 Ga0068868_100010496 3300005338 Bacteria 6710
34 Ga0068868_100021549 3300005338 Bacteria 4853
35 Ga0070660_100048572 3300005339 Bacteria 3259
36 Ga0070689_100002390 3300005340 Bacteria 12240
37 Ga0070689_100005165 3300005340 Bacteria 8885
38 Ga0070691_10001024 3300005341 Bacteria 11485
39 Ga0070687_100004163 3300005343 Bacteria 5729
40 Ga0070687_100007818 3300005343 Bacteria 4489
41 Ga0070687_100013052 3300005343 Bacteria 3690
42 Ga0070687_100079936 3300005343 Bacteria 1781
43 Ga0070661_100001516 3300005344 Bacteria 16141
44 Ga0070661_100002655 3300005344 Bacteria 12232
45 Ga0070661_100063727 3300005344 Bacteria 2708
46 Ga0070661_100168195 3300005344 Bacteria 1664
47 Ga0070661_100310096 3300005344 Bacteria 1230
48 Ga0070668_100005034 3300005347 Bacteria 9786
49 Ga0070669_100006556 3300005353 Bacteria 8377
50 Ga0070669_100079486 3300005353 Unclassified 2439
51 Ga0070675_100003428 3300005354 Bacteria 12011
52 Ga0070675_100012989 3300005354 Bacteria 6539
53 Ga0070675_100072105 3300005354 Unclassified 2867
54 Ga0070675_100223792 3300005354 Bacteria 1639
55 Ga0070671_100002370 3300005355 Bacteria 14551
56 Ga0070671_100004879 3300005355 Bacteria 10674
57 Ga0070671_100492298 3300005355 Bacteria 1054
58 Ga0070674_100165698 3300005356 Bacteria 1680
59 Ga0070673_100000236 3300005364 Bacteria 27700
60 Ga0070673_100011175 3300005364 Bacteria 6122
61 Ga0070673_100126014 3300005364 Bacteria 2143
62 Ga0070673_100148607 3300005364 Bacteria 1983
63 Ga0070688_100000996 3300005365 Bacteria 14212
64 Ga0070688_100002655 3300005365 Bacteria 9075
65 Ga0070688_100018958 3300005365 Bacteria 3980
66 Ga0070688_100103176 3300005365 Bacteria 1884
67 Ga0070688_100345716 3300005365 Unclassified 1087
68 Ga0070659_100007483 3300005366 Bacteria 7934
69 Ga0070667_100003269 3300005367 Bacteria 13853
70 Ga0070709_10016943 3300005434 Bacteria 4171
71 Ga0070714_100056549 3300005435 Bacteria 3356
72 Ga0070713_100055815 3300005436 Bacteria 3284
73 Ga0070710_10008516 3300005437 Bacteria 4994
74 Ga0070701_10005747 3300005438 Bacteria 5158
75 Ga0070701_10023751 3300005438 Bacteria 2958
76 Ga0070711_100002280 3300005439 Bacteria 10882
77 Ga0070705_100002565 3300005440 Bacteria 9129
78 Ga0070700_100003180 3300005441 Bacteria 8435
79 Ga0070700_100021736 3300005441 Bacteria 3733
80 Ga0070700_100241204 3300005441 Bacteria 1292
81 Ga0070694_100000700 3300005444 Bacteria 18666
82 Ga0070694_100300816 3300005444 Bacteria 1229
83 Ga0070663_100000375 3300005455 Bacteria 23516
84 Ga0070678_100308859 3300005456 Unclassified 1346
85 Ga0070662_100000335 3300005457 Bacteria 28226
86 Ga0070662_100045986 3300005457 Bacteria 3135
87 Ga0070662_100144324 3300005457 Bacteria 1848
88 Ga0068867_100005778 3300005459 Bacteria 8775
89 Ga0068867_100014254 3300005459 Bacteria 5631
90 Ga0070685_10008531 3300005466 Bacteria 5272
91 Ga0070707_100627641 3300005468 Unclassified 1037
92 Ga0070698_100011425 3300005471 Bacteria 9419
93 Ga0070698_100026579 3300005471 Bacteria 6025
94 Ga0070698_100532149 3300005471 Unclassified 1114
95 Ga0070699_100000388 3300005518 Bacteria 42659
96 Ga0070699_100016225 3300005518 Bacteria 6394
97 Ga0070699_100044770 3300005518 Bacteria 3831
98 Ga0070699_100517109 3300005518 Bacteria 1085
99 Ga0070679_100128851 3300005530 Bacteria 2512
100 Ga0070697_100028146 3300005536 Bacteria 4499
101 Ga0070697_100460863 3300005536 Bacteria 1108
102 Ga0068853_100014778 3300005539 Bacteria 6407
103 Ga0070672_100005088 3300005543 Bacteria 8676
104 Ga0070672_100008297 3300005543 Bacteria 7097
105 Ga0070672_100031492 3300005543 Bacteria 3992
106 Ga0070672_100054293 3300005543 Unclassified 3136
107 Ga0070672_100060436 3300005543 Bacteria 2984
108 Ga0070686_100002059 3300005544 Bacteria 11123
109 Ga0070686_100013914 3300005544 Bacteria 4621
110 Ga0070686_100063533 3300005544 Unclassified 2392
111 Ga0070686_100377028 3300005544 Unclassified 1073
112 Ga0070695_100009022 3300005545 Bacteria 5928
113 Ga0070696_100006015 3300005546 Bacteria 8095
114 Ga0070696_100008999 3300005546 Bacteria 6684
115 Ga0070696_100163163 3300005546 Bacteria 1643
116 Ga0070693_100004356 3300005547 Bacteria 6683
117 Ga0070665_100049391 3300005548 Bacteria 4221
118 Ga0070665_100173135 3300005548 Unclassified 2160
119 Ga0070704_100000645 3300005549 Bacteria 16858
120 Ga0068855_100012500 3300005563 Bacteria 10246
121 Ga0070664_100002958 3300005564 Bacteria 13744
122 Ga0070664_100008546 3300005564 Bacteria 8281
123 Ga0070664_100032704 3300005564 Bacteria 4351
124 Ga0070664_100056344 3300005564 Bacteria 3340
125 Ga0070664_100170454 3300005564 Bacteria 1931
126 Ga0068857_100007062 3300005577 Bacteria 9672
127 Ga0068857_100065525 3300005577 Bacteria 3231
