F456634

General Info

Members Datasets Scaffolds Average Seq Length
507 252 1014 340

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100045629|Ga0070673_1000456295
Length 386
Sequence LVKHPEWFVGHWPRRGTVRGTRTMARNPKLLNFKLPHLLRYITRKLLYGLLVMAGVVVLVFFLFQGFGDPSRLIIGQRADAATQENIRKELYLDQPKWKQFFFYLNDVSPVSIYSAKEIDEKKLHGLFIGSNTKLGLKTPYLRRSYQTKKEVWQILMEALPGTLLLAVAAMAFAVVLGIALGVLAAVKKGTWVDGSSIFAGIIGISAPSFFMGIIIAYVFGFLLSRYTGLHMAGSWFDLDEITGKKYITISNLILPAITLGIRPLAIISQLTRSTMLDTLGQDYIRTAYAKGLSKRSVIWKHALRNALNPVITAITGWFAELLAGAFFVEYIFGWKGIGKITVDALEKLDFPVVMGSVLVSSAFFILINILADLLYGLIDPRVRLQ

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
205 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
213 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
214 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
215 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
216 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
219 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
239 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
242 2738541278 Niastella sp. CF465 Isolate Unclassified
243 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
244 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
245 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
246 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
247 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
248 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
249 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
250 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
251 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
252 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.75
Nodule 0
Rhizoplane 0.39
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 15.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100045629 3300005364 Bacteria 3399
2 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
3 MRS1b_contig_4645766 2162886011 Bacteria 3971
4 rootH2_10054391 3300003320 Bacteria 21114
5 rootH2_10097470 3300003320 Bacteria 7940
6 rootH2_10101990 3300003320 Bacteria 6497
7 rootL2_10081290 3300003322 Bacteria 3993
8 rootL2_10174882 3300003322 Bacteria 3854
9 rootL2_10243019 3300003322 Bacteria 4178
10 rootH1_10039716 3300003323 Bacteria 14186
11 rootH1_10128599 3300003323 Bacteria 10821
12 rootH1_10191702 3300003323 Bacteria 3115
13 rootH1_10247663 3300003323 Bacteria 1387
14 JGI25160J50197_1001251 3300003354 Bacteria 12882
15 Ga0065165_1026799 3300005262 Bacteria 1890
16 Ga0065704_10070133 3300005289 Bacteria 1266035
17 Ga0065704_10076804 3300005289 Bacteria 4972
18 Ga0065712_10013733 3300005290 Unclassified 1801
19 Ga0065712_10070873 3300005290 Bacteria 5634
20 Ga0065715_10143036 3300005293 Bacteria 1817
21 Ga0065707_10103077 3300005295 Bacteria 2706
22 Ga0070658_10099680 3300005327 Bacteria 2400
23 Ga0070676_10021487 3300005328 Bacteria 3614
24 Ga0070683_100008776 3300005329 Bacteria 8593
25 Ga0070683_100034916 3300005329 Bacteria 4596
26 Ga0070690_100218268 3300005330 Bacteria 1335
27 Ga0070670_100081393 3300005331 Unclassified 2783
28 Ga0070670_100284459 3300005331 Bacteria 1444
29 Ga0070677_10052234 3300005333 Unclassified 1658
30 Ga0070677_10081719 3300005333 Bacteria 1384
31 Ga0068869_100008103 3300005334 Bacteria 6758
32 Ga0068869_100020521 3300005334 Bacteria 4531
33 Ga0068869_100042451 3300005334 Bacteria 3260
34 Ga0068869_100139172 3300005334 Bacteria 1873
35 Ga0068869_100248287 3300005334 Bacteria 1420
36 Ga0070666_10000024 3300005335 Bacteria 161355
37 Ga0070666_10076117 3300005335 Bacteria 2289
38 Ga0068868_100020162 3300005338 Bacteria 5004
39 Ga0068868_100034913 3300005338 Bacteria 3884
40 Ga0068868_100093128 3300005338 Bacteria 2429
41 Ga0068868_100105364 3300005338 Unclassified 2286
42 Ga0070689_100021688 3300005340 Bacteria 4786
43 Ga0070689_100023713 3300005340 Bacteria 4597
44 Ga0070689_100314121 3300005340 Unclassified 1307
45 Ga0070687_100005468 3300005343 Bacteria 5144
46 Ga0070661_100005591 3300005344 Bacteria 8662
47 Ga0070661_100039560 3300005344 Bacteria 3436
48 Ga0070661_100043829 3300005344 Bacteria 3268
49 Ga0070668_100007250 3300005347 Bacteria 8223
50 Ga0070668_100016281 3300005347 Bacteria 5561
51 Ga0070669_100007472 3300005353 Bacteria 7830
52 Ga0070669_100116724 3300005353 Bacteria 2032
53 Ga0070669_100341115 3300005353 Bacteria 1214
54 Ga0070675_100003118 3300005354 Bacteria 12537
55 Ga0070675_100006327 3300005354 Bacteria 9090
56 Ga0070675_100094451 3300005354 Bacteria 2509
57 Ga0070675_100107099 3300005354 Bacteria 2360
58 Ga0070675_100144265 3300005354 Bacteria 2037
59 Ga0070671_100132709 3300005355 Bacteria 2098
60 Ga0070673_100005255 3300005364 Bacteria 8266
61 Ga0070673_100050469 3300005364 Unclassified 3253
62 Ga0070673_100065452 3300005364 Bacteria 2899
63 Ga0070673_100070069 3300005364 Unclassified 2812
64 Ga0070673_100184192 3300005364 Bacteria 1789
65 Ga0070688_100001769 3300005365 Bacteria 10810
