F456618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 507 | 231 | 502 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10165614|rootH2_101656142 |
| Length | 283 |
| Sequence | MHLKKCTTATWSRVSSNLYNMRLLDKVIIVTGSTTGIGKAIAIRCAAEGAKILLHGLEQDWGNEVLTAIGPEKAALHIEDISAEGAPQRLVDKALQTFGKLDAVVNNAAWVVSSNITTTDIPFLQKVLNINTRAPFLLIKEALPHLSRTKGAVLNIGSVNAYSGEPDLMAYSISKGALMTMTRNLGDTLHREYGVRVNQINPGWVLTETEIQRKKEHGLADNWYEALPRVYAPAGRILRPAEIAAAAVYWLADESGPISGQVVDLEQHPFIGRNPPKDNTTIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 2 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 3 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 4 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 80 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 81 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 152 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 153 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 154 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 155 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 177 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 206 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 213 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 216 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 217 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 223 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 229 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.76 |
| Nodule | 0.59 |
| Rhizoplane | 0.59 |
| Rhizosphere | 93.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009163 | 3300001979 | Bacteria | 3891 |
| 2 | JGI24739J22299_10104297 | 3300001989 | Bacteria | 854 |
| 3 | JGI25151J46595_10000952 | 3300003187 | Bacteria | 22247 |
| 4 | JGI25406J46586_10002360 | 3300003203 | Bacteria | 8925 |
| 5 | rootH1_10072465 | 3300003316 | Bacteria | 2170 |
| 6 | rootH2_10165614 | 3300003320 | Bacteria | 1800 |
| 7 | rootH2_10186666 | 3300003320 | Unclassified | 3045 |
| 8 | rootL2_10106600 | 3300003322 | Bacteria | 1923 |
| 9 | rootH1_10001888 | 3300003323 | Bacteria | 7128 |
| 10 | rootH1_10195033 | 3300003323 | Bacteria | 1451 |
| 11 | JGI25160J50197_1000662 | 3300003354 | Bacteria | 19194 |
| 12 | Ga0065715_10105285 | 3300005293 | Unclassified | 2901 |
| 13 | Ga0070658_10220953 | 3300005327 | Unclassified | 1602 |
| 14 | Ga0070658_10241992 | 3300005327 | Unclassified | 1529 |
| 15 | Ga0070683_100002178 | 3300005329 | Bacteria | 15494 |
| 16 | Ga0070683_100002417 | 3300005329 | Bacteria | 14841 |
| 17 | Ga0070683_100011503 | 3300005329 | Bacteria | 7655 |
| 18 | Ga0070683_100030627 | 3300005329 | Bacteria | 4887 |
| 19 | Ga0070690_100056643 | 3300005330 | Bacteria | 2514 |
| 20 | Ga0070690_100093667 | 3300005330 | Unclassified | 1982 |
| 21 | Ga0070670_100092248 | 3300005331 | Bacteria | 2604 |
