F456646

General Info

Members Datasets Scaffolds Average Seq Length
507 292 1014 258

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100176167|Ga0070711_1001761672
Length 284
Sequence MSSAHARQTNAPTSVSRHHRGMQQIHELADTGYPSVLVPVDHVEPVPRRIRARLAGEVVLDTTRALYVWEWPAYPQYYVPLDDVRRELLDPEGRTQASSRGKVELYALSVGDVTRPHAAKVLEDSPLERLSGTVRFDWGSLDAWFEEDEQVFVHPRSPYARVDAIRSTRHVRVELEGVLLGESSSPVLLFETGLPTRYYLNRTEVSFDQLIPTSTVTACPYKGITSAYWSARVGQTLHADIAWAYDFPSAAMLPIAGLVAFYNERVDLSVDGRRLRRPTTHFSS

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 2.76
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 5.13
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100176167 3300005439 Bacteria 1634
2 JGI25404J52841_10004542 3300003659 Bacteria 2820
3 Ga0058862_12719070 3300004803 Bacteria 1084
4 Ga0070683_100153185 3300005329 Bacteria 2186
5 Ga0070683_100265620 3300005329 Bacteria 1632
6 Ga0070690_100125955 3300005330 Bacteria 1725
7 Ga0070666_10006220 3300005335 Bacteria 7343
8 Ga0070680_100077964 3300005336 Bacteria 2729
9 Ga0070680_100172457 3300005336 Bacteria 1821
10 Ga0070682_100211515 3300005337 Bacteria 1374
11 Ga0070660_100095004 3300005339 Bacteria 2356
12 Ga0070691_10132216 3300005341 Bacteria 1265
13 Ga0070661_100108273 3300005344 Bacteria 2073
14 Ga0070671_100451818 3300005355 Bacteria 1102
15 Ga0070673_100298385 3300005364 Bacteria 1418
16 Ga0070688_100446969 3300005365 Bacteria 966
17 Ga0070667_100083950 3300005367 Bacteria 2729
18 Ga0070709_10022014 3300005434 Bacteria 3722
19 Ga0070709_10049805 3300005434 Bacteria 2621
20 Ga0070709_10358151 3300005434 Bacteria 1080
21 Ga0070714_100009373 3300005435 Bacteria 7691
22 Ga0070714_100013161 3300005435 Bacteria 6624
23 Ga0070714_100034499 3300005435 Bacteria 4237
24 Ga0070714_100073459 3300005435 Bacteria 2963
25 Ga0070714_100169972 3300005435 Bacteria 1978
26 Ga0070714_100228990 3300005435 Bacteria 1711
27 Ga0070713_100013119 3300005436 Bacteria 6107
28 Ga0070713_100019721 3300005436 Bacteria 5157
29 Ga0070713_100046395 3300005436 Bacteria 3565
30 Ga0070713_100325460 3300005436 Bacteria 1420
31 Ga0070710_10012883 3300005437 Bacteria 4167
32 Ga0070710_10018272 3300005437 Bacteria 3605
33 Ga0070710_10192438 3300005437 Bacteria 1283
34 Ga0070711_100104870 3300005439 Bacteria 2063
35 Ga0070705_100247427 3300005440 Bacteria 1249
36 Ga0070694_100107271 3300005444 Bacteria 1985
37 Ga0070708_100003961 3300005445 Bacteria 11623
38 Ga0070708_100007136 3300005445 Bacteria 8915
39 Ga0070708_100012479 3300005445 Bacteria 6935
40 Ga0070708_100059344 3300005445 Bacteria 3411
41 Ga0070708_100359669 3300005445 Bacteria 1372
42 Ga0070678_100212837 3300005456 Bacteria 1602
43 Ga0070662_100195791 3300005457 Bacteria 1601
44 Ga0070681_10213546 3300005458 Bacteria 1845
45 Ga0070685_10107703 3300005466 Bacteria 1712
46 Ga0070706_100004725 3300005467 Bacteria 13057
47 Ga0070706_100016946 3300005467 Bacteria 6731
48 Ga0070706_100023410 3300005467 Bacteria 5688
49 Ga0070706_100069895 3300005467 Bacteria 3247
50 Ga0070706_100083330 3300005467 Bacteria 2962
51 Ga0070706_100300220 3300005467 Bacteria 1498
52 Ga0070707_100045179 3300005468 Bacteria 4216
53 Ga0070707_100102598 3300005468 Bacteria 2772
54 Ga0070698_100001571 3300005471 Bacteria 25365
55 Ga0070698_100051723 3300005471 Bacteria 4183
56 Ga0070698_100087529 3300005471 Bacteria 3101
57 Ga0070698_100089634 3300005471 Bacteria 3059
58 Ga0070698_100112873 3300005471 Bacteria 2682
59 Ga0070698_100173159 3300005471 Bacteria 2098
60 Ga0070698_100195872 3300005471 Bacteria 1957
61 Ga0070699_100004502 3300005518 Bacteria 12331
62 Ga0070679_100009825 3300005530 Bacteria 9051
63 Ga0070679_100166604 3300005530 Bacteria 2177
64 Ga0068853_100236546 3300005539 Bacteria 1672
65 Ga0070672_100130615 3300005543 Bacteria 2063
66 Ga0070686_100172342 3300005544 Bacteria 1531
67 Ga0070696_100322276 3300005546 Bacteria 1189
68 Ga0070693_100061753 3300005547 Bacteria 2179
69 Ga0070665_100258878 3300005548 Bacteria 1741
70 Ga0070704_100053984 3300005549 Bacteria 2842
71 Ga0068855_100002975 3300005563 Bacteria 20707
72 Ga0070664_100137728 3300005564 Bacteria 2148
73 Ga0068857_100598059 3300005577 Bacteria 1042
74 Ga0068856_100587671 3300005614 Bacteria 1135
75 Ga0068852_100205731 3300005616 Bacteria 1864
76 Ga0068864_100058642 3300005618 Bacteria 3328
77 Ga0068863_100147806 3300005841 Bacteria 2248
78 Ga0068858_100000135 3300005842 Bacteria 77565
79 Ga0068858_100351160 3300005842 Bacteria 1412
80 Ga0068860_100040654 3300005843 Bacteria 4444
81 Ga0068862_100353697 3300005844 Bacteria 1364
82 Ga0081455_10050367 3300005937 Bacteria 3582
83 Ga0081540_1000125 3300005983 Bacteria 81285
84 Ga0070717_10010655 3300006028 Bacteria 6949
85 Ga0070717_10069061 3300006028 Bacteria 2941