66 Ga0070688_100002985 3300005365 Bacteria 8623
67 Ga0070688_100061663 3300005365 Unclassified 2372
68 Ga0070688_100097524 3300005365 Bacteria 1933
69 Ga0070659_100027483 3300005366 Bacteria 4384
70 Ga0070659_100076744 3300005366 Bacteria 2664
71 Ga0070659_100424118 3300005366 Bacteria 1125
72 Ga0070667_100003179 3300005367 Bacteria 14074
73 Ga0070667_100074169 3300005367 Bacteria 2902
74 Ga0070667_100094756 3300005367 Bacteria 2573
75 Ga0070700_100047183 3300005441 Bacteria 2665
76 Ga0070662_100012086 3300005457 Bacteria 5716
77 Ga0070662_100020889 3300005457 Bacteria 4465
78 Ga0070662_100258314 3300005457 Bacteria 1403
79 Ga0070681_10108845 3300005458 Bacteria 2711
80 Ga0068867_100019746 3300005459 Unclassified 4801
81 Ga0070685_10009929 3300005466 Bacteria 4937
82 Ga0070685_10040719 3300005466 Bacteria 2645
83 Ga0070698_100004775 3300005471 Bacteria 14871
84 Ga0070698_100016643 3300005471 Bacteria 7760
85 Ga0070698_100040903 3300005471 Bacteria 4761
86 Ga0070679_100001952 3300005530 Bacteria 18513
87 Ga0070684_100024657 3300005535 Bacteria 5047
88 Ga0070684_100049345 3300005535 Bacteria 3653
89 Ga0068853_100005327 3300005539 Bacteria 10070
90 Ga0068853_100036151 3300005539 Unclassified 4198
91 Ga0068853_100042464 3300005539 Bacteria 3888
92 Ga0068853_100114387 3300005539 Bacteria 2400
93 Ga0068853_100155445 3300005539 Bacteria 2061
94 Ga0070672_100061320 3300005543 Unclassified 2964
95 Ga0070672_100121552 3300005543 Bacteria 2138
96 Ga0070686_100201633 3300005544 Bacteria 1427
97 Ga0070693_100034893 3300005547 Bacteria 2786
98 Ga0070665_100038235 3300005548 Bacteria 4824
99 Ga0070665_100245783 3300005548 Bacteria 1790
100 Ga0068855_100011960 3300005563 Bacteria 10492
101 Ga0068855_100012864 3300005563 Bacteria 10097
102 Ga0068855_100181372 3300005563 Bacteria 2380
103 Ga0070664_100029509 3300005564 Bacteria 4572
104 Ga0070664_100040204 3300005564 Unclassified 3942
105 Ga0070664_100078803 3300005564 Bacteria 2834
106 Ga0070664_100106129 3300005564 Unclassified 2447
107 Ga0068857_100005870 3300005577 Bacteria 10483
108 Ga0068857_100008333 3300005577 Bacteria 8955
109 Ga0068857_100032860 3300005577 Bacteria 4586
110 Ga0068857_100091857 3300005577 Unclassified 2717
111 Ga0068857_100147564 3300005577 Bacteria 2129
112 Ga0068856_100004037 3300005614 Bacteria 14698
113 Ga0068856_100026118 3300005614 Bacteria 5694
114 Ga0068852_100008954 3300005616 Bacteria 7408
115 Ga0068852_100032325 3300005616 Bacteria 4332
116 Ga0068852_100606993 3300005616 Unclassified 1099
117 Ga0068859_100000018 3300005617 Bacteria 248813
118 Ga0068859_100012863 3300005617 Bacteria 8406
119 Ga0068859_100108344 3300005617 Bacteria 2839
120 Ga0068859_100141239 3300005617 Bacteria 2482
121 Ga0068859_100427601 3300005617 Bacteria 1421
122 Ga0068864_100004617 3300005618 Bacteria 11298
123 Ga0068864_100030265 3300005618 Bacteria 4588
124 Ga0068864_100061948 3300005618 Bacteria 3240
125 Ga0068861_100001157 3300005719 Bacteria 16428
126 Ga0068861_100278300 3300005719 Bacteria 1440
127 Ga0068851_10019028 3300005834 Bacteria 3317
128 Ga0068851_10027860 3300005834 Bacteria 2787
129 Ga0068870_10143496 3300005840 Bacteria 1399
130 Ga0068863_100012262 3300005841 Bacteria 8276
131 Ga0068863_100028337 3300005841 Bacteria 5347
132 Ga0068863_100042276 3300005841 Unclassified 4330
133 Ga0068863_100237667 3300005841 Bacteria 1758
134 Ga0068858_100020038 3300005842 Bacteria 6254
135 Ga0068860_100006531 3300005843 Bacteria 11706
136 Ga0068860_100010513 3300005843 Bacteria 9150
137 Ga0068860_100044556 3300005843 Bacteria 4228
138 Ga0068860_100084109 3300005843 Unclassified 3027
139 Ga0068860_100284517 3300005843 Bacteria 1617
140 Ga0068860_100286587 3300005843 Unclassified 1610
141 Ga0068862_100213770 3300005844 Bacteria 1743
142 Ga0068862_100492405 3300005844 Bacteria 1162
143 Ga0097621_100016505 3300006237 Bacteria 5584
144 Ga0097621_100077532 3300006237 Bacteria 2759
145 Ga0068871_100029369 3300006358 Bacteria 4317
146 Ga0075428_100006899 3300006844 Bacteria 12614
147 Ga0075428_100058117 3300006844 Bacteria 4234
148 Ga0075430_100011931 3300006846 Bacteria 7398
149 Ga0075434_100265752 3300006871 Unclassified 1735
150 Ga0075429_100032466 3300006880 Bacteria 4538
151 Ga0068865_100010406 3300006881 Bacteria 5790
152 Ga0068865_100039383 3300006881 Bacteria 3206
153 Ga0097620_100000018 3300006931 Bacteria 248813
154 Ga0097620_100012863 3300006931 Bacteria 8406
155 Ga0097620_100108340 3300006931 Bacteria 2839
156 Ga0097620_100141242 3300006931 Bacteria 2482
157 Ga0097620_100292825 3300006931 Bacteria 1721
158 Ga0097620_100427587 3300006931 Bacteria 1421
159 Ga0105251_10037895 3300009011 Unclassified 2363
160 Ga0105240_10000152 3300009093 Bacteria 141054
161 Ga0105240_10000991 3300009093 Bacteria 50697
162 Ga0105240_10141681 3300009093 Bacteria 2874
163 Ga0111539_10006032 3300009094 Bacteria 15656
164 Ga0111539_10282951 3300009094 Bacteria 1930
165 Ga0114129_10060366 3300009147 Bacteria 5302