| 22 | Ga0070677_10061330 | 3300005333 | Bacteria | 1552 |
| 23 | Ga0068869_100009364 | 3300005334 | Bacteria | 6355 |
| 24 | Ga0068869_100029840 | 3300005334 | Unclassified | 3824 |
| 25 | Ga0068869_100031122 | 3300005334 | Bacteria | 3753 |
| 26 | Ga0068869_100053980 | 3300005334 | Bacteria | 2923 |
| 27 | Ga0068869_100056294 | 3300005334 | Bacteria | 2868 |
| 28 | Ga0068869_100070401 | 3300005334 | Bacteria | 2588 |
| 29 | Ga0068869_100197578 | 3300005334 | Bacteria | 1584 |
| 30 | Ga0068869_100221071 | 3300005334 | Bacteria | 1501 |
| 31 | Ga0068869_100439729 | 3300005334 | Bacteria | 1079 |
| 32 | Ga0070666_10014461 | 3300005335 | Bacteria | 5025 |
| 33 | Ga0070666_10133269 | 3300005335 | Bacteria | 1727 |
| 34 | Ga0070680_100007029 | 3300005336 | Bacteria | 8579 |
| 35 | Ga0070680_100008276 | 3300005336 | Bacteria | 7955 |
| 36 | Ga0070680_100116804 | 3300005336 | Bacteria | 2224 |
| 37 | Ga0070680_100318639 | 3300005336 | Bacteria | 1320 |
| 38 | Ga0070682_100002037 | 3300005337 | Bacteria | 11287 |
| 39 | Ga0070682_100043847 | 3300005337 | Bacteria | 2767 |
| 40 | Ga0068868_100041008 | 3300005338 | Unclassified | 3605 |
| 41 | Ga0070660_100000709 | 3300005339 | Bacteria | 22037 |
| 42 | Ga0070660_100019733 | 3300005339 | Bacteria | 4944 |
| 43 | Ga0070660_100108139 | 3300005339 | Bacteria | 2210 |
| 44 | Ga0070660_100188193 | 3300005339 | Bacteria | 1671 |
| 45 | Ga0070660_100217507 | 3300005339 | Bacteria | 1552 |
| 46 | Ga0070660_100280418 | 3300005339 | Bacteria | 1363 |
| 47 | Ga0070689_100192282 | 3300005340 | Bacteria | 1662 |
| 48 | Ga0070691_10014719 | 3300005341 | Bacteria | 3591 |
| 49 | Ga0070687_100118240 | 3300005343 | Bacteria | 1511 |
| 50 | Ga0070661_100001463 | 3300005344 | Bacteria | 16401 |
| 51 | Ga0070661_100003861 | 3300005344 | Bacteria | 10311 |
| 52 | Ga0070668_100030905 | 3300005347 | Bacteria | 4074 |
| 53 | Ga0070668_100033492 | 3300005347 | Unclassified | 3913 |
| 54 | Ga0070669_100009965 | 3300005353 | Bacteria | 6758 |
| 55 | Ga0070669_100019533 | 3300005353 | Bacteria | 4839 |
| 56 | Ga0070669_100286466 | 3300005353 | Unclassified | 1321 |
| 57 | Ga0070675_100060546 | 3300005354 | Bacteria | 3126 |
| 58 | Ga0070675_100061227 | 3300005354 | Bacteria | 3107 |
| 59 | Ga0070675_100121323 | 3300005354 | Unclassified | 2221 |
| 60 | Ga0070675_100274482 | 3300005354 | Bacteria | 1480 |
| 61 | Ga0070675_100476566 | 3300005354 | Bacteria | 1122 |
| 62 | Ga0070671_100076258 | 3300005355 | Bacteria | 2801 |
| 63 | Ga0070671_100292184 | 3300005355 | Bacteria | 1387 |
| 64 | Ga0070671_100413834 | 3300005355 | Bacteria | 1154 |
| 65 | Ga0070674_100050165 | 3300005356 | Unclassified | 2872 |
| 66 | Ga0070673_100063853 | 3300005364 | Unclassified | 2932 |
| 67 | Ga0070673_100069030 | 3300005364 | Bacteria | 2832 |
| 68 | Ga0070673_100379397 | 3300005364 | Unclassified | 1260 |