86 Ga0070717_10134230 3300006028 Bacteria 2130
87 Ga0070717_10143964 3300006028 Bacteria 2058
88 Ga0070717_10175123 3300006028 Bacteria 1867
89 Ga0070717_10310391 3300006028 Bacteria 1403
90 Ga0075364_10056248 3300006051 Bacteria 2575
91 Ga0070715_10101485 3300006163 Bacteria 1342
92 Ga0070716_100017706 3300006173 Bacteria 3699
93 Ga0070716_100022272 3300006173 Bacteria 3347
94 Ga0070716_100023840 3300006173 Bacteria 3252
95 Ga0070712_100001693 3300006175 Bacteria 13517
96 Ga0070712_100007784 3300006175 Bacteria 6706
97 Ga0070712_100014102 3300006175 Bacteria 5125
98 Ga0070712_100017647 3300006175 Bacteria 4622
99 Ga0070712_100033297 3300006175 Bacteria 3486
100 Ga0070712_100089802 3300006175 Bacteria 2248
101 Ga0070712_100097139 3300006175 Bacteria 2170
102 Ga0070712_100396217 3300006175 Bacteria 1139
103 Ga0068871_100050887 3300006358 Bacteria 3352
104 Ga0075433_10419697 3300006852 Bacteria 1180
105 Ga0105251_10039193 3300009011 Bacteria 2316
106 Ga0105240_10149503 3300009093 Bacteria 2783
107 Ga0105245_10467596 3300009098 Bacteria 1272
108 Ga0105247_10002626 3300009101 Bacteria 12136
109 Ga0105247_10278849 3300009101 Bacteria 1152
110 Ga0105241_10193014 3300009174 Bacteria 1696
111 Ga0105242_10377665 3300009176 Bacteria 1316
112 Ga0105242_10439961 3300009176 Bacteria 1226
113 Ga0105237_10221306 3300009545 Bacteria 1893
114 Ga0105237_10223274 3300009545 Bacteria 1884
115 Ga0105238_10457097 3300009551 Bacteria 1274
116 Ga0105249_10203798 3300009553 Bacteria 1937
117 Ga0105249_10282695 3300009553 Bacteria 1658
118 Ga0099796_10086278 3300010159 Bacteria 1160
119 Ga0105239_10179125 3300010375 Bacteria 2371
120 Ga0105239_10714631 3300010375 Bacteria 1146
121 Ga0105246_10136606 3300011119 Bacteria 1838
122 Ga0157324_1005356 3300012506 Bacteria 926
123 Ga0157371_10217725 3300013102 Bacteria 1371
124 Ga0157370_10062548 3300013104 Bacteria 3529
125 Ga0157370_10146106 3300013104 Bacteria 2202
126 Ga0157369_10043738 3300013105 Bacteria 4880
127 Ga0157374_10169322 3300013296 Bacteria 2130
128 Ga0163162_10289607 3300013306 Bacteria 1770
129 Ga0157372_10265756 3300013307 Bacteria 1992
130 Ga0163163_10065881 3300014325 Bacteria 3597
131 Ga0182008_10035080 3300014497 Bacteria 2514
132 Ga0157379_10000224 3300014968 Bacteria 44353
133 Ga0157379_10170306 3300014968 Bacteria 1966
134 Ga0206356_11641219 3300020070 Bacteria 911
135 Ga0206349_1012063 3300020075 Bacteria 846
136 Ga0206351_10072615 3300020077 Bacteria 936
137 Ga0206350_10003295 3300020080 Bacteria 1301
138 Ga0206354_10575515 3300020081 Bacteria 980
139 Ga0206354_10953936 3300020081 Bacteria 1515
140 Ga0206353_10765686 3300020082 Bacteria 1079
141 Ga0154015_1263636 3300020610 Bacteria 1399
142 Ga0224712_10050469 3300022467 Bacteria 1616
143 Ga0224712_10079971 3300022467 Bacteria 1347
144 Ga0224712_10105620 3300022467 Bacteria 1201
145 Ga0207713_1052478 3300025735 Bacteria 1613
146 Ga0207653_10019001 3300025885 Bacteria 2166
147 Ga0207692_10081221 3300025898 Bacteria 1734
148 Ga0207710_10000012 3300025900 Bacteria 409603
149 Ga0207710_10083692 3300025900 Bacteria 1484
150 Ga0207688_10006647 3300025901 Bacteria 6291
151 Ga0207680_10008912 3300025903 Bacteria 4947
152 Ga0207680_10046008 3300025903 Bacteria 2577
153 Ga0207647_10118272 3300025904 Bacteria 1564
154 Ga0207685_10016723 3300025905 Bacteria 2354
155 Ga0207699_10015012 3300025906 Bacteria 4013
156 Ga0207699_10032433 3300025906 Bacteria 2943
157 Ga0207699_10054095 3300025906 Bacteria 2383
158 Ga0207699_10104891 3300025906 Bacteria 1801
159 Ga0207645_10225154 3300025907 Bacteria 1237
160 Ga0207643_10109869 3300025908 Bacteria 1624
161 Ga0207684_10039503 3300025910 Bacteria 4003
162 Ga0207684_10052693 3300025910 Bacteria 3453
163 Ga0207684_10090980 3300025910 Bacteria 2600
164 Ga0207684_10129556 3300025910 Bacteria 2165
165 Ga0207654_10019266 3300025911 Bacteria 3599
166 Ga0207707_10002557 3300025912 Bacteria 16319
167 Ga0207707_10149270 3300025912 Bacteria 2044
168 Ga0207671_10521505 3300025914 Bacteria 947
169 Ga0207693_10007204 3300025915 Bacteria 9157
170 Ga0207693_10012670 3300025915 Bacteria 6810
171 Ga0207693_10013381 3300025915 Bacteria 6615
172 Ga0207693_10017364 3300025915 Bacteria 5739
173 Ga0207693_10087497 3300025915 Bacteria 2441
174 Ga0207693_10174467 3300025915 Bacteria 1692
175 Ga0207693_10233088 3300025915 Bacteria 1446
176 Ga0207693_10334874 3300025915 Bacteria 1185
177 Ga0207663_10060457 3300025916 Bacteria 2401
178 Ga0207663_10062377 3300025916 Bacteria 2369
179 Ga0207663_10093380 3300025916 Bacteria 2002
180 Ga0207663_10119199 3300025916 Bacteria 1804
181 Ga0207663_10128930 3300025916 Bacteria 1744
182 Ga0207663_10168289 3300025916 Bacteria 1554
183 Ga0207660_10019981 3300025917 Bacteria 4488