166 Ga0105241_10007471 3300009174 Bacteria 8043
167 Ga0105241_10009094 3300009174 Bacteria 7311
168 Ga0105242_10009911 3300009176 Bacteria 7297
169 Ga0105242_10022998 3300009176 Bacteria 4911
170 Ga0105242_10033060 3300009176 Bacteria 4139
171 Ga0105242_10107826 3300009176 Bacteria 2370
172 Ga0105237_10008915 3300009545 Bacteria 10810
173 Ga0105237_10022087 3300009545 Bacteria 6530
174 Ga0105238_10183212 3300009551 Unclassified 2071
175 Ga0105249_10001879 3300009553 Bacteria 18195
176 Ga0105249_10003657 3300009553 Bacteria 13275
177 Ga0105249_10011900 3300009553 Bacteria 7653
178 Ga0105249_10030582 3300009553 Unclassified 4869
179 Ga0105249_10054055 3300009553 Bacteria 3671
180 Ga0105249_10237815 3300009553 Bacteria 1799
181 Ga0105239_10022910 3300010375 Bacteria 6885
182 Ga0105239_10026016 3300010375 Bacteria 6443
183 Ga0105239_10083039 3300010375 Bacteria 3528
184 Ga0105239_10316179 3300010375 Unclassified 1760
185 Ga0105246_10025203 3300011119 Bacteria 3875
186 Ga0105246_10082160 3300011119 Bacteria 2299
187 Ga0157371_10136859 3300013102 Bacteria 1744
188 Ga0157370_10009541 3300013104 Bacteria 10350
189 Ga0157370_10011610 3300013104 Bacteria 9195
190 Ga0157369_10043490 3300013105 Bacteria 4896
191 Ga0157369_10136329 3300013105 Bacteria 2599
192 Ga0157369_10407513 3300013105 Bacteria 1410
193 Ga0157374_10000002 3300013296 Bacteria 1054226
194 Ga0157374_10004340 3300013296 Bacteria 11935
195 Ga0157374_10035268 3300013296 Unclassified 4576
196 Ga0157374_10047891 3300013296 Bacteria 3964
197 Ga0157374_10051476 3300013296 Bacteria 3832
198 Ga0157374_10059776 3300013296 Unclassified 3565
199 Ga0157374_10205471 3300013296 Bacteria 1930
200 Ga0157378_10008463 3300013297 Bacteria 8961
201 Ga0157378_10012811 3300013297 Bacteria 7341
202 Ga0157378_10034319 3300013297 Bacteria 4487
203 Ga0163162_10001022 3300013306 Bacteria 25996
204 Ga0163162_10003497 3300013306 Bacteria 15015
205 Ga0163162_10295107 3300013306 Bacteria 1753
206 Ga0157372_10011678 3300013307 Bacteria 9351
207 Ga0157372_10014977 3300013307 Bacteria 8299
208 Ga0157372_10198323 3300013307 Unclassified 2325
209 Ga0157372_10507946 3300013307 Bacteria 1405
210 Ga0157375_10021522 3300013308 Bacteria 5915
211 Ga0157375_10043443 3300013308 Bacteria 4359
212 Ga0157375_10104327 3300013308 Bacteria 2924
213 Ga0157375_10206499 3300013308 Bacteria 2121
214 Ga0157375_10263136 3300013308 Bacteria 1886
215 Ga0163163_10020531 3300014325 Bacteria 6222
216 Ga0163163_10046510 3300014325 Bacteria 4263
217 Ga0163163_10311586 3300014325 Bacteria 1627
218 Ga0157380_10010202 3300014326 Bacteria 6749
219 Ga0157380_10028823 3300014326 Bacteria 4238
220 Ga0157380_10123039 3300014326 Bacteria 2201
221 Ga0157380_10346268 3300014326 Unclassified 1388
222 Ga0157377_10002352 3300014745 Bacteria 8342
223 Ga0157377_10020412 3300014745 Bacteria 3471
224 Ga0157377_10082363 3300014745 Bacteria 1884
225 Ga0157379_10124144 3300014968 Bacteria 2323
226 Ga0157379_10125340 3300014968 Bacteria 2311
227 Ga0157379_10160317 3300014968 Bacteria 2030
228 Ga0157379_10374595 3300014968 Bacteria 1306
229 Ga0157376_10002193 3300014969 Bacteria 13161
230 Ga0157376_10005066 3300014969 Bacteria 9191
231 Ga0157376_10016712 3300014969 Bacteria 5579
232 Ga0157376_10040883 3300014969 Unclassified 3792
233 Ga0182005_1000126 3300015265 Bacteria 53914
234 Ga0163161_10001931 3300017792 Bacteria 15120
235 Ga0163161_10097236 3300017792 Unclassified 2187
236 Ga0213876_10056680 3300021384 Bacteria 2068
237 Ga0209436_103438 3300025208 Bacteria 4215
238 Ga0207426_1000009 3300025302 Bacteria 797229
239 Ga0207682_10090909 3300025893 Bacteria 1323
240 Ga0207688_10005125 3300025901 Bacteria 7118
241 Ga0207688_10080220 3300025901 Unclassified 1862
242 Ga0207680_10000026 3300025903 Bacteria 79960
243 Ga0207680_10024323 3300025903 Bacteria 3323
244 Ga0207680_10038463 3300025903 Bacteria 2769
245 Ga0207647_10063108 3300025904 Bacteria 2254
246 Ga0207647_10070731 3300025904 Unclassified 2107
247 Ga0207647_10127289 3300025904 Bacteria 1498
248 Ga0207645_10008796 3300025907 Bacteria 7021
249 Ga0207643_10026659 3300025908 Unclassified 3200
250 Ga0207654_10001418 3300025911 Bacteria 12717
251 Ga0207654_10064195 3300025911 Bacteria 2158
252 Ga0207707_10044052 3300025912 Bacteria 3891
253 Ga0207707_10053658 3300025912 Bacteria 3509
254 Ga0207695_10000666 3300025913 Bacteria 67698
255 Ga0207695_10052130 3300025913 Bacteria 4289
256 Ga0207695_10077030 3300025913 Bacteria 3389
257 Ga0207671_10019665 3300025914 Bacteria 5159
258 Ga0207671_10025216 3300025914 Bacteria 4466
259 Ga0207660_10024790 3300025917 Bacteria 4063
260 Ga0207662_10013510 3300025918 Bacteria 4566
261 Ga0207657_10026796 3300025919 Bacteria 5288
262 Ga0207657_10144027 3300025919 Bacteria 1945
263 Ga0207649_10009010 3300025920 Bacteria 5452
264 Ga0207649_10130925 3300025920 Bacteria 1703
265 Ga0207652_10000115 3300025921 Bacteria 87927
266 Ga0207652_10000258 3300025921 Bacteria 55325