128 Ga0068854_100009370 3300005578 Bacteria 6321
129 Ga0068854_100023091 3300005578 Bacteria 4245
130 Ga0070702_100002616 3300005615 Bacteria 7839
131 Ga0068852_100331895 3300005616 Unclassified 1480
132 Ga0068852_100651065 3300005616 Bacteria 1061
133 Ga0068859_100237303 3300005617 Bacteria 1912
134 Ga0068859_100418898 3300005617 Unclassified 1435
135 Ga0068864_100010408 3300005618 Bacteria 7682
136 Ga0068864_100125141 3300005618 Unclassified 2303
137 Ga0068864_100211850 3300005618 Bacteria 1784
138 Ga0068864_100260243 3300005618 Bacteria 1614
139 Ga0068861_100211470 3300005719 Archaea 1634
140 Ga0068851_10194813 3300005834 Unclassified 1128
141 Ga0068851_10228164 3300005834 Bacteria 1049
142 Ga0068863_100010976 3300005841 Bacteria 8785
143 Ga0068863_100029211 3300005841 Bacteria 5264
144 Ga0068863_100030111 3300005841 Bacteria 5185
145 Ga0068863_100448385 3300005841 Bacteria 1266
146 Ga0068858_100029171 3300005842 Bacteria 5122
147 Ga0068860_100038327 3300005843 Bacteria 4584
148 Ga0068862_100042112 3300005844 Bacteria 3889
149 Ga0068862_100050523 3300005844 Unclassified 3554
150 Ga0068862_100259465 3300005844 Bacteria 1586
151 Ga0081539_10000277 3300005985 Bacteria 117060
152 Ga0081539_10001760 3300005985 Bacteria 34531
153 Ga0081539_10018849 3300005985 Bacteria 4756
154 Ga0075432_10005094 3300006058 Bacteria 4477
155 Ga0070715_10001050 3300006163 Bacteria 7801
156 Ga0070716_100002310 3300006173 Bacteria 8780
157 Ga0070712_100001380 3300006175 Bacteria 14737
158 Ga0097621_100021107 3300006237 Bacteria 5030
159 Ga0097621_100041936 3300006237 Unclassified 3686
160 Ga0097621_100355188 3300006237 Bacteria 1304
161 Ga0068871_100223660 3300006358 Bacteria 1631
162 Ga0075428_100017712 3300006844 Bacteria 7872
163 Ga0075428_100066445 3300006844 Bacteria 3948
164 Ga0075428_100173546 3300006844 Bacteria 2336
165 Ga0075428_100691244 3300006844 Bacteria 1087
166 Ga0075430_100001258 3300006846 Bacteria 20411
167 Ga0075430_100006676 3300006846 Bacteria 9734
168 Ga0075430_100187646 3300006846 Bacteria 1719
169 Ga0075431_100000096 3300006847 Bacteria 54552
170 Ga0075431_100003441 3300006847 Bacteria 15353
171 Ga0075431_100036581 3300006847 Bacteria 5056
172 Ga0075431_100040742 3300006847 Bacteria 4787
173 Ga0075431_100062530 3300006847 Bacteria 3841
174 Ga0075431_100466809 3300006847 Unclassified 1256
175 Ga0075431_100551499 3300006847 Unclassified 1140
176 Ga0075433_10000156 3300006852 Bacteria 36701
177 Ga0075433_10224563 3300006852 Bacteria 1668
178 Ga0075433_10477643 3300006852 Unclassified 1098
179 Ga0075434_100000285 3300006871 Bacteria 35998
180 Ga0075434_100000677 3300006871 Bacteria 26486
181 Ga0075434_100041026 3300006871 Bacteria 4584
182 Ga0075434_100157411 3300006871 Unclassified 2291
183 Ga0075434_100239517 3300006871 Bacteria 1834
184 Ga0075434_100753571 3300006871 Bacteria 991
185 Ga0075429_100001155 3300006880 Bacteria 21307
186 Ga0075429_100029115 3300006880 Bacteria 4797
187 Ga0075429_100038867 3300006880 Bacteria 4143
188 Ga0068865_100076306 3300006881 Bacteria 2392
189 Ga0068865_100498253 3300006881 Unclassified 1015
190 Ga0075436_100035623 3300006914 Bacteria 3432
191 Ga0075436_100293667 3300006914 Bacteria 1164
192 Ga0097620_100237308 3300006931 Bacteria 1912
193 Ga0097620_100418896 3300006931 Unclassified 1435
194 Ga0075435_100008076 3300007076 Bacteria 7534
195 Ga0075435_100040116 3300007076 Bacteria 3738
196 Ga0075435_100062945 3300007076 Unclassified 3012
197 Ga0111539_10000163 3300009094 Bacteria 76568
198 Ga0111539_10001203 3300009094 Bacteria 34451
199 Ga0111539_10001782 3300009094 Bacteria 28623
200 Ga0111539_10006711 3300009094 Bacteria 14819
201 Ga0111539_10097629 3300009094 Bacteria 3451
202 Ga0111539_10358369 3300009094 Bacteria 1697
203 Ga0111539_10567220 3300009094 Bacteria 1322
204 Ga0111539_10632793 3300009094 Bacteria 1246
205 Ga0111539_11155780 3300009094 Bacteria 899
206 Ga0105247_10000190 3300009101 Bacteria 60261
207 Ga0114129_10003505 3300009147 Bacteria 22067
208 Ga0114129_10004681 3300009147 Bacteria 19328
209 Ga0114129_10084295 3300009147 Bacteria 4413
210 Ga0114129_10104718 3300009147 Bacteria 3910
211 Ga0114129_10112368 3300009147 Bacteria 3757
212 Ga0114129_10476284 3300009147 Bacteria 1634
213 Ga0114129_10491878 3300009147 Unclassified 1603
214 Ga0114129_10648625 3300009147 Unclassified 1363
215 Ga0105243_10017979 3300009148 Bacteria 5349
216 Ga0105243_10071790 3300009148 Bacteria 2800
217 Ga0105242_10061124 3300009176 Bacteria 3098
218 Ga0105248_10013717 3300009177 Bacteria 8922
219 Ga0105248_10091598 3300009177 Unclassified 3424
220 Ga0105248_10904216 3300009177 Bacteria 997
221 Ga0105238_10021306 3300009551 Bacteria 6606