| 69 | Ga0070688_100391450 | 3300005365 | Bacteria | 1027 |
| 70 | Ga0070659_100007003 | 3300005366 | Bacteria | 8164 |
| 71 | Ga0070659_100008743 | 3300005366 | Bacteria | 7412 |
| 72 | Ga0070659_100184146 | 3300005366 | Bacteria | 1714 |
| 73 | Ga0070667_100043984 | 3300005367 | Bacteria | 3749 |
| 74 | Ga0070667_100108520 | 3300005367 | Bacteria | 2405 |
| 75 | Ga0070667_100399836 | 3300005367 | Bacteria | 1250 |
| 76 | Ga0070667_100736383 | 3300005367 | Bacteria | 913 |
| 77 | Ga0070667_100754951 | 3300005367 | Bacteria | 902 |
| 78 | Ga0070678_100039308 | 3300005456 | Unclassified | 3336 |
| 79 | Ga0070678_100124117 | 3300005456 | Bacteria | 2041 |
| 80 | Ga0070678_100144629 | 3300005456 | Bacteria | 1907 |
| 81 | Ga0070662_100025036 | 3300005457 | Bacteria | 4118 |
| 82 | Ga0070662_100091358 | 3300005457 | Unclassified | 2286 |
| 83 | Ga0070662_100108878 | 3300005457 | Bacteria | 2108 |
| 84 | Ga0070662_100259634 | 3300005457 | Bacteria | 1399 |
| 85 | Ga0070681_10029132 | 3300005458 | Bacteria | 5543 |
| 86 | Ga0070681_10295220 | 3300005458 | Bacteria | 1531 |
| 87 | Ga0068867_100054306 | 3300005459 | Bacteria | 2960 |
| 88 | Ga0068867_100056378 | 3300005459 | Unclassified | 2907 |
| 89 | Ga0068867_100092884 | 3300005459 | Unclassified | 2292 |
| 90 | Ga0068867_100159032 | 3300005459 | Bacteria | 1780 |
| 91 | Ga0070685_10065120 | 3300005466 | Bacteria | 2145 |
| 92 | Ga0070685_10169085 | 3300005466 | Bacteria | 1400 |
| 93 | Ga0070679_100068617 | 3300005530 | Bacteria | 3536 |
| 94 | Ga0070679_100201966 | 3300005530 | Bacteria | 1953 |
| 95 | Ga0070679_100202658 | 3300005530 | Unclassified | 1949 |
| 96 | Ga0070679_100238660 | 3300005530 | Unclassified | 1776 |
| 97 | Ga0070684_100008384 | 3300005535 | Bacteria | 8074 |
| 98 | Ga0070684_100123197 | 3300005535 | Unclassified | 2333 |
| 99 | Ga0070684_100214237 | 3300005535 | Bacteria | 1756 |
| 100 | Ga0068853_100004573 | 3300005539 | Bacteria | 10729 |
| 101 | Ga0068853_100331735 | 3300005539 | Bacteria | 1412 |
| 102 | Ga0068853_100764313 | 3300005539 | Unclassified | 924 |
| 103 | Ga0070672_100045223 | 3300005543 | Unclassified | 3404 |
| 104 | Ga0070672_100277492 | 3300005543 | Bacteria | 1416 |
| 105 | Ga0070672_100541141 | 3300005543 | Bacteria | 1010 |
| 106 | Ga0070665_100051542 | 3300005548 | Unclassified | 4127 |
| 107 | Ga0070665_100179809 | 3300005548 | Unclassified | 2116 |
| 108 | Ga0068855_100006753 | 3300005563 | Bacteria | 13918 |
| 109 | Ga0068855_100016996 | 3300005563 | Bacteria | 8749 |
| 110 | Ga0068855_100018440 | 3300005563 | Bacteria | 8386 |
| 111 | Ga0068855_100332881 | 3300005563 | Bacteria | 1676 |
| 112 | Ga0068855_100408701 | 3300005563 | Bacteria | 1486 |
| 113 | Ga0070664_100016825 | 3300005564 | Bacteria | 6003 |
| 114 | Ga0070664_100058799 | 3300005564 | Unclassified | 3270 |