267 Ga0207681_10002862 3300025923 Bacteria 10905
268 Ga0207681_10165077 3300025923 Bacteria 1673
269 Ga0207694_10032549 3300025924 Bacteria 3992
270 Ga0207650_10007216 3300025925 Bacteria 7575
271 Ga0207650_10121327 3300025925 Bacteria 2036
272 Ga0207650_10211542 3300025925 Bacteria 1557
273 Ga0207650_10220498 3300025925 Bacteria 1526
274 Ga0207659_10014825 3300025926 Bacteria 5038
275 Ga0207659_10361347 3300025926 Bacteria 1207
276 Ga0207644_10048503 3300025931 Unclassified 3037
277 Ga0207706_10006315 3300025933 Bacteria 11014
278 Ga0207706_10030504 3300025933 Bacteria 4809
279 Ga0207706_10035708 3300025933 Bacteria 4418
280 Ga0207686_10000909 3300025934 Bacteria 17772
281 Ga0207670_10004427 3300025936 Bacteria 7565
282 Ga0207670_10058867 3300025936 Bacteria 2611
283 Ga0207704_10178908 3300025938 Unclassified 1531
284 Ga0207691_10059890 3300025940 Bacteria 3461
285 Ga0207691_10097522 3300025940 Bacteria 2627
286 Ga0207689_10001523 3300025942 Bacteria 22061
287 Ga0207689_10006429 3300025942 Bacteria 10389
288 Ga0207689_10009053 3300025942 Bacteria 8623
289 Ga0207689_10012708 3300025942 Bacteria 7192
290 Ga0207689_10019064 3300025942 Bacteria 5785
291 Ga0207689_10052575 3300025942 Bacteria 3356
292 Ga0207679_10070229 3300025945 Bacteria 2638
293 Ga0207679_10164253 3300025945 Bacteria 1821
294 Ga0207679_10316949 3300025945 Bacteria 1349
295 Ga0207667_10014573 3300025949 Bacteria 8955
296 Ga0207667_10225885 3300025949 Bacteria 1918
297 Ga0207651_10036505 3300025960 Bacteria 3209
298 Ga0207651_10044011 3300025960 Unclassified 2984
299 Ga0207651_10046956 3300025960 Bacteria 2908
300 Ga0207651_10062814 3300025960 Unclassified 2590
301 Ga0207712_10022943 3300025961 Bacteria 4115
302 Ga0207712_10029125 3300025961 Unclassified 3701
303 Ga0207712_10223238 3300025961 Unclassified 1507
304 Ga0207668_10079042 3300025972 Unclassified 2378
305 Ga0207668_10311051 3300025972 Unclassified 1304
306 Ga0207658_10026812 3300025986 Bacteria 4044
307 Ga0207658_10066920 3300025986 Bacteria 2704
308 Ga0207658_10080085 3300025986 Unclassified 2501
309 Ga0207677_10006223 3300026023 Bacteria 6527
310 Ga0207677_10045943 3300026023 Unclassified 2920
311 Ga0207677_10048089 3300026023 Bacteria 2869
312 Ga0207677_10168347 3300026023 Unclassified 1710
313 Ga0207677_10446678 3300026023 Unclassified 1107
314 Ga0207703_10026602 3300026035 Bacteria 4555
315 Ga0207639_10001323 3300026041 Bacteria 16766
316 Ga0207639_10019961 3300026041 Bacteria 4790
317 Ga0207639_10032425 3300026041 Bacteria 3846
318 Ga0207639_10106208 3300026041 Bacteria 2279
319 Ga0207678_10080570 3300026067 Bacteria 2787
320 Ga0207708_10034047 3300026075 Bacteria 3874
321 Ga0207708_10043383 3300026075 Bacteria 3428
322 Ga0207702_10087210 3300026078 Bacteria 2724
323 Ga0207641_10000167 3300026088 Bacteria 92790
324 Ga0207641_10005899 3300026088 Bacteria 10390
325 Ga0207641_10017281 3300026088 Bacteria 5905
326 Ga0207641_10110408 3300026088 Bacteria 2437
327 Ga0207641_10112251 3300026088 Bacteria 2418
328 Ga0207648_10002320 3300026089 Bacteria 20536
329 Ga0207648_10030355 3300026089 Unclassified 4788
330 Ga0207648_10435034 3300026089 Bacteria 1193
331 Ga0207676_10004370 3300026095 Bacteria 9999
332 Ga0207676_10022412 3300026095 Bacteria 4644
333 Ga0207676_10442232 3300026095 Bacteria 1224
334 Ga0207674_10005497 3300026116 Bacteria 15045
335 Ga0207674_10021248 3300026116 Bacteria 6995
336 Ga0207674_10068615 3300026116 Bacteria 3568
337 Ga0207674_10080560 3300026116 Bacteria 3259
338 Ga0207674_10136086 3300026116 Viruses 2419
339 Ga0207674_10163078 3300026116 Unclassified 2183
340 Ga0207675_100000422 3300026118 Bacteria 40963
341 Ga0207675_100053361 3300026118 Bacteria 3772
342 Ga0207675_100117740 3300026118 Bacteria 2512
343 Ga0207683_10012847 3300026121 Bacteria 7146
344 Ga0207683_10014189 3300026121 Bacteria 6789
345 Ga0207698_10046482 3300026142 Bacteria 3278
346 Ga0207698_10192088 3300026142 Bacteria 1820
347 Ga0207698_10204673 3300026142 Bacteria 1771
348 Ga0207698_10230670 3300026142 Unclassified 1680
349 Ga0207698_10266035 3300026142 Unclassified 1578
350 Ga0207698_10289552 3300026142 Bacteria 1519
351 Ga0268265_10002951 3300028380 Bacteria 12466
352 Ga0268265_10060284 3300028380 Bacteria 2908
353 Ga0268265_10164096 3300028380 Bacteria 1891
354 Ga0268264_10014592 3300028381 Bacteria 6454
355 Ga0268264_10079097 3300028381 Bacteria 2804
356 Ga0268264_10098761 3300028381 Unclassified 2532
357 Ga0268264_10166529 3300028381 Unclassified 1990
358 Ga0268264_10477386 3300028381 Bacteria 1212
359 Ga0307515_10000677 3300028794 Bacteria 78511
360 Ga0307511_10000498 3300030521 Bacteria 42446
361 Ga0265327_10000054 3300031251 Bacteria 250337
362 Ga0265327_10002040 3300031251 Bacteria 22722
363 Ga0307509_10125471 3300031507 Bacteria 2534
364 Ga0307509_10149564 3300031507 Unclassified 2254
365 Ga0307508_10003711 3300031616 Bacteria 15293
366 Ga0307410_10177806 3300031852 Bacteria 1609
367 Ga0307406_10103581 3300031901 Bacteria 1944