184 Ga0207662_10175210 3300025918 Bacteria 1377
185 Ga0207657_10097487 3300025919 Bacteria 2444
186 Ga0207652_10007631 3300025921 Bacteria 8705
187 Ga0207652_10087985 3300025921 Bacteria 2724
188 Ga0207646_10045373 3300025922 Bacteria 3945
189 Ga0207646_10168059 3300025922 Bacteria 1980
190 Ga0207694_10120886 3300025924 Bacteria 2091
191 Ga0207700_10027427 3300025928 Bacteria 3988
192 Ga0207700_10033719 3300025928 Bacteria 3666
193 Ga0207700_10045533 3300025928 Bacteria 3238
194 Ga0207700_10065838 3300025928 Bacteria 2766
195 Ga0207700_10117606 3300025928 Bacteria 2150
196 Ga0207700_10147929 3300025928 Bacteria 1938
197 Ga0207700_10761673 3300025928 Bacteria 865
198 Ga0207664_10011288 3300025929 Bacteria 6338
199 Ga0207664_10020183 3300025929 Bacteria 4935
200 Ga0207664_10035758 3300025929 Bacteria 3834
201 Ga0207664_10036427 3300025929 Bacteria 3803
202 Ga0207664_10047517 3300025929 Bacteria 3372
203 Ga0207664_10057443 3300025929 Bacteria 3093
204 Ga0207664_10083290 3300025929 Bacteria 2607
205 Ga0207664_10247833 3300025929 Bacteria 1553
206 Ga0207690_10183800 3300025932 Bacteria 1576
207 Ga0207686_10214426 3300025934 Bacteria 1386
208 Ga0207709_10179807 3300025935 Bacteria 1493
209 Ga0207665_10019254 3300025939 Bacteria 4486
210 Ga0207665_10033030 3300025939 Bacteria 3428
211 Ga0207665_10205785 3300025939 Bacteria 1436
212 Ga0207691_10107742 3300025940 Bacteria 2480
213 Ga0207689_10008862 3300025942 Bacteria 8731
214 Ga0207661_10068560 3300025944 Bacteria 2889
215 Ga0207661_10164378 3300025944 Bacteria 1927
216 Ga0207667_10152717 3300025949 Unclassified 2376
217 Ga0207667_10216553 3300025949 Bacteria 1962
218 Ga0207651_10262799 3300025960 Bacteria 1418
219 Ga0207668_10121490 3300025972 Bacteria 1979
220 Ga0207640_10231741 3300025981 Bacteria 1421
221 Ga0207658_10068820 3300025986 Bacteria 2672
222 Ga0207703_10000014 3300026035 Bacteria 304317
223 Ga0207703_10133415 3300026035 Bacteria 2147
224 Ga0207678_10006693 3300026067 Bacteria 10219
225 Ga0207708_10183698 3300026075 Bacteria 1661
226 Ga0207702_10141107 3300026078 Bacteria 2180
227 Ga0207702_10147836 3300026078 Bacteria 2134
228 Ga0207702_10255037 3300026078 Bacteria 1649
229 Ga0207702_10517469 3300026078 Bacteria 1165
230 Ga0207641_10285234 3300026088 Bacteria 1554
231 Ga0207674_10062246 3300026116 Bacteria 3769
232 Ga0207675_100115959 3300026118 Bacteria 2531
233 Ga0207683_10000264 3300026121 Bacteria 46774
234 Ga0268266_10000216 3300028379 Bacteria 100792
235 Ga0268266_10197322 3300028379 Bacteria 1840
236 Ga0265337_1007718 3300028556 Bacteria 3992
237 Ga0265319_1016793 3300028563 Bacteria 2800
238 Ga0265334_10001506 3300028573 Bacteria 11252
239 Ga0265318_10025315 3300028577 Bacteria 2344
240 Ga0265336_10004056 3300028666 Bacteria 5580
241 Ga0265336_10021062 3300028666 Bacteria 2086
242 Ga0265338_10007855 3300028800 Bacteria 13100
243 Ga0265338_10022415 3300028800 Bacteria 6538
244 Ga0265324_10009232 3300029957 Bacteria 3859
245 Ga0265760_10040394 3300031090 Bacteria 1390
246 Ga0265760_10087698 3300031090 Bacteria 971
247 Ga0265332_10001378 3300031238 Bacteria 13733
248 Ga0265320_10007038 3300031240 Bacteria 7011
249 Ga0265325_10005691 3300031241 Bacteria 7661
250 Ga0265340_10000670 3300031247 Bacteria 19184
251 Ga0265339_10107972 3300031249 Bacteria 1443
252 Ga0265316_10004139 3300031344 Bacteria 14517
253 Ga0265314_10077503 3300031711 Bacteria 2204
254 Ga0265342_10004014 3300031712 Bacteria 11763
255 Ga0373959_0007729 3300034820 Bacteria 1813
256 Ga0373938_0030452 3300034957 Bacteria 1152
257 Ga0373926_0000821 3300035083 Bacteria 8810
258 Ga0373926_0022013 3300035083 Bacteria 2210
259 Ga0373926_0137867 3300035083 Bacteria 926
260 Ga0373929_0060937 3300035085 Bacteria 883
261 Ga0373934_0055657 3300035086 Bacteria 1572
262 Ga0373940_0035692 3300035088 Bacteria 1347
263 Ga0373944_0001322 3300035089 Bacteria 6234
264 Ga0373944_0017442 3300035089 Bacteria 2038
265 Ga0373923_0015442 3300035111 Bacteria 2883
266 Ga0373936_0000622 3300035113 Bacteria 12236
267 Ga0373936_0014050 3300035113 Bacteria 3058
268 Ga0373941_0065315 3300035115 Bacteria 1194
269 Ga0373945_0000479 3300035116 Bacteria 11324
270 Ga0373945_0001894 3300035116 Bacteria 6488
271 Ga0373956_0016154 3300035119 Bacteria 3132
272 Ga0373943_0004598 3300035170 Bacteria 6237
273 Ga0373943_0029694 3300035170 Bacteria 2583
274 Ga0373946_0001148 3300035171 Bacteria 9158
275 Ga0373946_0003984 3300035171 Bacteria 5252
276 Ga0373955_0052103 3300035172 Bacteria 2231
277 Ga0373942_0000701 3300035207 Bacteria 9292
278 Ga0373942_0026831 3300035207 Bacteria 1494
279 Ga0373924_0002131 3300035410 Bacteria 6620
280 Ga0373924_0017187 3300035410 Bacteria 2771
281 Ga0373935_0002189 3300035692 Bacteria 11104
282 Ga0373927_0002362 3300035695 Bacteria 13747