| 115 | Ga0070664_100062152 | 3300005564 | Bacteria | 3183 |
| 116 | Ga0070664_100201285 | 3300005564 | Bacteria | 1777 |
| 117 | Ga0070664_100621121 | 3300005564 | Unclassified | 1003 |
| 118 | Ga0068857_100001588 | 3300005577 | Bacteria | 18219 |
| 119 | Ga0068857_100003611 | 3300005577 | Bacteria | 12957 |
| 120 | Ga0068857_100010207 | 3300005577 | Bacteria | 8165 |
| 121 | Ga0068857_100015293 | 3300005577 | Bacteria | 6698 |
| 122 | Ga0068857_100020090 | 3300005577 | Bacteria | 5871 |
| 123 | Ga0068857_100219696 | 3300005577 | Bacteria | 1735 |
| 124 | Ga0068854_100045217 | 3300005578 | Bacteria | 3130 |
| 125 | Ga0068854_100317772 | 3300005578 | Bacteria | 1265 |
| 126 | Ga0068854_100446468 | 3300005578 | Unclassified | 1079 |
| 127 | Ga0068856_100009543 | 3300005614 | Bacteria | 9429 |
| 128 | Ga0068856_100042155 | 3300005614 | Bacteria | 4489 |
| 129 | Ga0068856_100296011 | 3300005614 | Bacteria | 1635 |
| 130 | Ga0068856_100420992 | 3300005614 | Bacteria | 1355 |
| 131 | Ga0068852_100000410 | 3300005616 | Bacteria | 28619 |
| 132 | Ga0068852_100005821 | 3300005616 | Bacteria | 8851 |
| 133 | Ga0068852_100076693 | 3300005616 | Bacteria | 2952 |
| 134 | Ga0068852_100181987 | 3300005616 | Bacteria | 1977 |
| 135 | Ga0068852_100415199 | 3300005616 | Bacteria | 1326 |
| 136 | Ga0068852_100676743 | 3300005616 | Bacteria | 1041 |
| 137 | Ga0068859_100016717 | 3300005617 | Bacteria | 7365 |
| 138 | Ga0068859_100024651 | 3300005617 | Bacteria | 6037 |
| 139 | Ga0068859_100161511 | 3300005617 | Bacteria | 2319 |
| 140 | Ga0068864_100070143 | 3300005618 | Bacteria | 3049 |
| 141 | Ga0068864_100083315 | 3300005618 | Bacteria | 2808 |
| 142 | Ga0068861_100007343 | 3300005719 | Bacteria | 7550 |
| 143 | Ga0068861_100016538 | 3300005719 | Bacteria | 5222 |
| 144 | Ga0068863_100271099 | 3300005841 | Bacteria | 1643 |
| 145 | Ga0068860_100004009 | 3300005843 | Bacteria | 15116 |
| 146 | Ga0068860_100014023 | 3300005843 | Bacteria | 7862 |
| 147 | Ga0068860_100035569 | 3300005843 | Bacteria | 4777 |
| 148 | Ga0068860_100056169 | 3300005843 | Unclassified | 3744 |
| 149 | Ga0068860_100328540 | 3300005843 | Bacteria | 1502 |
| 150 | Ga0068860_100523107 | 3300005843 | Unclassified | 1186 |
| 151 | Ga0068862_100009417 | 3300005844 | Bacteria | 8080 |
| 152 | Ga0068862_100039601 | 3300005844 | Bacteria | 4003 |
| 153 | Ga0068862_100099588 | 3300005844 | Unclassified | 2541 |
| 154 | Ga0081539_10000338 | 3300005985 | Bacteria | 103849 |
| 155 | Ga0075364_10099580 | 3300006051 | Bacteria | 1935 |
| 156 | Ga0097621_100025618 | 3300006237 | Bacteria | 4616 |
| 157 | Ga0097621_100096643 | 3300006237 | Bacteria | 2479 |
| 158 | Ga0097621_100125831 | 3300006237 | Bacteria | 2177 |
| 159 | Ga0097621_100189009 | 3300006237 | Bacteria | 1783 |