368 Ga0307411_10132753 3300032005 Bacteria 1823
369 Ga0307510_10189720 3300033180 Unclassified 1605
370 Ga0373934_0040490 3300035086 Bacteria 1838
371 Ga0373923_0033556 3300035111 Bacteria 2079
372 Ga0373955_0037671 3300035172 Bacteria 2572
373 Ga0373937_0013982 3300036401 Bacteria 7076
374 Ga0316584_0036221 3300036712 Bacteria 3661
375 Ga0395900_0012750 3300037418 Bacteria 8591
376 Ga0395900_0157819 3300037418 Bacteria 2316
377 Ga0395900_0294875 3300037418 Bacteria 1609
378 Ga0395898_0125241 3300037466 Unclassified 2461
379 Ga0395898_0241007 3300037466 Bacteria 1725
380 Ga0395905_0001979 3300037471 Bacteria 23428
381 Ga0395905_0018736 3300037471 Bacteria 6565
382 Ga0395905_0296872 3300037471 Bacteria 1503
383 Ga0395901_0027637 3300038443 Bacteria 5830
384 Ga0395901_0210464 3300038443 Unclassified 2035
385 Ga0395901_0215670 3300038443 Bacteria 2007
386 Ga0436365_1551316 3300039437 Bacteria 6723
387 Ga0439436_0010209 3300041404 Bacteria 2868
388 Ga0439431_0007093 3300041997 Bacteria 2493
389 Ga0439441_003969 3300042001 Unclassified 2215
390 Ga0439442_008401 3300042002 Unclassified 2085
391 Ga0439457_008944 3300042014 Bacteria 2344
392 Ga0450898_002137 3300042134 Bacteria 2732
393 Ga0439434_0004131 3300042435 Bacteria 4240
394 Ga0466969_0000033 3300044656 Bacteria 82227
395 Ga0466972_0000020 3300044658 Bacteria 197336
396 Ga0466972_0001881 3300044658 Bacteria 10296
397 Ga0466972_0006196 3300044658 Bacteria 6011
398 Ga0466972_0065365 3300044658 Unclassified 1740
399 Ga0466966_0000543 3300044684 Bacteria 24041
400 Ga0466970_0000117 3300044765 Bacteria 35460
401 Ga0466957_0004183 3300044842 Bacteria 7996
402 Ga0466959_0000048 3300045049 Bacteria 83528
403 Ga0451576_0000012 3300045051 Bacteria 674684
404 Ga0466967_0251126 3300045976 Bacteria 1690
405 Ga0495618_0060077 3300046514 Bacteria 2410
406 Ga0495628_0258612 3300046516 Bacteria 1298
407 Ga0495668_0000562 3300046616 Bacteria 45637
408 Ga0495668_0015003 3300046616 Bacteria 4533
409 Ga0495634_0017536 3300046642 Bacteria 5106
410 Ga0495625_0312151 3300046660 Bacteria 1003
411 Ga0495613_0294019 3300046689 Bacteria 1125
412 Ga0495600_0161827 3300046809 Bacteria 1447
413 Ga0495672_0031761 3300047320 Bacteria 3294
414 Ga0495686_0000102 3300047472 Bacteria 177525
415 Ga0495686_0000616 3300047472 Bacteria 49206
416 Ga0495686_0007468 3300047472 Bacteria 8190
417 Ga0495686_0111670 3300047472 Bacteria 1638
418 Ga0496115_0009506 3300048918 Bacteria 7221
419 Ga0496115_0276411 3300048918 Bacteria 1379
420 Ga0496121_0000007 3300048924 Bacteria 942516
421 Ga0501300_003603 3300049523 Unclassified 2305
422 Ga0501032_0273209 3300049569 Bacteria 1095
423 Ga0501034_0000114 3300049571 Bacteria 148505
424 Ga0501034_0006325 3300049571 Bacteria 12750
425 Ga0501034_0035010 3300049571 Bacteria 5092
426 Ga0501034_0054023 3300049571 Bacteria 4044
427 Ga0501036_0003899 3300049572 Bacteria 11968
428 Ga0501036_0003983 3300049572 Bacteria 11870
429 Ga0501037_0077973 3300049573 Bacteria 2404
430 Ga0501038_0046785 3300049574 Bacteria 3750
431 Ga0501038_0196965 3300049574 Bacteria 1619
432 Ga0501039_0152977 3300049575 Unclassified 1812
433 Ga0501043_0006741 3300049579 Bacteria 9168
434 Ga0501043_0009529 3300049579 Bacteria 7612
435 Ga0501043_0034395 3300049579 Bacteria 3986
436 Ga0501046_0005622 3300049580 Bacteria 11191
437 Ga0501046_0080280 3300049580 Unclassified 2521
438 Ga0501047_0049425 3300049581 Bacteria 4061
439 Ga0501047_0108388 3300049581 Bacteria 2660
440 Ga0501048_0010212 3300049582 Bacteria 7021
441 Ga0501070_0024534 3300049586 Bacteria 5057
442 Ga0501073_0014124 3300049589 Bacteria 5799
443 Ga0501074_0000510 3300049590 Bacteria 23805
444 Ga0501201_000261 3300049651 Bacteria 4741
445 Ga0501202_003309 3300049652 Unclassified 2754
446 Ga0501206_002032 3300049653 Unclassified 2552
447 Ga0501207_002877 3300049654 Unclassified 2249
448 Ga0501217_002762 3300049661 Unclassified 3490
449 Ga0501217_003653 3300049661 Unclassified 3120
450 Ga0501222_002063 3300049662 Unclassified 2780
451 Ga0501222_010281 3300049662 Bacteria 1237
452 Ga0501223_007952 3300049663 Bacteria 2164
453 Ga0501223_018621 3300049663 Unclassified 1365
454 Ga0501233_009522 3300049668 Unclassified 1895
455 Ga0501235_003819 3300049669 Unclassified 3255
456 Ga0501243_001285 3300049675 Unclassified 3579
457 Ga0501243_011457 3300049675 Unclassified 1391
458 Ga0501257_022672 3300049686 Bacteria 1487
459 Ga0501259_002604 3300049688 Unclassified 2908
460 Ga0501261_000863 3300049690 Bacteria 3756
461 Ga0501219_001347 3300049703 Bacteria 2469
462 Ga0501221_002560 3300049704 Unclassified 2997
463 Ga0501225_0001099 3300049705 Bacteria 8490
464 Ga0501225_0006568 3300049705 Unclassified 3396
465 Ga0501225_0012593 3300049705 Unclassified 2374
466 Ga0501225_0021186 3300049705 Unclassified 1795
467 Ga0501234_002357 3300049707 Unclassified 2975
468 Ga0501245_000465 3300049708 Bacteria 4908
469 Ga0501083_0007826 3300049744 Bacteria 7572