222 Ga0105246_10059253 3300011119 Bacteria 2655
223 Ga0157374_10000859 3300013296 Bacteria 26602
224 Ga0157378_10465993 3300013297 Unclassified 1256
225 Ga0163162_10107681 3300013306 Bacteria 2883
226 Ga0157372_10176310 3300013307 Bacteria 2474
227 Ga0157375_10026255 3300013308 Bacteria 5425
228 Ga0157375_10214443 3300013308 Bacteria 2083
229 Ga0157375_10865443 3300013308 Bacteria 1050
230 Ga0163163_10019625 3300014325 Bacteria 6349
231 Ga0163163_10063333 3300014325 Bacteria 3666
232 Ga0163163_10329059 3300014325 Bacteria 1582
233 Ga0157380_10012231 3300014326 Bacteria 6217
234 Ga0157380_10333242 3300014326 Bacteria 1412
235 Ga0157377_10001303 3300014745 Bacteria 10692
236 Ga0157377_10095458 3300014745 Bacteria 1762
237 Ga0157377_10191086 3300014745 Bacteria 1294
238 Ga0157379_10006446 3300014968 Bacteria 10113
239 Ga0157376_10446154 3300014969 Unclassified 1261
240 Ga0163161_10020734 3300017792 Bacteria 4614
241 Ga0163161_10027947 3300017792 Bacteria 4002
242 Ga0207697_10000608 3300025315 Bacteria 20375
243 Ga0207656_10005533 3300025321 Bacteria 4472
244 Ga0207682_10002659 3300025893 Bacteria 7954
245 Ga0207682_10069593 3300025893 Unclassified 1489
246 Ga0207642_10131322 3300025899 Bacteria 1307
247 Ga0207688_10193870 3300025901 Unclassified 1216
248 Ga0207680_10006061 3300025903 Bacteria 5821
249 Ga0207680_10023553 3300025903 Bacteria 3365
250 Ga0207680_10097952 3300025903 Bacteria 1879
251 Ga0207680_10276399 3300025903 Bacteria 1166
252 Ga0207685_10094420 3300025905 Unclassified 1267
253 Ga0207699_10006208 3300025906 Bacteria 5765
254 Ga0207645_10006177 3300025907 Bacteria 8600
255 Ga0207645_10010442 3300025907 Bacteria 6372
256 Ga0207645_10086401 3300025907 Bacteria 2015
257 Ga0207643_10003089 3300025908 Bacteria 8951
258 Ga0207643_10008855 3300025908 Bacteria 5402
259 Ga0207643_10051681 3300025908 Bacteria 2333
260 Ga0207705_10098172 3300025909 Bacteria 2152
261 Ga0207695_10154620 3300025913 Bacteria 2229
262 Ga0207671_10022631 3300025914 Bacteria 4748
263 Ga0207693_10000404 3300025915 Bacteria 39462
264 Ga0207693_10097638 3300025915 Bacteria 2303
265 Ga0207663_10183210 3300025916 Unclassified 1497
266 Ga0207660_10010180 3300025917 Bacteria 6094
267 Ga0207660_10136978 3300025917 Bacteria 1869
268 Ga0207662_10004078 3300025918 Bacteria 7629
269 Ga0207662_10010011 3300025918 Bacteria 5231
270 Ga0207662_10013350 3300025918 Bacteria 4592
271 Ga0207657_10001543 3300025919 Bacteria 24675
272 Ga0207649_10005475 3300025920 Bacteria 6872
273 Ga0207649_10215159 3300025920 Unclassified 1365
274 Ga0207681_10020654 3300025923 Unclassified 4177
275 Ga0207681_10021995 3300025923 Bacteria 4062
276 Ga0207681_10026865 3300025923 Bacteria 3716
277 Ga0207681_10064412 3300025923 Bacteria 2531
278 Ga0207681_10127704 3300025923 Bacteria 1875
279 Ga0207694_10232793 3300025924 Bacteria 1505
280 Ga0207650_10001214 3300025925 Bacteria 18898
281 Ga0207650_10018649 3300025925 Bacteria 4871
282 Ga0207650_10104296 3300025925 Bacteria 2187
283 Ga0207659_10004992 3300025926 Bacteria 8039
284 Ga0207659_10082707 3300025926 Unclassified 2378
285 Ga0207659_10104807 3300025926 Bacteria 2139
286 Ga0207659_10141596 3300025926 Unclassified 1867
287 Ga0207659_10330373 3300025926 Bacteria 1260
288 Ga0207659_10342122 3300025926 Unclassified 1239
289 Ga0207687_10147384 3300025927 Bacteria 1792
290 Ga0207700_10215667 3300025928 Bacteria 1625
291 Ga0207700_10239197 3300025928 Bacteria 1547
292 Ga0207644_10028878 3300025931 Bacteria 3844
293 Ga0207644_10079648 3300025931 Bacteria 2417
294 Ga0207690_10015470 3300025932 Bacteria 4624
295 Ga0207690_10299474 3300025932 Unclassified 1258
296 Ga0207706_10001189 3300025933 Bacteria 26270
297 Ga0207706_10302487 3300025933 Bacteria 1393
298 Ga0207706_10417744 3300025933 Unclassified 1162
299 Ga0207706_10514560 3300025933 Bacteria 1032
300 Ga0207686_10012062 3300025934 Bacteria 4748
301 Ga0207709_10005688 3300025935 Bacteria 7040
302 Ga0207670_10002280 3300025936 Bacteria 10047
303 Ga0207670_10006151 3300025936 Bacteria 6640
304 Ga0207670_10096175 3300025936 Bacteria 2105
305 Ga0207669_10120276 3300025937 Unclassified 1781
306 Ga0207669_10264328 3300025937 Unclassified 1289
307 Ga0207704_10050970 3300025938 Bacteria 2500
308 Ga0207704_10111766 3300025938 Unclassified 1849
309 Ga0207704_10185788 3300025938 Bacteria 1507
310 Ga0207704_10292875 3300025938 Bacteria 1243
311 Ga0207665_10001635 3300025939 Bacteria 15070
312 Ga0207691_10033675 3300025940 Bacteria 4771
313 Ga0207691_10075994 3300025940 Unclassified 3027
314 Ga0207691_10173563 3300025940 Bacteria 1887
315 Ga0207711_10020877 3300025941 Bacteria 5467
316 Ga0207711_10186375 3300025941 Unclassified 1889