283 Ga0373927_0007260 3300035695 Bacteria 7517
284 Ga0373933_0048273 3300035724 Bacteria 2534
285 Ga0373947_0001136 3300035725 Bacteria 16362
286 Ga0373947_0004078 3300035725 Bacteria 8598
287 Ga0373937_0009327 3300036401 Bacteria 8522
288 Ga0373937_0146221 3300036401 Bacteria 2212
289 Ga0373925_0026882 3300037068 Bacteria 4212
290 Ga0373925_0032128 3300037068 Bacteria 3861
291 Ga0436364_0303804 3300037853 Bacteria 3210
292 Ga0436364_0959203 3300037853 Bacteria 4157
293 Ga0436365_1044940 3300039437 Bacteria 1450
294 Ga0436360_1181608 3300039438 Bacteria 916
295 Ga0436363_1344434 3300039450 Bacteria 1216
296 Ga0466969_0001421 3300044656 Bacteria 12919
297 Ga0466972_0033698 3300044658 Bacteria 2512
298 Ga0466966_0005270 3300044684 Bacteria 8501
299 Ga0466961_0024518 3300044693 Bacteria 3880
300 Ga0466961_0137374 3300044693 Bacteria 1531
301 Ga0466963_0057746 3300044694 Bacteria 2585
302 Ga0466971_0000711 3300044719 Bacteria 13310
303 Ga0466970_0090800 3300044765 Bacteria 1657
304 Ga0466957_0244363 3300044842 Bacteria 1192
305 Ga0466960_0014572 3300044901 Bacteria 3371
306 Ga0466959_0083981 3300045049 Bacteria 2292
307 Ga0466959_0290261 3300045049 Bacteria 1121
308 Ga0466958_0023753 3300045836 Bacteria 3602
309 Ga0466967_0022922 3300045976 Bacteria 5106
310 Ga0466967_0181937 3300045976 Bacteria 1983
311 Ga0495592_0019335 3300046454 Bacteria 5181
312 Ga0495603_0004818 3300046455 Bacteria 8066
313 Ga0495629_0001818 3300046459 Bacteria 16717
314 Ga0495629_0416277 3300046459 Bacteria 912
315 Ga0495641_0006334 3300046461 Bacteria 7691
316 Ga0495641_0061901 3300046461 Bacteria 1688
317 Ga0495651_0019697 3300046462 Bacteria 5229
318 Ga0495651_0020122 3300046462 Bacteria 5179
319 Ga0495653_0015768 3300046463 Bacteria 6160
320 Ga0495653_0025927 3300046463 Bacteria 4704
321 Ga0495653_0067530 3300046463 Bacteria 2685
322 Ga0495653_0175622 3300046463 Bacteria 1474
323 Ga0495580_0043245 3300046472 Bacteria 3206
324 Ga0495582_0004501 3300046473 Bacteria 7834
325 Ga0495639_0003236 3300046475 Bacteria 7075
326 Ga0495664_0008021 3300046477 Bacteria 5879
327 Ga0495664_0010487 3300046477 Bacteria 5198
328 Ga0495664_0030248 3300046477 Bacteria 3171
329 Ga0495664_0184064 3300046477 Bacteria 1266
330 Ga0495594_0081477 3300046499 Bacteria 1807
331 Ga0495608_0013657 3300046511 Bacteria 5635
332 Ga0495608_0218621 3300046511 Bacteria 1196
333 Ga0495618_0007117 3300046514 Bacteria 6765
334 Ga0495618_0009801 3300046514 Bacteria 5792
335 Ga0495618_0068298 3300046514 Bacteria 2260
336 Ga0495628_0026908 3300046516 Bacteria 4682
337 Ga0495628_0115144 3300046516 Bacteria 2065
338 Ga0495628_0242914 3300046516 Bacteria 1346
339 Ga0495630_0029287 3300046517 Bacteria 4092
340 Ga0495630_0032007 3300046517 Bacteria 3917
341 Ga0495630_0096118 3300046517 Bacteria 2240
342 Ga0495630_0155629 3300046517 Bacteria 1740
343 Ga0495666_0007776 3300046526 Bacteria 5366
344 Ga0495652_0004525 3300046529 Bacteria 13264
345 Ga0495652_0048771 3300046529 Bacteria 3627
346 Ga0495652_0192905 3300046529 Bacteria 1553
347 Ga0495652_0226655 3300046529 Bacteria 1400
348 Ga0495652_0274140 3300046529 Bacteria 1238
349 Ga0495665_0001473 3300046531 Bacteria 12625
350 Ga0495640_0040741 3300046533 Bacteria 3250
351 Ga0495586_0001203 3300046535 Bacteria 14544
352 Ga0495587_0030709 3300046536 Bacteria 3258
353 Ga0495645_0018310 3300046543 Bacteria 5029
354 Ga0495645_0042468 3300046543 Bacteria 3315
355 Ga0495645_0074138 3300046543 Bacteria 2451
356 Ga0495645_0194442 3300046543 Bacteria 1380
357 Ga0495667_0002045 3300046559 Bacteria 13380
358 Ga0495667_0010387 3300046559 Bacteria 6301
359 Ga0495667_0049322 3300046559 Bacteria 2779
360 Ga0495667_0051280 3300046559 Bacteria 2722
361 Ga0495667_0074893 3300046559 Bacteria 2203
362 Ga0495634_0053006 3300046642 Bacteria 2718
363 Ga0495634_0163819 3300046642 Bacteria 1400
364 Ga0495634_0242843 3300046642 Bacteria 1104
365 Ga0495635_0002968 3300046663 Bacteria 11639
366 Ga0495635_0049810 3300046663 Bacteria 2887
367 Ga0495635_0078533 3300046663 Bacteria 2260
368 Ga0495635_0168773 3300046663 Bacteria 1488
369 Ga0495588_0092324 3300046674 Bacteria 1586
370 Ga0495657_0169238 3300046675 Bacteria 1346
371 Ga0495657_0213738 3300046675 Bacteria 1171
372 Ga0495599_0060347 3300046678 Bacteria 2371
373 Ga0495599_0062948 3300046678 Bacteria 2317
374 Ga0495599_0167308 3300046678 Bacteria 1357
375 Ga0495623_0038456 3300046679 Bacteria 3059
376 Ga0495623_0041021 3300046679 Bacteria 2953
377 Ga0495623_0079156 3300046679 Bacteria 2037
378 Ga0495646_0003859 3300046680 Bacteria 9370
379 Ga0495646_0154787 3300046680 Bacteria 1272
380 Ga0495646_0261748 3300046680 Bacteria 924
381 Ga0495647_0036537 3300046681 Bacteria 1849
382 Ga0495613_0004387 3300046689 Bacteria 10558