| 160 | Ga0097621_100244900 | 3300006237 | Unclassified | 1568 |
| 161 | Ga0097621_100347834 | 3300006237 | Bacteria | 1318 |
| 162 | Ga0097621_100358551 | 3300006237 | Bacteria | 1298 |
| 163 | Ga0068871_100004069 | 3300006358 | Bacteria | 10115 |
| 164 | Ga0068871_100191390 | 3300006358 | Unclassified | 1762 |
| 165 | Ga0075428_100007909 | 3300006844 | Bacteria | 11789 |
| 166 | Ga0075428_100338452 | 3300006844 | Bacteria | 1616 |
| 167 | Ga0075429_100022346 | 3300006880 | Bacteria | 5486 |
| 168 | Ga0075429_100421559 | 3300006880 | Bacteria | 1169 |
| 169 | Ga0075429_100447183 | 3300006880 | Unclassified | 1132 |
| 170 | Ga0068865_100150648 | 3300006881 | Bacteria | 1764 |
| 171 | Ga0068865_100276612 | 3300006881 | Bacteria | 1335 |
| 172 | Ga0097620_100016719 | 3300006931 | Bacteria | 7365 |
| 173 | Ga0097620_100024651 | 3300006931 | Bacteria | 6037 |
| 174 | Ga0097620_100161510 | 3300006931 | Bacteria | 2319 |
| 175 | Ga0105240_10001165 | 3300009093 | Bacteria | 46077 |
| 176 | Ga0105240_10001264 | 3300009093 | Bacteria | 43767 |
| 177 | Ga0105240_10004678 | 3300009093 | Bacteria | 20688 |
| 178 | Ga0105240_10005683 | 3300009093 | Bacteria | 18511 |
| 179 | Ga0105240_10144907 | 3300009093 | Bacteria | 2835 |
| 180 | Ga0111539_10001995 | 3300009094 | Bacteria | 27227 |
| 181 | Ga0111539_10039960 | 3300009094 | Bacteria | 5649 |
| 182 | Ga0111539_10066664 | 3300009094 | Bacteria | 4252 |
| 183 | Ga0105247_10110004 | 3300009101 | Bacteria | 1772 |
| 184 | Ga0105247_10167630 | 3300009101 | Bacteria | 1458 |
| 185 | Ga0114129_10007759 | 3300009147 | Bacteria | 15265 |
| 186 | Ga0105241_10001366 | 3300009174 | Bacteria | 18591 |
| 187 | Ga0105241_10020047 | 3300009174 | Bacteria | 4938 |
| 188 | Ga0105241_10114802 | 3300009174 | Unclassified | 2161 |
| 189 | Ga0105241_10327022 | 3300009174 | Unclassified | 1324 |
| 190 | Ga0105241_10528224 | 3300009174 | Unclassified | 1056 |
| 191 | Ga0105242_10088686 | 3300009176 | Unclassified | 2599 |
| 192 | Ga0105242_10208089 | 3300009176 | Bacteria | 1741 |
| 193 | Ga0105248_10265123 | 3300009177 | Bacteria | 1934 |
| 194 | Ga0105237_10014557 | 3300009545 | Bacteria | 8220 |
| 195 | Ga0105237_10136947 | 3300009545 | Bacteria | 2443 |
| 196 | Ga0105237_10216184 | 3300009545 | Unclassified | 1917 |
| 197 | Ga0105238_10011379 | 3300009551 | Bacteria | 8957 |
| 198 | Ga0105238_10035408 | 3300009551 | Bacteria | 5076 |
| 199 | Ga0105238_10119004 | 3300009551 | Bacteria | 2621 |
| 200 | Ga0105249_10094322 | 3300009553 | Bacteria | 2805 |
| 201 | Ga0105249_10158730 | 3300009553 | Bacteria | 2184 |
| 202 | Ga0105249_10350113 | 3300009553 | Bacteria | 1496 |
| 203 | Ga0123341_1000054 | 3300009765 | Bacteria | 48678 |
| 204 | Ga0123342_1006389 | 3300009766 | Bacteria | 16386 |
| 205 | Ga0105033_100448 | 3300009986 | Bacteria | 3198 |