317 Ga0207689_10085536 3300025942 Bacteria 2592
318 Ga0207689_10142934 3300025942 Bacteria 1971
319 Ga0207689_10224743 3300025942 Unclassified 1552
320 Ga0207661_10259457 3300025944 Bacteria 1548
321 Ga0207661_10435792 3300025944 Bacteria 1192
322 Ga0207679_10008219 3300025945 Bacteria 6643
323 Ga0207679_10020323 3300025945 Bacteria 4480
324 Ga0207679_10020894 3300025945 Bacteria 4428
325 Ga0207667_10013475 3300025949 Bacteria 9355
326 Ga0207651_10006668 3300025960 Bacteria 6075
327 Ga0207651_10014298 3300025960 Bacteria 4577
328 Ga0207651_10077730 3300025960 Bacteria 2377
329 Ga0207651_10241948 3300025960 Bacteria 1471
330 Ga0207651_10521927 3300025960 Bacteria 1029
331 Ga0207712_10004045 3300025961 Bacteria 9264
332 Ga0207668_10003300 3300025972 Bacteria 9460
333 Ga0207668_10121195 3300025972 Bacteria 1981
334 Ga0207640_10003206 3300025981 Bacteria 8812
335 Ga0207640_10028151 3300025981 Bacteria 3432
336 Ga0207658_10015755 3300025986 Bacteria 5190
337 Ga0207703_10048272 3300026035 Bacteria 3436
338 Ga0207639_10022560 3300026041 Bacteria 4535
339 Ga0207678_10000987 3300026067 Bacteria 25938
340 Ga0207708_10000758 3300026075 Bacteria 24232
341 Ga0207708_10003362 3300026075 Bacteria 11803
342 Ga0207708_10030395 3300026075 Bacteria 4094
343 Ga0207708_10101490 3300026075 Bacteria 2227
344 Ga0207708_10133243 3300026075 Bacteria 1944
345 Ga0207641_10003842 3300026088 Bacteria 13149
346 Ga0207641_10182085 3300026088 Unclassified 1925
347 Ga0207641_10384869 3300026088 Bacteria 1344
348 Ga0207648_10008806 3300026089 Bacteria 9721
349 Ga0207676_10033369 3300026095 Bacteria 3888
350 Ga0207676_10242682 3300026095 Bacteria 1617
351 Ga0207674_10005874 3300026116 Bacteria 14552
352 Ga0207674_10157466 3300026116 Unclassified 2226
353 Ga0207675_100007687 3300026118 Bacteria 10171
354 Ga0207675_100375066 3300026118 Unclassified 1398
355 Ga0207683_10068216 3300026121 Bacteria 3139
356 Ga0207683_10069653 3300026121 Bacteria 3107
357 Ga0207683_10074739 3300026121 Unclassified 2999
358 Ga0207698_10232839 3300026142 Bacteria 1673
359 Ga0207428_10000505 3300027907 Bacteria 46673
360 Ga0207428_10020432 3300027907 Bacteria 5626
361 Ga0207428_10053711 3300027907 Bacteria 3212
362 Ga0207428_10074628 3300027907 Bacteria 2659
363 Ga0207428_10092099 3300027907 Bacteria 2353
364 Ga0207428_10221819 3300027907 Bacteria 1417
365 Ga0207428_10245494 3300027907 Bacteria 1336
366 Ga0268266_10064142 3300028379 Bacteria 3173
367 Ga0268266_10357527 3300028379 Bacteria 1373
368 Ga0268265_10024428 3300028380 Bacteria 4275
369 Ga0268264_10121161 3300028381 Bacteria 2305
370 Ga0265338_10098494 3300028800 Bacteria 2392
371 Ga0307408_100017088 3300031548 Bacteria 4853
372 Ga0307408_100282802 3300031548 Unclassified 1382
373 Ga0316576_10210967 3300031727 Bacteria 1462
374 Ga0307405_10003206 3300031731 Bacteria 7455
375 Ga0307405_10081511 3300031731 Bacteria 2115
376 Ga0307413_10051045 3300031824 Bacteria 2490
377 Ga0307410_10007991 3300031852 Bacteria 5833
378 Ga0307410_10033266 3300031852 Bacteria 3327
379 Ga0307410_10275257 3300031852 Bacteria 1318
380 Ga0307406_10002782 3300031901 Bacteria 9551
381 Ga0307412_10031719 3300031911 Bacteria 3340
382 Ga0307412_10384068 3300031911 Bacteria 1138
383 Ga0307409_100002160 3300031995 Bacteria 10138
384 Ga0307409_100231488 3300031995 Bacteria 1675
385 Ga0307416_100005138 3300032002 Bacteria 7994
386 Ga0307416_100162888 3300032002 Bacteria 2064
387 Ga0307414_10052115 3300032004 Bacteria 2846
388 Ga0307411_10016478 3300032005 Bacteria 4184
389 Ga0307411_10229640 3300032005 Bacteria 1445
390 Ga0307415_100003068 3300032126 Bacteria 8429
391 Ga0307415_100013061 3300032126 Bacteria 4832
392 Ga0316583_10002470 3300032133 Bacteria 6426
393 Ga0373957_0168005 3300035120 Bacteria 906
394 Ga0373937_0056737 3300036401 Bacteria 3597
395 Ga0316584_0206838 3300036712 Bacteria 1446
396 Ga0373925_0179224 3300037068 Bacteria 1676
397 Ga0373925_0248229 3300037068 Bacteria 1427
398 Ga0400487_65960 3300039110 Bacteria 2847
399 Ga0439460_0039426 3300042461 Bacteria 1381
400 Ga0451577_0000849 3300042876 Bacteria 45563
401 Ga0451577_0653241 3300042876 Unclassified 954
402 Ga0453684_0000481 3300044712 Bacteria 158570
403 Ga0451576_0124851 3300045051 Bacteria 2682
404 Ga0495603_0069637 3300046455 Bacteria 2069
405 Ga0495629_0002986 3300046459 Bacteria 12858
406 Ga0495629_0004941 3300046459 Bacteria 10000
407 Ga0495580_0032938 3300046472 Bacteria 3734
408 Ga0495594_0005323 3300046499 Bacteria 6609
409 Ga0495594_0117936 3300046499 Bacteria 1499
410 Ga0495594_0146438 3300046499 Unclassified 1340
411 Ga0495608_0172800 3300046511 Unclassified 1370
412 Ga0495628_0337063 3300046516 Bacteria 1111