383 Ga0495624_0000938 3300046690 Bacteria 23002
384 Ga0495624_0001819 3300046690 Bacteria 16282
385 Ga0495600_0022947 3300046809 Bacteria 4012
386 Ga0495600_0029721 3300046809 Bacteria 3538
387 Ga0495600_0034404 3300046809 Bacteria 3289
388 Ga0495600_0058630 3300046809 Bacteria 2515
389 Ga0495600_0137536 3300046809 Bacteria 1586
390 Ga0495581_0000844 3300047315 Bacteria 16332
391 Ga0495604_0070539 3300047317 Bacteria 2645
392 Ga0495674_0082878 3300047319 Bacteria 2749
393 Ga0495674_0087708 3300047319 Bacteria 2662
394 Ga0495674_0087774 3300047319 Bacteria 2661
395 Ga0495674_0107082 3300047319 Bacteria 2373
396 Ga0495674_0334395 3300047319 Bacteria 1232
397 Ga0495676_0006054 3300047321 Bacteria 11117
398 Ga0495676_0195518 3300047321 Bacteria 1408
399 Ga0495680_0003673 3300047322 Bacteria 14986
400 Ga0495680_0010240 3300047322 Bacteria 8372
401 Ga0495680_0018451 3300047322 Bacteria 5923
402 Ga0495680_0025007 3300047322 Bacteria 4945
403 Ga0495680_0095817 3300047322 Bacteria 2218
404 Ga0495680_0159720 3300047322 Bacteria 1637
405 Ga0495675_0018008 3300047444 Bacteria 4478
406 Ga0495675_0121725 3300047444 Bacteria 1625
407 Ga0495684_0002930 3300047471 Bacteria 13444
408 Ga0495684_0010439 3300047471 Bacteria 7183
409 Ga0495684_0014482 3300047471 Bacteria 6069
410 Ga0495684_0014517 3300047471 Bacteria 6063
411 Ga0495684_0019852 3300047471 Bacteria 5178
412 Ga0495686_0110843 3300047472 Bacteria 1646
413 Ga0495593_0011073 3300047673 Bacteria 5189
414 Ga0495602_0014271 3300048088 Bacteria 8070
415 Ga0495602_0153115 3300048088 Bacteria 1809
416 Ga0495614_0012028 3300048089 Bacteria 3802
417 Ga0496100_0204960 3300048903 Bacteria 1439
418 Ga0496101_0186781 3300048904 Bacteria 1598
419 Ga0496102_0002832 3300048905 Bacteria 14749
420 Ga0496102_0162427 3300048905 Bacteria 2101
421 Ga0496102_0530263 3300048905 Bacteria 1100
422 Ga0496102_0610948 3300048905 Bacteria 1013
423 Ga0496103_0022929 3300048906 Bacteria 3762
424 Ga0496103_0046672 3300048906 Bacteria 2675
425 Ga0496103_0123027 3300048906 Bacteria 1653
426 Ga0496104_0021425 3300048907 Bacteria 5933
427 Ga0496104_0140763 3300048907 Bacteria 2317
428 Ga0496105_0063891 3300048908 Bacteria 3037
429 Ga0496105_0206599 3300048908 Bacteria 1602
430 Ga0496106_0067754 3300048909 Bacteria 2721
431 Ga0496107_0130063 3300048910 Bacteria 1858
432 Ga0496108_0212953 3300048911 Bacteria 1677
433 Ga0496109_0082163 3300048912 Bacteria 2969
434 Ga0496109_0181739 3300048912 Bacteria 1975
435 Ga0496109_0565126 3300048912 Bacteria 1073
436 Ga0496110_0130545 3300048913 Bacteria 2268
437 Ga0496110_0189172 3300048913 Bacteria 1869
438 Ga0496111_0007051 3300048914 Bacteria 7341
439 Ga0496111_0033629 3300048914 Bacteria 3657
440 Ga0496112_0002983 3300048915 Bacteria 13811
441 Ga0496112_0498157 3300048915 Bacteria 1154
442 Ga0496113_0054889 3300048916 Bacteria 2984
443 Ga0496116_0001659 3300048919 Bacteria 24487
444 Ga0496117_0002954 3300048920 Bacteria 20541
445 Ga0496118_0004753 3300048921 Bacteria 15891
446 Ga0496119_0003832 3300048922 Bacteria 15365
447 Ga0496119_0005699 3300048922 Bacteria 11813
448 Ga0496119_0016674 3300048922 Bacteria 5574
449 Ga0496120_0259503 3300048923 Bacteria 812
450 Ga0496121_0004272 3300048924 Bacteria 19398
451 Ga0496121_0013909 3300048924 Bacteria 8603
452 Ga0496121_0028063 3300048924 Bacteria 5249
453 Ga0496121_0109315 3300048924 Bacteria 2113
454 Ga0496124_0010869 3300048927 Bacteria 9162
455 Ga0496125_0027583 3300048928 Bacteria 5146
456 Ga0496125_0118317 3300048928 Bacteria 1898
457 Ga0496126_0005410 3300048929 Bacteria 14571
458 Ga0496126_0110737 3300048929 Bacteria 2391
459 Ga0496126_0190755 3300048929 Bacteria 1736
460 Ga0501031_0003383 3300049568 Bacteria 10245
461 Ga0501032_0067461 3300049569 Bacteria 2389
462 Ga0501033_0006077 3300049570 Bacteria 9470
463 Ga0501034_0009920 3300049571 Bacteria 9951
464 Ga0501036_0006019 3300049572 Bacteria 9837
465 Ga0501037_0005002 3300049573 Bacteria 9639
466 Ga0501038_0007121 3300049574 Bacteria 10333
467 Ga0501039_0014729 3300049575 Bacteria 5983
468 Ga0501040_0051516 3300049576 Bacteria 2816
469 Ga0501043_0005695 3300049579 Bacteria 10038
470 Ga0501046_0007044 3300049580 Bacteria 9904
471 Ga0501047_0001844 3300049581 Bacteria 20430
472 Ga0501047_0147496 3300049581 Bacteria 2229
473 Ga0501048_0005493 3300049582 Bacteria 9644
474 Ga0501067_0173115 3300049583 Bacteria 1202
475 Ga0501069_0030797 3300049585 Bacteria 2948
476 Ga0501070_0005807 3300049586 Bacteria 10531
477 Ga0501070_0007740 3300049586 Bacteria 9107
478 Ga0501072_0189705 3300049588 Bacteria 1639
479 Ga0501073_0005281 3300049589 Bacteria 9688
480 Ga0501074_0019293 3300049590 Bacteria 4953
481 Ga0501079_0016889 3300049741 Bacteria 5574