470 Ga0501241_002800 3300049758 Bacteria 3351
471 Ga0501035_0006493 3300049822 Bacteria 10987
472 Ga0501035_0116952 3300049822 Unclassified 2333
473 Ga0501044_0002053 3300049823 Bacteria 23236
474 Ga0501044_0044442 3300049823 Bacteria 4609
475 Ga0501044_0275349 3300049823 Unclassified 1618
476 Ga0501284_00078 3300050005 Bacteria 25912
477 nmdc:mga0k408_58540_c1 3300050493 Unclassified 2238
478 nmdc:mga0k408_8244_c1 3300050493 Bacteria 5589
479 nmdc:mga05p37_48169_c1 3300050507 Bacteria 5242
480 nmdc:mga09592_27982_c1 3300050508 Bacteria 4681
481 nmdc:mga06r32_98013_c1 3300050510 Bacteria 2873
482 nmdc:mga08y16_171938_c1 3300050511 Bacteria 2250
483 nmdc:mga08y16_9852_c1 3300050511 Bacteria 10032
484 Ga0500578_0000097 3300053086 Bacteria 100607
485 Ga0500583_0000031 3300053092 Bacteria 104319
486 Ga0500583_0049958 3300053092 Bacteria 1938
487 Ga0500555_053772 3300053103 Unclassified 1097
488 Ga0500572_006399 3300053111 Bacteria 2695
489 Ga0500594_0015270 3300053118 Bacteria 1851
490 Ga0500642_0004048 3300053130 Bacteria 4527
491 Ga0500559_0115395 3300053136 Bacteria 1246
492 Ga0500568_0007656 3300053139 Bacteria 5277
493 Ga0500588_0004176 3300053146 Bacteria 3109
494 Ga0500603_019676 3300053150 Bacteria 1641
495 Ga0500616_0012484 3300053153 Bacteria 4970
496 Ga0500611_000043 3300053727 Bacteria 58183
497 2738730491 2738541278 Bacteria 9755573
498 2740031825 2739367866 Bacteria 4215900
499 2819575656 2818991442 Bacteria 8318214
500 2821138205 2821136567 Bacteria 8080116
501 2839990366 2839989709 Bacteria 3773432
502 2881957500 2881955468 Bacteria 3545609
503 2904469000 2904467357 Bacteria 8057758
504 2910249289 2910245624 Bacteria 6935613
505 2929180946 2929177148 Bacteria 7883697
506 2945983345 2945977869 Bacteria 7777518
507 2946017265 2946013367 Bacteria 7766675
508 Ga0070673_100045629
509 SwRhRL2b_contig_677025
510 MRS1b_contig_4645766
511 rootH2_10054391
512 rootH2_10097470
513 rootH2_10101990
514 rootL2_10081290
515 rootL2_10174882
516 rootL2_10243019
517 rootH1_10039716
518 rootH1_10128599
519 rootH1_10191702
520 rootH1_10247663
521 JGI25160J50197_1001251
522 Ga0065165_1026799
523 Ga0065704_10070133
524 Ga0065704_10076804
525 Ga0065712_10013733
526 Ga0065712_10070873
527 Ga0065715_10143036
528 Ga0065707_10103077
529 Ga0070658_10099680
530 Ga0070676_10021487
531 Ga0070683_100008776
532 Ga0070683_100034916
533 Ga0070690_100218268
534 Ga0070670_100081393
535 Ga0070670_100284459
536 Ga0070677_10052234
537 Ga0070677_10081719
538 Ga0068869_100008103
539 Ga0068869_100020521
540 Ga0068869_100042451
541 Ga0068869_100139172
542 Ga0068869_100248287
543 Ga0070666_10000024
544 Ga0070666_10076117
545 Ga0068868_100020162
546 Ga0068868_100034913
547 Ga0068868_100093128
548 Ga0068868_100105364
549 Ga0070689_100021688
550 Ga0070689_100023713
551 Ga0070689_100314121
552 Ga0070687_100005468
553 Ga0070661_100005591
554 Ga0070661_100039560
555 Ga0070661_100043829
556 Ga0070668_100007250
557 Ga0070668_100016281
558 Ga0070669_100007472
559 Ga0070669_100116724
560 Ga0070669_100341115
561 Ga0070675_100003118
562 Ga0070675_100006327
563 Ga0070675_100094451
564 Ga0070675_100107099
565 Ga0070675_100144265
566 Ga0070671_100132709
567 Ga0070673_100005255
568 Ga0070673_100050469
569 Ga0070673_100065452
570 Ga0070673_100070069
571 Ga0070673_100184192
572 Ga0070688_100001769
573 Ga0070688_100002985
574 Ga0070688_100061663
575 Ga0070688_100097524
576 Ga0070659_100027483
577 Ga0070659_100076744
578 Ga0070659_100424118
579 Ga0070667_100003179
580 Ga0070667_100074169
581 Ga0070667_100094756
582 Ga0070700_100047183
583 Ga0070662_100012086
584 Ga0070662_100020889
585 Ga0070662_100258314
586 Ga0070681_10108845
587 Ga0068867_100019746
588 Ga0070685_10009929
589 Ga0070685_10040719
590 Ga0070698_100004775
591 Ga0070698_100016643
592 Ga0070698_100040903
593 Ga0070679_100001952
594 Ga0070684_100024657
595 Ga0070684_100049345
596 Ga0068853_100005327
597 Ga0068853_100036151
598 Ga0068853_100042464
599 Ga0068853_100114387
600 Ga0068853_100155445
601 Ga0070672_100061320
602 Ga0070672_100121552
603 Ga0070686_100201633
604 Ga0070693_100034893
605 Ga0070665_100038235
606 Ga0070665_100245783
607 Ga0068855_100011960
608 Ga0068855_100012864
609 Ga0068855_100181372
610 Ga0070664_100029509
611 Ga0070664_100040204
612 Ga0070664_100078803
613 Ga0070664_100106129
614 Ga0068857_100005870
615 Ga0068857_100008333
616 Ga0068857_100032860
617 Ga0068857_100091857
618 Ga0068857_100147564
619 Ga0068856_100004037
620 Ga0068856_100026118
621 Ga0068852_100008954
622 Ga0068852_100032325
623 Ga0068852_100606993
624 Ga0068859_100000018
625 Ga0068859_100012863
626 Ga0068859_100108344
627 Ga0068859_100141239
628 Ga0068859_100427601
629 Ga0068864_100004617
630 Ga0068864_100030265
631 Ga0068864_100061948
632 Ga0068861_100001157
633 Ga0068861_100278300
634 Ga0068851_10019028
635 Ga0068851_10027860
636 Ga0068870_10143496
637 Ga0068863_100012262
638 Ga0068863_100028337
639 Ga0068863_100042276