413 Ga0495643_0001653 3300046522 Bacteria 19570
414 Ga0495642_0343249 3300046528 Unclassified 656
415 Ga0495598_0065394 3300046537 Bacteria 1132
416 Ga0495621_0004332 3300046539 Bacteria 3983
417 Ga0495621_0008267 3300046539 Bacteria 3113
418 Ga0495645_0117709 3300046543 Bacteria 1874
419 Ga0495622_0031305 3300046557 Bacteria 2487
420 Ga0495622_0142466 3300046557 Bacteria 1088
421 Ga0495588_0060812 3300046674 Bacteria 1955
422 Ga0495647_0030732 3300046681 Bacteria 1995
423 Ga0495613_0016626 3300046689 Bacteria 5476
424 Ga0495581_0061939 3300047315 Bacteria 2162
425 Ga0495604_0094438 3300047317 Bacteria 2211
426 Ga0495676_0085402 3300047321 Bacteria 2378
427 Ga0495684_0330045 3300047471 Bacteria 1088
428 Ga0495593_0014292 3300047673 Bacteria 4515
429 Ga0495614_0080235 3300048089 Bacteria 1413
430 Ga0496109_0152173 3300048912 Bacteria 2166
431 Ga0496109_0392578 3300048912 Unclassified 1311
432 Ga0496114_0501907 3300048917 Unclassified 1073
433 Ga0501298_024543 3300049521 Unclassified 1150
434 Ga0501299_009191 3300049522 Bacteria 1625
435 Ga0501034_0201921 3300049571 Bacteria 1946
436 Ga0501039_0021715 3300049575 Bacteria 4925
437 Ga0501039_0185997 3300049575 Bacteria 1634
438 Ga0501040_0057329 3300049576 Bacteria 2674
439 Ga0501041_0013871 3300049577 Bacteria 4777
440 Ga0501042_0044441 3300049578 Bacteria 3165
441 Ga0501046_0031111 3300049580 Unclassified 4330
442 Ga0501048_0077005 3300049582 Bacteria 2354
443 Ga0501067_0013905 3300049583 Bacteria 4457
444 Ga0501068_0089340 3300049584 Bacteria 1899
445 Ga0501069_0012306 3300049585 Bacteria 4548
446 Ga0501071_0022131 3300049587 Bacteria 4430
447 Ga0501073_0317665 3300049589 Unclassified 1075
448 Ga0501075_0025502 3300049591 Bacteria 4343
449 Ga0501076_0296767 3300049592 Bacteria 1325
450 Ga0501076_0365549 3300049592 Bacteria 1185
451 Ga0501077_0026263 3300049593 Bacteria 3696
452 Ga0501079_0203671 3300049741 Bacteria 1546
453 Ga0501081_0012171 3300049743 Bacteria 5643
454 Ga0501081_0379716 3300049743 Bacteria 1044
455 Ga0501283_009289 3300049779 Bacteria 1432
456 nmdc:mga00v17_346987_c1 3300050491 Bacteria 965
457 nmdc:mga0yw44_71581_c1 3300050492 Bacteria 2153
458 nmdc:mga05p37_102139_c1 3300050507 Bacteria 3531
459 nmdc:mga05p37_203706_c1 3300050507 Unclassified 2395
460 nmdc:mga05p37_216545_c1 3300050507 Unclassified 2313
461 nmdc:mga05p37_272787_c1 3300050507 Unclassified 2020
462 nmdc:mga05p37_403690_c1 3300050507 Bacteria 1595
463 nmdc:mga05p37_639686_c1 3300050507 Bacteria 1193
464 nmdc:mga05p37_84106_c1 3300050507 Bacteria 3920
465 nmdc:mga05p37_9713_c2 3300050507 Bacteria 4074
466 nmdc:mga09592_22596_c1 3300050508 Bacteria 5194
467 nmdc:mga09592_312449_c1 3300050508 Bacteria 1362
468 nmdc:mga0qj67_108519_c1 3300050509 Bacteria 2240
469 nmdc:mga0qj67_13999_c1 3300050509 Bacteria 6059
470 nmdc:mga0qj67_169040_c1 3300050509 Bacteria 1775
471 nmdc:mga0qj67_391871_c1 3300050509 Bacteria 1121
472 nmdc:mga0qj67_426267_c1 3300050509 Bacteria 1069
473 nmdc:mga0qj67_560579_c1 3300050509 Bacteria 916
474 nmdc:mga06r32_11940_c1 3300050510 Bacteria 7828
475 nmdc:mga06r32_2339_c1 3300050510 Bacteria 16994
476 nmdc:mga06r32_243746_c1 3300050510 Bacteria 1785
477 nmdc:mga06r32_333374_c1 3300050510 Bacteria 1502
478 nmdc:mga08y16_223591_c1 3300050511 Bacteria 1948
479 nmdc:mga08y16_23810_c1 3300050511 Bacteria 6466
480 nmdc:mga08y16_43243_c1 3300050511 Bacteria 4720
481 nmdc:mga08y16_48172_c1 3300050511 Bacteria 4460
482 nmdc:mga08y16_72822_c1 3300050511 Bacteria 3580
483 nmdc:mga08y16_82367_c2 3300050511 Bacteria 2165
484 nmdc:mga08y16_970_c1 3300050511 Bacteria 27909
485 nmdc:mga0n895_18641_c1 3300050512 Bacteria 6427
486 nmdc:mga0n895_37170_c1 3300050512 Bacteria 4709
487 nmdc:mga0n895_435225_c1 3300050512 Bacteria 1325
488 nmdc:mga0n895_6047_c1 3300050512 Bacteria 10205
489 nmdc:mga0n895_82324_c1 3300050512 Bacteria 3208
490 nmdc:mga0rr50_27447_c1 3300050513 Bacteria 3986
491 nmdc:mga0rr50_4326_c1 3300050513 Bacteria 8327
492 nmdc:mga0a205_1113_c1 3300050515 Bacteria 22246
493 nmdc:mga0a205_188775_c1 3300050515 Bacteria 1953
494 nmdc:mga0a205_329601_c1 3300050515 Unclassified 1396
495 Ga0495619_0003430 3300053085 Bacteria 10231
496 Ga0495619_0043967 3300053085 Unclassified 2930
497 Ga0501084_0109869 3300054114 Bacteria 2317
498 Ga0501084_0158737 3300054114 Bacteria 1908
499 Ga0501084_0354164 3300054114 Bacteria 1240
500 Ga0590071_000008 3300059421 Bacteria 54082
501 Ga0590071_000802 3300059421 Bacteria 8778
502 Ga0590074_001198 3300059423 Bacteria 4091
503 Ga0590074_026001 3300059423 Bacteria 1022
504 Ga0590077_000306 3300059426 Bacteria 13901
505 Ga0590077_006242 3300059426 Bacteria 2444