482 Ga0501080_0039881 3300049742 Bacteria 4382
483 Ga0501083_0004654 3300049744 Bacteria 9694
484 Ga0501083_0264650 3300049744 Bacteria 1118
485 Ga0501035_0003153 3300049822 Bacteria 15842
486 Ga0501044_0004479 3300049823 Bacteria 15616
487 Ga0501044_0085804 3300049823 Bacteria 3181
488 Ga0501044_0094947 3300049823 Bacteria 3006
489 Ga0501044_0142764 3300049823 Bacteria 2382
490 Ga0501045_0036895 3300049824 Bacteria 3551
491 nmdc:mga00v17_195513_c1 3300050491 Bacteria 1307
492 nmdc:mga0rr50_266794_c1 3300050513 Bacteria 1426
493 nmdc:mga08x19_91499_c1 3300050514 Bacteria 2008
494 Ga0495601_0004354 3300053077 Bacteria 8183
495 Ga0495601_0005189 3300053077 Bacteria 7572
496 Ga0495601_0034034 3300053077 Bacteria 3176
497 Ga0495612_0020056 3300053078 Bacteria 2678
498 Ga0495612_0077697 3300053078 Bacteria 1391
499 Ga0495595_0006198 3300053084 Bacteria 4866
500 Ga0495619_0010214 3300053085 Bacteria 5913
501 Ga0495619_0298035 3300053085 Bacteria 1117
502 Ga0495619_0584882 3300053085 Bacteria 764
503 Ga0501084_0489717 3300054114 Bacteria 1039
504 Ga0501082_0036421 3300060353 Bacteria 4239
505 Ga0466962_0000355 3300061719 Bacteria 19651
506 Ga0466962_0017646 3300061719 Bacteria 3436
507 2795781801 2795385470 Bacteria 8317180
508 Ga0070711_100176167
509 JGI25404J52841_10004542
510 Ga0058862_12719070
511 Ga0070683_100153185
512 Ga0070683_100265620
513 Ga0070690_100125955
514 Ga0070666_10006220
515 Ga0070680_100077964
516 Ga0070680_100172457
517 Ga0070682_100211515
518 Ga0070660_100095004
519 Ga0070691_10132216
520 Ga0070661_100108273
521 Ga0070671_100451818
522 Ga0070673_100298385
523 Ga0070688_100446969
524 Ga0070667_100083950
525 Ga0070709_10022014
526 Ga0070709_10049805
527 Ga0070709_10358151
528 Ga0070714_100009373
529 Ga0070714_100013161
530 Ga0070714_100034499
531 Ga0070714_100073459
532 Ga0070714_100169972
533 Ga0070714_100228990
534 Ga0070713_100013119
535 Ga0070713_100019721
536 Ga0070713_100046395
537 Ga0070713_100325460
538 Ga0070710_10012883
539 Ga0070710_10018272
540 Ga0070710_10192438
541 Ga0070711_100104870
542 Ga0070705_100247427
543 Ga0070694_100107271
544 Ga0070708_100003961
545 Ga0070708_100007136
546 Ga0070708_100012479
547 Ga0070708_100059344
548 Ga0070708_100359669
549 Ga0070678_100212837
550 Ga0070662_100195791
551 Ga0070681_10213546
552 Ga0070685_10107703
553 Ga0070706_100004725
554 Ga0070706_100016946
555 Ga0070706_100023410
556 Ga0070706_100069895
557 Ga0070706_100083330
558 Ga0070706_100300220
559 Ga0070707_100045179
560 Ga0070707_100102598
561 Ga0070698_100001571
562 Ga0070698_100051723
563 Ga0070698_100087529
564 Ga0070698_100089634
565 Ga0070698_100112873
566 Ga0070698_100173159
567 Ga0070698_100195872
568 Ga0070699_100004502
569 Ga0070679_100009825
570 Ga0070679_100166604
571 Ga0068853_100236546
572 Ga0070672_100130615
573 Ga0070686_100172342
574 Ga0070696_100322276
575 Ga0070693_100061753
576 Ga0070665_100258878
577 Ga0070704_100053984
578 Ga0068855_100002975
579 Ga0070664_100137728
580 Ga0068857_100598059
581 Ga0068856_100587671
582 Ga0068852_100205731
583 Ga0068864_100058642
584 Ga0068863_100147806
585 Ga0068858_100000135
586 Ga0068858_100351160
587 Ga0068860_100040654
588 Ga0068862_100353697
589 Ga0081455_10050367
590 Ga0081540_1000125
591 Ga0070717_10010655
592 Ga0070717_10069061
593 Ga0070717_10134230
594 Ga0070717_10143964
595 Ga0070717_10175123
596 Ga0070717_10310391
597 Ga0075364_10056248
598 Ga0070715_10101485
599 Ga0070716_100017706
600 Ga0070716_100022272
601 Ga0070716_100023840
602 Ga0070712_100001693
603 Ga0070712_100007784
604 Ga0070712_100014102
605 Ga0070712_100017647
606 Ga0070712_100033297
607 Ga0070712_100089802
608 Ga0070712_100097139
609 Ga0070712_100396217
610 Ga0068871_100050887
611 Ga0075433_10419697
612 Ga0105251_10039193
613 Ga0105240_10149503
614 Ga0105245_10467596
615 Ga0105247_10002626
616 Ga0105247_10278849
617 Ga0105241_10193014
618 Ga0105242_10377665
619 Ga0105242_10439961
620 Ga0105237_10221306
621 Ga0105237_10223274
622 Ga0105238_10457097
623 Ga0105249_10203798
624 Ga0105249_10282695
625 Ga0099796_10086278
626 Ga0105239_10179125
627 Ga0105239_10714631
628 Ga0105246_10136606
629 Ga0157324_1005356
630 Ga0157371_10217725
631 Ga0157370_10062548
632 Ga0157370_10146106
633 Ga0157369_10043738
634 Ga0157374_10169322
635 Ga0163162_10289607
636 Ga0157372_10265756
637 Ga0163163_10065881
638 Ga0182008_10035080
639 Ga0157379_10000224
640 Ga0157379_10170306
641 Ga0206356_11641219
642 Ga0206349_1012063
643 Ga0206351_10072615
644 Ga0206350_10003295
645 Ga0206354_10575515
646 Ga0206354_10953936
647 Ga0206353_10765686
648 Ga0154015_1263636
649 Ga0224712_10050469
650 Ga0224712_10079971
651 Ga0224712_10105620
652 Ga0207713_1052478
653 Ga0207653_10019001
654 Ga0207692_10081221
655 Ga0207710_10000012