| 206 | Ga0105239_10014753 | 3300010375 | Bacteria | 8665 |
| 207 | Ga0105239_10032134 | 3300010375 | Bacteria | 5768 |
| 208 | Ga0105239_10108166 | 3300010375 | Bacteria | 3081 |
| 209 | Ga0105239_10161438 | 3300010375 | Unclassified | 2504 |
| 210 | Ga0157373_10034656 | 3300013100 | Bacteria | 3626 |
| 211 | Ga0157373_10241560 | 3300013100 | Unclassified | 1277 |
| 212 | Ga0157371_10012767 | 3300013102 | Bacteria | 6404 |
| 213 | Ga0157371_10017210 | 3300013102 | Bacteria | 5374 |
| 214 | Ga0157371_10048931 | 3300013102 | Unclassified | 3004 |
| 215 | Ga0157371_10071117 | 3300013102 | Unclassified | 2463 |
| 216 | Ga0157371_10090968 | 3300013102 | Unclassified | 2161 |
| 217 | Ga0157371_10190028 | 3300013102 | Bacteria | 1470 |
| 218 | Ga0157370_10020571 | 3300013104 | Bacteria | 6589 |
| 219 | Ga0157370_10058722 | 3300013104 | Bacteria | 3656 |
| 220 | Ga0157370_10168298 | 3300013104 | Unclassified | 2038 |
| 221 | Ga0157370_10176928 | 3300013104 | Unclassified | 1983 |
| 222 | Ga0157370_10634471 | 3300013104 | Bacteria | 977 |
| 223 | Ga0157369_10025905 | 3300013105 | Bacteria | 6507 |
| 224 | Ga0157369_10085498 | 3300013105 | Bacteria | 3370 |
| 225 | Ga0157369_10088117 | 3300013105 | Bacteria | 3313 |
| 226 | Ga0157369_10148890 | 3300013105 | Bacteria | 2474 |
| 227 | Ga0157369_10435959 | 3300013105 | Bacteria | 1358 |
| 228 | Ga0157374_10001327 | 3300013296 | Bacteria | 21026 |
| 229 | Ga0157374_10023391 | 3300013296 | Bacteria | 5527 |
| 230 | Ga0157374_10061971 | 3300013296 | Bacteria | 3504 |
| 231 | Ga0157374_10066516 | 3300013296 | Bacteria | 3387 |
| 232 | Ga0157374_10094217 | 3300013296 | Bacteria | 2861 |
| 233 | Ga0157374_10355879 | 3300013296 | Bacteria | 1455 |
| 234 | Ga0157378_10047291 | 3300013297 | Unclassified | 3825 |
| 235 | Ga0157378_10077309 | 3300013297 | Bacteria | 3000 |
| 236 | Ga0163162_10018838 | 3300013306 | Bacteria | 6767 |
| 237 | Ga0163162_10049855 | 3300013306 | Bacteria | 4198 |
| 238 | Ga0163162_10127133 | 3300013306 | Bacteria | 2656 |
| 239 | Ga0163162_10239760 | 3300013306 | Bacteria | 1944 |
| 240 | Ga0157372_10000230 | 3300013307 | Bacteria | 62343 |
| 241 | Ga0157372_10214162 | 3300013307 | Bacteria | 2232 |
| 242 | Ga0157372_10226217 | 3300013307 | Bacteria | 2169 |
| 243 | Ga0157372_10373667 | 3300013307 | Bacteria | 1661 |
| 244 | Ga0157372_10537569 | 3300013307 | Bacteria | 1362 |
| 245 | Ga0157375_10026629 | 3300013308 | Bacteria | 5393 |
| 246 | Ga0157375_10041917 | 3300013308 | Bacteria | 4425 |
| 247 | Ga0157375_10050185 | 3300013308 | Bacteria | 4092 |
| 248 | Ga0157375_10152197 | 3300013308 | Bacteria | 2450 |
| 249 | Ga0157375_10286117 | 3300013308 | Bacteria | 1811 |
| 250 | Ga0163163_10034751 | 3300014325 | Bacteria | 4885 |
| 251 | Ga0163163_10059837 | 3300014325 | Bacteria | 3769 |
| 252 | Ga0163163_10372647 | 3300014325 | Unclassified | 1485 |