640 Ga0068863_100237667
641 Ga0068858_100020038
642 Ga0068860_100006531
643 Ga0068860_100010513
644 Ga0068860_100044556
645 Ga0068860_100084109
646 Ga0068860_100284517
647 Ga0068860_100286587
648 Ga0068862_100213770
649 Ga0068862_100492405
650 Ga0097621_100016505
651 Ga0097621_100077532
652 Ga0068871_100029369
653 Ga0075428_100006899
654 Ga0075428_100058117
655 Ga0075430_100011931
656 Ga0075434_100265752
657 Ga0075429_100032466
658 Ga0068865_100010406
659 Ga0068865_100039383
660 Ga0097620_100000018
661 Ga0097620_100012863
662 Ga0097620_100108340
663 Ga0097620_100141242
664 Ga0097620_100292825
665 Ga0097620_100427587
666 Ga0105251_10037895
667 Ga0105240_10000152
668 Ga0105240_10000991
669 Ga0105240_10141681
670 Ga0111539_10006032
671 Ga0111539_10282951
672 Ga0114129_10060366
673 Ga0105241_10007471
674 Ga0105241_10009094
675 Ga0105242_10009911
676 Ga0105242_10022998
677 Ga0105242_10033060
678 Ga0105242_10107826
679 Ga0105237_10008915
680 Ga0105237_10022087
681 Ga0105238_10183212
682 Ga0105249_10001879
683 Ga0105249_10003657
684 Ga0105249_10011900
685 Ga0105249_10030582
686 Ga0105249_10054055
687 Ga0105249_10237815
688 Ga0105239_10022910
689 Ga0105239_10026016
690 Ga0105239_10083039
691 Ga0105239_10316179
692 Ga0105246_10025203
693 Ga0105246_10082160
694 Ga0157371_10136859
695 Ga0157370_10009541
696 Ga0157370_10011610
697 Ga0157369_10043490
698 Ga0157369_10136329
699 Ga0157369_10407513
700 Ga0157374_10000002
701 Ga0157374_10004340
702 Ga0157374_10035268
703 Ga0157374_10047891
704 Ga0157374_10051476
705 Ga0157374_10059776
706 Ga0157374_10205471
707 Ga0157378_10008463
708 Ga0157378_10012811
709 Ga0157378_10034319
710 Ga0163162_10001022
711 Ga0163162_10003497
712 Ga0163162_10295107
713 Ga0157372_10011678
714 Ga0157372_10014977
715 Ga0157372_10198323
716 Ga0157372_10507946
717 Ga0157375_10021522
718 Ga0157375_10043443
719 Ga0157375_10104327
720 Ga0157375_10206499
721 Ga0157375_10263136
722 Ga0163163_10020531
723 Ga0163163_10046510
724 Ga0163163_10311586
725 Ga0157380_10010202
726 Ga0157380_10028823
727 Ga0157380_10123039
728 Ga0157380_10346268
729 Ga0157377_10002352
730 Ga0157377_10020412
731 Ga0157377_10082363
732 Ga0157379_10124144
733 Ga0157379_10125340
734 Ga0157379_10160317
735 Ga0157379_10374595
736 Ga0157376_10002193
737 Ga0157376_10005066
738 Ga0157376_10016712
739 Ga0157376_10040883
740 Ga0182005_1000126
741 Ga0163161_10001931
742 Ga0163161_10097236
743 Ga0213876_10056680
744 Ga0209436_103438
745 Ga0207426_1000009
746 Ga0207682_10090909
747 Ga0207688_10005125
748 Ga0207688_10080220
749 Ga0207680_10000026
750 Ga0207680_10024323
751 Ga0207680_10038463
752 Ga0207647_10063108
753 Ga0207647_10070731
754 Ga0207647_10127289
755 Ga0207645_10008796
756 Ga0207643_10026659
757 Ga0207654_10001418
758 Ga0207654_10064195
759 Ga0207707_10044052
760 Ga0207707_10053658
761 Ga0207695_10000666
762 Ga0207695_10052130
763 Ga0207695_10077030
764 Ga0207671_10019665
765 Ga0207671_10025216
766 Ga0207660_10024790
767 Ga0207662_10013510
768 Ga0207657_10026796
769 Ga0207657_10144027
770 Ga0207649_10009010
771 Ga0207649_10130925
772 Ga0207652_10000115
773 Ga0207652_10000258
774 Ga0207681_10002862
775 Ga0207681_10165077
776 Ga0207694_10032549
777 Ga0207650_10007216
778 Ga0207650_10121327
779 Ga0207650_10211542
780 Ga0207650_10220498
781 Ga0207659_10014825
782 Ga0207659_10361347
783 Ga0207644_10048503
784 Ga0207706_10006315
785 Ga0207706_10030504
786 Ga0207706_10035708
787 Ga0207686_10000909
788 Ga0207670_10004427
789 Ga0207670_10058867
790 Ga0207704_10178908
791 Ga0207691_10059890
792 Ga0207691_10097522
793 Ga0207689_10001523
794 Ga0207689_10006429
795 Ga0207689_10009053
796 Ga0207689_10012708
797 Ga0207689_10019064
798 Ga0207689_10052575
799 Ga0207679_10070229
800 Ga0207679_10164253
801 Ga0207679_10316949
802 Ga0207667_10014573
803 Ga0207667_10225885
804 Ga0207651_10036505
805 Ga0207651_10044011
806 Ga0207651_10046956
807 Ga0207651_10062814
808 Ga0207712_10022943
809 Ga0207712_10029125
810 Ga0207712_10223238
811 Ga0207668_10079042
812 Ga0207668_10311051
813 Ga0207658_10026812
814 Ga0207658_10066920
815 Ga0207658_10080085
816 Ga0207677_10006223
817 Ga0207677_10045943
818 Ga0207677_10048089
819 Ga0207677_10168347
820 Ga0207677_10446678
821 Ga0207703_10026602
822 Ga0207639_10001323
823 Ga0207639_10019961
824 Ga0207639_10032425
825 Ga0207639_10106208
826 Ga0207678_10080570
827 Ga0207708_10034047
828 Ga0207708_10043383
829 Ga0207702_10087210
830 Ga0207641_10000167
831 Ga0207641_10005899
832 Ga0207641_10017281
833 Ga0207641_10110408
834 Ga0207641_10112251
835 Ga0207648_10002320
836 Ga0207648_10030355
837 Ga0207648_10435034
838 Ga0207676_10004370
839 Ga0207676_10022412
840 Ga0207676_10442232
841 Ga0207674_10005497
842 Ga0207674_10021248
843 Ga0207674_10068615
844 Ga0207674_10080560
845 Ga0207674_10136086
846 Ga0207674_10163078
847 Ga0207675_100000422
848 Ga0207675_100053361
849 Ga0207675_100117740
850 Ga0207683_10012847
851 Ga0207683_10014189
852 Ga0207698_10046482