656 Ga0207710_10083692
657 Ga0207688_10006647
658 Ga0207680_10008912
659 Ga0207680_10046008
660 Ga0207647_10118272
661 Ga0207685_10016723
662 Ga0207699_10015012
663 Ga0207699_10032433
664 Ga0207699_10054095
665 Ga0207699_10104891
666 Ga0207645_10225154
667 Ga0207643_10109869
668 Ga0207684_10039503
669 Ga0207684_10052693
670 Ga0207684_10090980
671 Ga0207684_10129556
672 Ga0207654_10019266
673 Ga0207707_10002557
674 Ga0207707_10149270
675 Ga0207671_10521505
676 Ga0207693_10007204
677 Ga0207693_10012670
678 Ga0207693_10013381
679 Ga0207693_10017364
680 Ga0207693_10087497
681 Ga0207693_10174467
682 Ga0207693_10233088
683 Ga0207693_10334874
684 Ga0207663_10060457
685 Ga0207663_10062377
686 Ga0207663_10093380
687 Ga0207663_10119199
688 Ga0207663_10128930
689 Ga0207663_10168289
690 Ga0207660_10019981
691 Ga0207662_10175210
692 Ga0207657_10097487
693 Ga0207652_10007631
694 Ga0207652_10087985
695 Ga0207646_10045373
696 Ga0207646_10168059
697 Ga0207694_10120886
698 Ga0207700_10027427
699 Ga0207700_10033719
700 Ga0207700_10045533
701 Ga0207700_10065838
702 Ga0207700_10117606
703 Ga0207700_10147929
704 Ga0207700_10761673
705 Ga0207664_10011288
706 Ga0207664_10020183
707 Ga0207664_10035758
708 Ga0207664_10036427
709 Ga0207664_10047517
710 Ga0207664_10057443
711 Ga0207664_10083290
712 Ga0207664_10247833
713 Ga0207690_10183800
714 Ga0207686_10214426
715 Ga0207709_10179807
716 Ga0207665_10019254
717 Ga0207665_10033030
718 Ga0207665_10205785
719 Ga0207691_10107742
720 Ga0207689_10008862
721 Ga0207661_10068560
722 Ga0207661_10164378
723 Ga0207667_10152717
724 Ga0207667_10216553
725 Ga0207651_10262799
726 Ga0207668_10121490
727 Ga0207640_10231741
728 Ga0207658_10068820
729 Ga0207703_10000014
730 Ga0207703_10133415
731 Ga0207678_10006693
732 Ga0207708_10183698
733 Ga0207702_10141107
734 Ga0207702_10147836
735 Ga0207702_10255037
736 Ga0207702_10517469
737 Ga0207641_10285234
738 Ga0207674_10062246
739 Ga0207675_100115959
740 Ga0207683_10000264
741 Ga0268266_10000216
742 Ga0268266_10197322
743 Ga0265337_1007718
744 Ga0265319_1016793
745 Ga0265334_10001506
746 Ga0265318_10025315
747 Ga0265336_10004056
748 Ga0265336_10021062
749 Ga0265338_10007855
750 Ga0265338_10022415
751 Ga0265324_10009232
752 Ga0265760_10040394
753 Ga0265760_10087698
754 Ga0265332_10001378
755 Ga0265320_10007038
756 Ga0265325_10005691
757 Ga0265340_10000670
758 Ga0265339_10107972
759 Ga0265316_10004139
760 Ga0265314_10077503
761 Ga0265342_10004014
762 Ga0373959_0007729
763 Ga0373938_0030452
764 Ga0373926_0000821
765 Ga0373926_0022013
766 Ga0373926_0137867
767 Ga0373929_0060937
768 Ga0373934_0055657
769 Ga0373940_0035692
770 Ga0373944_0001322
771 Ga0373944_0017442
772 Ga0373923_0015442
773 Ga0373936_0000622
774 Ga0373936_0014050
775 Ga0373941_0065315
776 Ga0373945_0000479
777 Ga0373945_0001894
778 Ga0373956_0016154
779 Ga0373943_0004598
780 Ga0373943_0029694
781 Ga0373946_0001148
782 Ga0373946_0003984
783 Ga0373955_0052103
784 Ga0373942_0000701
785 Ga0373942_0026831
786 Ga0373924_0002131
787 Ga0373924_0017187
788 Ga0373935_0002189
789 Ga0373927_0002362
790 Ga0373927_0007260
791 Ga0373933_0048273
792 Ga0373947_0001136
793 Ga0373947_0004078
794 Ga0373937_0009327
795 Ga0373937_0146221
796 Ga0373925_0026882
797 Ga0373925_0032128
798 Ga0436364_0303804
799 Ga0436364_0959203
800 Ga0436365_1044940
801 Ga0436360_1181608
802 Ga0436363_1344434
803 Ga0466969_0001421
804 Ga0466972_0033698
805 Ga0466966_0005270
806 Ga0466961_0024518
807 Ga0466961_0137374
808 Ga0466963_0057746
809 Ga0466971_0000711
810 Ga0466970_0090800
811 Ga0466957_0244363
812 Ga0466960_0014572
813 Ga0466959_0083981
814 Ga0466959_0290261
815 Ga0466958_0023753
816 Ga0466967_0022922
817 Ga0466967_0181937
818 Ga0495592_0019335
819 Ga0495603_0004818
820 Ga0495629_0001818
821 Ga0495629_0416277
822 Ga0495641_0006334
823 Ga0495641_0061901
824 Ga0495651_0019697
825 Ga0495651_0020122
826 Ga0495653_0015768
827 Ga0495653_0025927
828 Ga0495653_0067530
829 Ga0495653_0175622
830 Ga0495580_0043245
831 Ga0495582_0004501
832 Ga0495639_0003236
833 Ga0495664_0008021
834 Ga0495664_0010487
835 Ga0495664_0030248
836 Ga0495664_0184064
837 Ga0495594_0081477
838 Ga0495608_0013657
839 Ga0495608_0218621
840 Ga0495618_0007117
841 Ga0495618_0009801
842 Ga0495618_0068298
843 Ga0495628_0026908
844 Ga0495628_0115144
845 Ga0495628_0242914
846 Ga0495630_0029287
847 Ga0495630_0032007
848 Ga0495630_0096118
849 Ga0495630_0155629
850 Ga0495666_0007776
851 Ga0495652_0004525
852 Ga0495652_0048771
853 Ga0495652_0192905
854 Ga0495652_0226655
855 Ga0495652_0274140
856 Ga0495665_0001473
857 Ga0495640_0040741
858 Ga0495586_0001203
859 Ga0495587_0030709
860 Ga0495645_0018310
861 Ga0495645_0042468
862 Ga0495645_0074138
863 Ga0495645_0194442
864 Ga0495667_0002045