506 Ga0530510_0033842 3300061734 Bacteria 3679
507 Ga0530510_0143075 3300061734 Bacteria 1763
508 Ga0081539_10000012
509 JGI24750J21931_1013770
510 JGI25406J46586_10001234
511 JGI25406J46586_10004167
512 rootL2_10195292
513 Ga0065712_10034131
514 Ga0065715_10122967
515 Ga0065715_10420906
516 Ga0070658_10123375
517 Ga0070676_10006702
518 Ga0070676_10009696
519 Ga0070676_10221556
520 Ga0070683_100165179
521 Ga0070683_100493051
522 Ga0070683_100665052
523 Ga0070690_100000699
524 Ga0070690_100018411
525 Ga0070690_100019592
526 Ga0070690_100099915
527 Ga0070690_100179164
528 Ga0070670_100001479
529 Ga0070670_100173011
530 Ga0070677_10000288
531 Ga0068869_100009540
532 Ga0068869_100012302
533 Ga0068869_100026481
534 Ga0068869_100369758
535 Ga0070666_10001698
536 Ga0070666_10153648
537 Ga0070680_100024106
538 Ga0070680_100206504
539 Ga0070682_100002183
540 Ga0068868_100010496
541 Ga0068868_100021549
542 Ga0070660_100048572
543 Ga0070689_100002390
544 Ga0070689_100005165
545 Ga0070691_10001024
546 Ga0070687_100004163
547 Ga0070687_100007818
548 Ga0070687_100013052
549 Ga0070687_100079936
550 Ga0070661_100001516
551 Ga0070661_100002655
552 Ga0070661_100063727
553 Ga0070661_100168195
554 Ga0070661_100310096
555 Ga0070668_100005034
556 Ga0070669_100006556
557 Ga0070669_100079486
558 Ga0070675_100003428
559 Ga0070675_100012989
560 Ga0070675_100072105
561 Ga0070675_100223792
562 Ga0070671_100002370
563 Ga0070671_100004879
564 Ga0070671_100492298
565 Ga0070674_100165698
566 Ga0070673_100000236
567 Ga0070673_100011175
568 Ga0070673_100126014
569 Ga0070673_100148607
570 Ga0070688_100000996
571 Ga0070688_100002655
572 Ga0070688_100018958
573 Ga0070688_100103176
574 Ga0070688_100345716
575 Ga0070659_100007483
576 Ga0070667_100003269
577 Ga0070709_10016943
578 Ga0070714_100056549
579 Ga0070713_100055815
580 Ga0070710_10008516
581 Ga0070701_10005747
582 Ga0070701_10023751
583 Ga0070711_100002280
584 Ga0070705_100002565
585 Ga0070700_100003180
586 Ga0070700_100021736
587 Ga0070700_100241204
588 Ga0070694_100000700
589 Ga0070694_100300816
590 Ga0070663_100000375
591 Ga0070678_100308859
592 Ga0070662_100000335
593 Ga0070662_100045986
594 Ga0070662_100144324
595 Ga0068867_100005778
596 Ga0068867_100014254
597 Ga0070685_10008531
598 Ga0070707_100627641
599 Ga0070698_100011425
600 Ga0070698_100026579
601 Ga0070698_100532149
602 Ga0070699_100000388
603 Ga0070699_100016225
604 Ga0070699_100044770
605 Ga0070699_100517109
606 Ga0070679_100128851
607 Ga0070697_100028146
608 Ga0070697_100460863
609 Ga0068853_100014778
610 Ga0070672_100005088
611 Ga0070672_100008297
612 Ga0070672_100031492
613 Ga0070672_100054293
614 Ga0070672_100060436
615 Ga0070686_100002059
616 Ga0070686_100013914
617 Ga0070686_100063533
618 Ga0070686_100377028
619 Ga0070695_100009022
620 Ga0070696_100006015
621 Ga0070696_100008999
622 Ga0070696_100163163
623 Ga0070693_100004356
624 Ga0070665_100049391
625 Ga0070665_100173135
626 Ga0070704_100000645
627 Ga0068855_100012500
628 Ga0070664_100002958
629 Ga0070664_100008546
630 Ga0070664_100032704
631 Ga0070664_100056344
632 Ga0070664_100170454
633 Ga0068857_100007062
634 Ga0068857_100065525
635 Ga0068854_100009370
636 Ga0068854_100023091
637 Ga0070702_100002616
638 Ga0068852_100331895
639 Ga0068852_100651065
640 Ga0068859_100237303
641 Ga0068859_100418898
642 Ga0068864_100010408
643 Ga0068864_100125141
644 Ga0068864_100211850
645 Ga0068864_100260243
646 Ga0068861_100211470
647 Ga0068851_10194813
648 Ga0068851_10228164
649 Ga0068863_100010976
650 Ga0068863_100029211
651 Ga0068863_100030111
652 Ga0068863_100448385
653 Ga0068858_100029171
654 Ga0068860_100038327
655 Ga0068862_100042112
656 Ga0068862_100050523
657 Ga0068862_100259465
658 Ga0081539_10000277
659 Ga0081539_10001760
660 Ga0081539_10018849
661 Ga0075432_10005094
662 Ga0070715_10001050
663 Ga0070716_100002310
664 Ga0070712_100001380
665 Ga0097621_100021107
666 Ga0097621_100041936
667 Ga0097621_100355188
668 Ga0068871_100223660
669 Ga0075428_100017712
670 Ga0075428_100066445
671 Ga0075428_100173546
672 Ga0075428_100691244
673 Ga0075430_100001258
674 Ga0075430_100006676
675 Ga0075430_100187646
676 Ga0075431_100000096
677 Ga0075431_100003441
678 Ga0075431_100036581
679 Ga0075431_100040742
680 Ga0075431_100062530
681 Ga0075431_100466809
682 Ga0075431_100551499
683 Ga0075433_10000156
684 Ga0075433_10224563
685 Ga0075433_10477643
686 Ga0075434_100000285
687 Ga0075434_100000677
688 Ga0075434_100041026
689 Ga0075434_100157411
690 Ga0075434_100239517
691 Ga0075434_100753571
692 Ga0075429_100001155
693 Ga0075429_100029115
694 Ga0075429_100038867
695 Ga0068865_100076306
696 Ga0068865_100498253
697 Ga0075436_100035623
698 Ga0075436_100293667