853 Ga0207698_10192088
854 Ga0207698_10204673
855 Ga0207698_10230670
856 Ga0207698_10266035
857 Ga0207698_10289552
858 Ga0268265_10002951
859 Ga0268265_10060284
860 Ga0268265_10164096
861 Ga0268264_10014592
862 Ga0268264_10079097
863 Ga0268264_10098761
864 Ga0268264_10166529
865 Ga0268264_10477386
866 Ga0307515_10000677
867 Ga0307511_10000498
868 Ga0265327_10000054
869 Ga0265327_10002040
870 Ga0307509_10125471
871 Ga0307509_10149564
872 Ga0307508_10003711
873 Ga0307410_10177806
874 Ga0307406_10103581
875 Ga0307411_10132753
876 Ga0307510_10189720
877 Ga0373934_0040490
878 Ga0373923_0033556
879 Ga0373955_0037671
880 Ga0373937_0013982
881 Ga0316584_0036221
882 Ga0395900_0012750
883 Ga0395900_0157819
884 Ga0395900_0294875
885 Ga0395898_0125241
886 Ga0395898_0241007
887 Ga0395905_0001979
888 Ga0395905_0018736
889 Ga0395905_0296872
890 Ga0395901_0027637
891 Ga0395901_0210464
892 Ga0395901_0215670
893 Ga0436365_1551316
894 Ga0439436_0010209
895 Ga0439431_0007093
896 Ga0439441_003969
897 Ga0439442_008401
898 Ga0439457_008944
899 Ga0450898_002137
900 Ga0439434_0004131
901 Ga0466969_0000033
902 Ga0466972_0000020
903 Ga0466972_0001881
904 Ga0466972_0006196
905 Ga0466972_0065365
906 Ga0466966_0000543
907 Ga0466970_0000117
908 Ga0466957_0004183
909 Ga0466959_0000048
910 Ga0451576_0000012
911 Ga0466967_0251126
912 Ga0495618_0060077
913 Ga0495628_0258612
914 Ga0495668_0000562
915 Ga0495668_0015003
916 Ga0495634_0017536
917 Ga0495625_0312151
918 Ga0495613_0294019
919 Ga0495600_0161827
920 Ga0495672_0031761
921 Ga0495686_0000102
922 Ga0495686_0000616
923 Ga0495686_0007468
924 Ga0495686_0111670
925 Ga0496115_0009506
926 Ga0496115_0276411
927 Ga0496121_0000007
928 Ga0501300_003603
929 Ga0501032_0273209
930 Ga0501034_0000114
931 Ga0501034_0006325
932 Ga0501034_0035010
933 Ga0501034_0054023
934 Ga0501036_0003899
935 Ga0501036_0003983
936 Ga0501037_0077973
937 Ga0501038_0046785
938 Ga0501038_0196965
939 Ga0501039_0152977
940 Ga0501043_0006741
941 Ga0501043_0009529
942 Ga0501043_0034395
943 Ga0501046_0005622
944 Ga0501046_0080280
945 Ga0501047_0049425
946 Ga0501047_0108388
947 Ga0501048_0010212
948 Ga0501070_0024534
949 Ga0501073_0014124
950 Ga0501074_0000510
951 Ga0501201_000261
952 Ga0501202_003309
953 Ga0501206_002032
954 Ga0501207_002877
955 Ga0501217_002762
956 Ga0501217_003653
957 Ga0501222_002063
958 Ga0501222_010281
959 Ga0501223_007952
960 Ga0501223_018621
961 Ga0501233_009522
962 Ga0501235_003819
963 Ga0501243_001285
964 Ga0501243_011457
965 Ga0501257_022672
966 Ga0501259_002604
967 Ga0501261_000863
968 Ga0501219_001347
969 Ga0501221_002560
970 Ga0501225_0001099
971 Ga0501225_0006568
972 Ga0501225_0012593
973 Ga0501225_0021186
974 Ga0501234_002357
975 Ga0501245_000465
976 Ga0501083_0007826
977 Ga0501241_002800
978 Ga0501035_0006493
979 Ga0501035_0116952
980 Ga0501044_0002053
981 Ga0501044_0044442
982 Ga0501044_0275349
983 Ga0501284_00078
984 nmdc:mga0k408_58540_c1
985 nmdc:mga0k408_8244_c1
986 nmdc:mga05p37_48169_c1
987 nmdc:mga09592_27982_c1
988 nmdc:mga06r32_98013_c1
989 nmdc:mga08y16_171938_c1
990 nmdc:mga08y16_9852_c1
991 Ga0500578_0000097
992 Ga0500583_0000031
993 Ga0500583_0049958
994 Ga0500555_053772
995 Ga0500572_006399
996 Ga0500594_0015270
997 Ga0500642_0004048
998 Ga0500559_0115395
999 Ga0500568_0007656
1000 Ga0500588_0004176
1001 Ga0500603_019676
1002 Ga0500616_0012484
1003 Ga0500611_000043
1004 2738730491
1005 2740031825
1006 2819575656
1007 2821138205
1008 2839990366
1009 2881957500
1010 2904469000
1011 2910249289
1012 2929180946
1013 2945983345
1014 2946017265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

178

385

0.98

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

38

167

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7953 119 337
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7846 119 331
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7783 119 337
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7721 117 335
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7577 119 331
ID Description Score Start End Superfamily
af_Q2FVE8_90_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9101 116 341 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9038 109 345 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9029 114 340 1.10.3720.10
af_Q2FVE8_90_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8981 116 341 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8966 118 343 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X7JW00-F1-model_v4 ABC transporter permease 0.9464 106 347 GO:0005886
GO:0055085
AF-A0A6N8YYI3-F1-model_v4 ABC transporter permease 0.9329 1 346 GO:0005886
GO:0055085
AF-H1LYI9-F1-model_v4 ABC transporter, permease protein 0.9293 114 347 GO:0005886
GO:0055085
AF-H5SIH0-F1-model_v4 Peptide/nickel transport system permease protein 0.9279 1 347 GO:0005886
GO:0055085
AF-A0A496P9E7-F1-model_v4 ABC transporter permease 0.9272 105 346 GO:0005886
GO:0055085

Map