865 Ga0495667_0010387
866 Ga0495667_0049322
867 Ga0495667_0051280
868 Ga0495667_0074893
869 Ga0495634_0053006
870 Ga0495634_0163819
871 Ga0495634_0242843
872 Ga0495635_0002968
873 Ga0495635_0049810
874 Ga0495635_0078533
875 Ga0495635_0168773
876 Ga0495588_0092324
877 Ga0495657_0169238
878 Ga0495657_0213738
879 Ga0495599_0060347
880 Ga0495599_0062948
881 Ga0495599_0167308
882 Ga0495623_0038456
883 Ga0495623_0041021
884 Ga0495623_0079156
885 Ga0495646_0003859
886 Ga0495646_0154787
887 Ga0495646_0261748
888 Ga0495647_0036537
889 Ga0495613_0004387
890 Ga0495624_0000938
891 Ga0495624_0001819
892 Ga0495600_0022947
893 Ga0495600_0029721
894 Ga0495600_0034404
895 Ga0495600_0058630
896 Ga0495600_0137536
897 Ga0495581_0000844
898 Ga0495604_0070539
899 Ga0495674_0082878
900 Ga0495674_0087708
901 Ga0495674_0087774
902 Ga0495674_0107082
903 Ga0495674_0334395
904 Ga0495676_0006054
905 Ga0495676_0195518
906 Ga0495680_0003673
907 Ga0495680_0010240
908 Ga0495680_0018451
909 Ga0495680_0025007
910 Ga0495680_0095817
911 Ga0495680_0159720
912 Ga0495675_0018008
913 Ga0495675_0121725
914 Ga0495684_0002930
915 Ga0495684_0010439
916 Ga0495684_0014482
917 Ga0495684_0014517
918 Ga0495684_0019852
919 Ga0495686_0110843
920 Ga0495593_0011073
921 Ga0495602_0014271
922 Ga0495602_0153115
923 Ga0495614_0012028
924 Ga0496100_0204960
925 Ga0496101_0186781
926 Ga0496102_0002832
927 Ga0496102_0162427
928 Ga0496102_0530263
929 Ga0496102_0610948
930 Ga0496103_0022929
931 Ga0496103_0046672
932 Ga0496103_0123027
933 Ga0496104_0021425
934 Ga0496104_0140763
935 Ga0496105_0063891
936 Ga0496105_0206599
937 Ga0496106_0067754
938 Ga0496107_0130063
939 Ga0496108_0212953
940 Ga0496109_0082163
941 Ga0496109_0181739
942 Ga0496109_0565126
943 Ga0496110_0130545
944 Ga0496110_0189172
945 Ga0496111_0007051
946 Ga0496111_0033629
947 Ga0496112_0002983
948 Ga0496112_0498157
949 Ga0496113_0054889
950 Ga0496116_0001659
951 Ga0496117_0002954
952 Ga0496118_0004753
953 Ga0496119_0003832
954 Ga0496119_0005699
955 Ga0496119_0016674
956 Ga0496120_0259503
957 Ga0496121_0004272
958 Ga0496121_0013909
959 Ga0496121_0028063
960 Ga0496121_0109315
961 Ga0496124_0010869
962 Ga0496125_0027583
963 Ga0496125_0118317
964 Ga0496126_0005410
965 Ga0496126_0110737
966 Ga0496126_0190755
967 Ga0501031_0003383
968 Ga0501032_0067461
969 Ga0501033_0006077
970 Ga0501034_0009920
971 Ga0501036_0006019
972 Ga0501037_0005002
973 Ga0501038_0007121
974 Ga0501039_0014729
975 Ga0501040_0051516
976 Ga0501043_0005695
977 Ga0501046_0007044
978 Ga0501047_0001844
979 Ga0501047_0147496
980 Ga0501048_0005493
981 Ga0501067_0173115
982 Ga0501069_0030797
983 Ga0501070_0005807
984 Ga0501070_0007740
985 Ga0501072_0189705
986 Ga0501073_0005281
987 Ga0501074_0019293
988 Ga0501079_0016889
989 Ga0501080_0039881
990 Ga0501083_0004654
991 Ga0501083_0264650
992 Ga0501035_0003153
993 Ga0501044_0004479
994 Ga0501044_0085804
995 Ga0501044_0094947
996 Ga0501044_0142764
997 Ga0501045_0036895
998 nmdc:mga00v17_195513_c1
999 nmdc:mga0rr50_266794_c1
1000 nmdc:mga08x19_91499_c1
1001 Ga0495601_0004354
1002 Ga0495601_0005189
1003 Ga0495601_0034034
1004 Ga0495612_0020056
1005 Ga0495612_0077697
1006 Ga0495595_0006198
1007 Ga0495619_0010214
1008 Ga0495619_0298035
1009 Ga0495619_0584882
1010 Ga0501084_0489717
1011 Ga0501082_0036421
1012 Ga0466962_0000355
1013 Ga0466962_0017646
1014 2795781801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

171

264

0.98

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

50

139

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.9072 135 246
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8768 135 246
7sfz-assembly2.cif.gz_D crystal structure of mis18a-yippee domain 0.6648 142 247
7sfz-assembly2.cif.gz_D crystal structure of mis18a-yippee domain 0.6414 142 247
7sfz-assembly1.cif.gz_B crystal structure of mis18a-yippee domain 0.6203 142 250
ID Description Score Start End Superfamily
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9655 130 246 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9488 130 246 2.170.150.40
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9241 135 246 2.170.150.40
af_O53404_8_113_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9203 7 114 2.170.150.40
af_O53404_8_113_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9036 7 114 2.170.150.40
ID Description Score Start End GO Terms
AF-A0A7G1IID3-F1-model_v4 DUF427 domain-containing protein 0.991 136 259
AF-A0A655A0G2-F1-model_v4 Short-chain dehydrogenase of uncharacterized substrate specificity 0.9842 153 260
AF-A0A2S8MMD5-F1-model_v4 deleted 0.9817 171 259
AF-A0A7J9VET7-F1-model_v4 DUF427 domain-containing protein 0.9691 134 260
AF-A0A7G1IID3-F1-model_v4 DUF427 domain-containing protein 0.9669 136 259

Map