699 Ga0097620_100237308
700 Ga0097620_100418896
701 Ga0075435_100008076
702 Ga0075435_100040116
703 Ga0075435_100062945
704 Ga0111539_10000163
705 Ga0111539_10001203
706 Ga0111539_10001782
707 Ga0111539_10006711
708 Ga0111539_10097629
709 Ga0111539_10358369
710 Ga0111539_10567220
711 Ga0111539_10632793
712 Ga0111539_11155780
713 Ga0105247_10000190
714 Ga0114129_10003505
715 Ga0114129_10004681
716 Ga0114129_10084295
717 Ga0114129_10104718
718 Ga0114129_10112368
719 Ga0114129_10476284
720 Ga0114129_10491878
721 Ga0114129_10648625
722 Ga0105243_10017979
723 Ga0105243_10071790
724 Ga0105242_10061124
725 Ga0105248_10013717
726 Ga0105248_10091598
727 Ga0105248_10904216
728 Ga0105238_10021306
729 Ga0105246_10059253
730 Ga0157374_10000859
731 Ga0157378_10465993
732 Ga0163162_10107681
733 Ga0157372_10176310
734 Ga0157375_10026255
735 Ga0157375_10214443
736 Ga0157375_10865443
737 Ga0163163_10019625
738 Ga0163163_10063333
739 Ga0163163_10329059
740 Ga0157380_10012231
741 Ga0157380_10333242
742 Ga0157377_10001303
743 Ga0157377_10095458
744 Ga0157377_10191086
745 Ga0157379_10006446
746 Ga0157376_10446154
747 Ga0163161_10020734
748 Ga0163161_10027947
749 Ga0207697_10000608
750 Ga0207656_10005533
751 Ga0207682_10002659
752 Ga0207682_10069593
753 Ga0207642_10131322
754 Ga0207688_10193870
755 Ga0207680_10006061
756 Ga0207680_10023553
757 Ga0207680_10097952
758 Ga0207680_10276399
759 Ga0207685_10094420
760 Ga0207699_10006208
761 Ga0207645_10006177
762 Ga0207645_10010442
763 Ga0207645_10086401
764 Ga0207643_10003089
765 Ga0207643_10008855
766 Ga0207643_10051681
767 Ga0207705_10098172
768 Ga0207695_10154620
769 Ga0207671_10022631
770 Ga0207693_10000404
771 Ga0207693_10097638
772 Ga0207663_10183210
773 Ga0207660_10010180
774 Ga0207660_10136978
775 Ga0207662_10004078
776 Ga0207662_10010011
777 Ga0207662_10013350
778 Ga0207657_10001543
779 Ga0207649_10005475
780 Ga0207649_10215159
781 Ga0207681_10020654
782 Ga0207681_10021995
783 Ga0207681_10026865
784 Ga0207681_10064412
785 Ga0207681_10127704
786 Ga0207694_10232793
787 Ga0207650_10001214
788 Ga0207650_10018649
789 Ga0207650_10104296
790 Ga0207659_10004992
791 Ga0207659_10082707
792 Ga0207659_10104807
793 Ga0207659_10141596
794 Ga0207659_10330373
795 Ga0207659_10342122
796 Ga0207687_10147384
797 Ga0207700_10215667
798 Ga0207700_10239197
799 Ga0207644_10028878
800 Ga0207644_10079648
801 Ga0207690_10015470
802 Ga0207690_10299474
803 Ga0207706_10001189
804 Ga0207706_10302487
805 Ga0207706_10417744
806 Ga0207706_10514560
807 Ga0207686_10012062
808 Ga0207709_10005688
809 Ga0207670_10002280
810 Ga0207670_10006151
811 Ga0207670_10096175
812 Ga0207669_10120276
813 Ga0207669_10264328
814 Ga0207704_10050970
815 Ga0207704_10111766
816 Ga0207704_10185788
817 Ga0207704_10292875
818 Ga0207665_10001635
819 Ga0207691_10033675
820 Ga0207691_10075994
821 Ga0207691_10173563
822 Ga0207711_10020877
823 Ga0207711_10186375
824 Ga0207689_10085536
825 Ga0207689_10142934
826 Ga0207689_10224743
827 Ga0207661_10259457
828 Ga0207661_10435792
829 Ga0207679_10008219
830 Ga0207679_10020323
831 Ga0207679_10020894
832 Ga0207667_10013475
833 Ga0207651_10006668
834 Ga0207651_10014298
835 Ga0207651_10077730
836 Ga0207651_10241948
837 Ga0207651_10521927
838 Ga0207712_10004045
839 Ga0207668_10003300
840 Ga0207668_10121195
841 Ga0207640_10003206
842 Ga0207640_10028151
843 Ga0207658_10015755
844 Ga0207703_10048272
845 Ga0207639_10022560
846 Ga0207678_10000987
847 Ga0207708_10000758
848 Ga0207708_10003362
849 Ga0207708_10030395
850 Ga0207708_10101490
851 Ga0207708_10133243
852 Ga0207641_10003842
853 Ga0207641_10182085
854 Ga0207641_10384869
855 Ga0207648_10008806
856 Ga0207676_10033369
857 Ga0207676_10242682
858 Ga0207674_10005874
859 Ga0207674_10157466
860 Ga0207675_100007687
861 Ga0207675_100375066
862 Ga0207683_10068216
863 Ga0207683_10069653
864 Ga0207683_10074739
865 Ga0207698_10232839
866 Ga0207428_10000505
867 Ga0207428_10020432
868 Ga0207428_10053711
869 Ga0207428_10074628
870 Ga0207428_10092099
871 Ga0207428_10221819
872 Ga0207428_10245494
873 Ga0268266_10064142
874 Ga0268266_10357527
875 Ga0268265_10024428
876 Ga0268264_10121161
877 Ga0265338_10098494
878 Ga0307408_100017088
879 Ga0307408_100282802
880 Ga0316576_10210967
881 Ga0307405_10003206
882 Ga0307405_10081511
883 Ga0307413_10051045
884 Ga0307410_10007991
885 Ga0307410_10033266
886 Ga0307410_10275257
887 Ga0307406_10002782
888 Ga0307412_10031719
889 Ga0307412_10384068
890 Ga0307409_100002160
891 Ga0307409_100231488
892 Ga0307416_100005138
893 Ga0307416_100162888
894 Ga0307414_10052115
895 Ga0307411_10016478
896 Ga0307411_10229640
897 Ga0307415_100003068
898 Ga0307415_100013061
899 Ga0316583_10002470
900 Ga0373957_0168005
901 Ga0373937_0056737
902 Ga0316584_0206838
903 Ga0373925_0179224
904 Ga0373925_0248229
905 Ga0400487_65960
906 Ga0439460_0039426
907 Ga0451577_0000849
908 Ga0451577_0653241
909 Ga0453684_0000481
910 Ga0451576_0124851
911 Ga0495603_0069637
912 Ga0495629_0002986
913 Ga0495629_0004941
914 Ga0495580_0032938
915 Ga0495594_0005323
916 Ga0495594_0117936
917 Ga0495594_0146438
918 Ga0495608_0172800
919 Ga0495628_0337063
920 Ga0495643_0001653
921 Ga0495642_0343249
922 Ga0495598_0065394
923 Ga0495621_0004332
924 Ga0495621_0008267
925 Ga0495645_0117709
926 Ga0495622_0031305
927 Ga0495622_0142466
928 Ga0495588_0060812
929 Ga0495647_0030732
930 Ga0495613_0016626
931 Ga0495581_0061939
932 Ga0495604_0094438
933 Ga0495676_0085402
934 Ga0495684_0330045
935 Ga0495593_0014292
936 Ga0495614_0080235
937 Ga0496109_0152173
938 Ga0496109_0392578
939 Ga0496114_0501907
940 Ga0501298_024543
941 Ga0501299_009191
942 Ga0501034_0201921
943 Ga0501039_0021715
944 Ga0501039_0185997
945 Ga0501040_0057329
946 Ga0501041_0013871
947 Ga0501042_0044441
948 Ga0501046_0031111
949 Ga0501048_0077005
950 Ga0501067_0013905
951 Ga0501068_0089340
952 Ga0501069_0012306
953 Ga0501071_0022131
954 Ga0501073_0317665
955 Ga0501075_0025502
956 Ga0501076_0296767
957 Ga0501076_0365549
958 Ga0501077_0026263
959 Ga0501079_0203671
960 Ga0501081_0012171
961 Ga0501081_0379716
962 Ga0501283_009289
963 nmdc:mga00v17_346987_c1
964 nmdc:mga0yw44_71581_c1
965 nmdc:mga05p37_102139_c1
966 nmdc:mga05p37_203706_c1
967 nmdc:mga05p37_216545_c1
968 nmdc:mga05p37_272787_c1
969 nmdc:mga05p37_403690_c1
970 nmdc:mga05p37_639686_c1
971 nmdc:mga05p37_84106_c1
972 nmdc:mga05p37_9713_c2
973 nmdc:mga09592_22596_c1
974 nmdc:mga09592_312449_c1
975 nmdc:mga0qj67_108519_c1
976 nmdc:mga0qj67_13999_c1
977 nmdc:mga0qj67_169040_c1
978 nmdc:mga0qj67_391871_c1
979 nmdc:mga0qj67_426267_c1
980 nmdc:mga0qj67_560579_c1
981 nmdc:mga06r32_11940_c1
982 nmdc:mga06r32_2339_c1
983 nmdc:mga06r32_243746_c1
984 nmdc:mga06r32_333374_c1
985 nmdc:mga08y16_223591_c1
986 nmdc:mga08y16_23810_c1
987 nmdc:mga08y16_43243_c1
988 nmdc:mga08y16_48172_c1
989 nmdc:mga08y16_72822_c1
990 nmdc:mga08y16_82367_c2
991 nmdc:mga08y16_970_c1
992 nmdc:mga0n895_18641_c1
993 nmdc:mga0n895_37170_c1
994 nmdc:mga0n895_435225_c1
995 nmdc:mga0n895_6047_c1
996 nmdc:mga0n895_82324_c1
997 nmdc:mga0rr50_27447_c1
998 nmdc:mga0rr50_4326_c1
999 nmdc:mga0a205_1113_c1
1000 nmdc:mga0a205_188775_c1
1001 nmdc:mga0a205_329601_c1
1002 Ga0495619_0003430
1003 Ga0495619_0043967
1004 Ga0501084_0109869
1005 Ga0501084_0158737
1006 Ga0501084_0354164
1007 Ga0590071_000008
1008 Ga0590071_000802
1009 Ga0590074_001198
1010 Ga0590074_026001
1011 Ga0590077_000306
1012 Ga0590077_006242
1013 Ga0530510_0033842
1014 Ga0530510_0143075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02348

CTP_transf_3

Cytidylyltransferase

32

157

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifd-assembly1.cif.gz_A crystal structure of cmp-n-acetylneuraminate synthetase from vibrio cholerae in complex with cdp and mg2+. 0.9149 3 231
6ifd-assembly1.cif.gz_A crystal structure of cmp-n-acetylneuraminate synthetase from vibrio cholerae in complex with cdp and mg2+. 0.9029 3 231
6ifd-assembly2.cif.gz_C crystal structure of cmp-n-acetylneuraminate synthetase from vibrio cholerae in complex with cdp and mg2+. 0.8844 3 229
1eyr-assembly1.cif.gz_B structure of a sialic acid activating synthetase, cmp acylneuraminate synthetase in the presence and absence of cdp 0.875 1 229
1ezi-assembly1.cif.gz_A structure of a sialic acid activating synthetase, cmp acylneuraminate synthetase in the presence and absence of cdp 0.865 1 231
ID Description Score Start End Superfamily
6ckkA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8536 1 232 3.90.550.10
af_A0A2R8RQE4_29_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8471 4 126 3.90.550.10
af_H9BFW7_23_246_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8437 5 233 3.90.550.10
6ckkA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8435 1 232 3.90.550.10
af_H9BFW7_23_246_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8159 5 233 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C1MK38-F1-model_v4 Acylneuraminate cytidylyltransferase family protein 0.9886 23 247 GO:0008781
AF-X1CDJ0-F1-model_v4 Acylneuraminate cytidylyltransferase 0.9879 3 126 GO:0008781
AF-A0A3M1FYK3-F1-model_v4 Acylneuraminate cytidylyltransferase family protein 0.984 2 114 GO:0008781
AF-A0A382MMD9-F1-model_v4 Acylneuraminate cytidylyltransferase family protein 0.9837 6 130 GO:0008781
AF-A0A382XEX9-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9805 3 129 GO:0008781

Map