| 253 | Ga0157380_10007608 | 3300014326 | Bacteria | 7700 |
| 254 | Ga0157380_10008489 | 3300014326 | Bacteria | 7338 |
| 255 | Ga0157377_10006525 | 3300014745 | Bacteria | 5570 |
| 256 | Ga0157377_10013421 | 3300014745 | Bacteria | 4146 |
| 257 | Ga0157377_10116799 | 3300014745 | Bacteria | 1611 |
| 258 | Ga0157379_10140999 | 3300014968 | Unclassified | 2173 |
| 259 | Ga0157379_10153642 | 3300014968 | Unclassified | 2076 |
| 260 | Ga0157379_10226584 | 3300014968 | Bacteria | 1694 |
| 261 | Ga0157376_10038566 | 3300014969 | Unclassified | 3888 |
| 262 | Ga0157376_10112340 | 3300014969 | Unclassified | 2400 |
| 263 | Ga0157376_10212394 | 3300014969 | Bacteria | 1787 |
| 264 | Ga0163161_10049702 | 3300017792 | Unclassified | 3032 |
| 265 | Ga0163161_10060791 | 3300017792 | Unclassified | 2750 |
| 266 | Ga0163161_10254391 | 3300017792 | Unclassified | 1370 |
| 267 | Ga0209130_1000821 | 3300025284 | Bacteria | 26175 |
| 268 | Ga0209025_1000282 | 3300025294 | Bacteria | 115627 |
| 269 | Ga0209758_1005277 | 3300025297 | Bacteria | 10099 |
| 270 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 271 | Ga0207426_1000182 | 3300025302 | Bacteria | 155724 |
| 272 | Ga0207697_10020982 | 3300025315 | Bacteria | 2675 |
| 273 | Ga0207682_10009901 | 3300025893 | Bacteria | 3746 |
| 274 | Ga0207642_10118887 | 3300025899 | Bacteria | 1359 |
| 275 | Ga0207680_10032469 | 3300025903 | Unclassified | 2968 |
| 276 | Ga0207680_10159496 | 3300025903 | Bacteria | 1511 |
| 277 | Ga0207645_10008724 | 3300025907 | Bacteria | 7060 |
| 278 | Ga0207645_10019000 | 3300025907 | Bacteria | 4512 |
| 279 | Ga0207705_10041871 | 3300025909 | Unclassified | 3286 |
| 280 | Ga0207705_10143341 | 3300025909 | Bacteria | 1785 |
| 281 | Ga0207654_10003604 | 3300025911 | Bacteria | 7821 |
| 282 | Ga0207654_10008598 | 3300025911 | Bacteria | 5170 |
| 283 | Ga0207654_10048336 | 3300025911 | Unclassified | 2434 |
| 284 | Ga0207654_10101338 | 3300025911 | Bacteria | 1775 |
| 285 | Ga0207654_10112796 | 3300025911 | Unclassified | 1694 |
| 286 | Ga0207654_10120342 | 3300025911 | Bacteria | 1647 |
| 287 | Ga0207707_10002309 | 3300025912 | Bacteria | 17195 |
| 288 | Ga0207707_10102970 | 3300025912 | Bacteria | 2496 |
| 289 | Ga0207707_10316290 | 3300025912 | Bacteria | 1348 |
| 290 | Ga0207695_10000586 | 3300025913 | Bacteria | 73584 |
| 291 | Ga0207695_10001138 | 3300025913 | Bacteria | 46094 |
| 292 | Ga0207695_10008355 | 3300025913 | Bacteria | 12968 |
| 293 | Ga0207695_10025284 | 3300025913 | Bacteria | 6651 |
| 294 | Ga0207695_10060329 | 3300025913 | Bacteria | 3927 |
| 295 | Ga0207695_10174415 | 3300025913 | Bacteria | 2073 |
| 296 | Ga0207671_10085076 | 3300025914 | Bacteria | 2376 |
| 297 | Ga0207671_10115826 | 3300025914 | Unclassified | 2044 |
| 298 | Ga0207660_10013491 | 3300025917 | Bacteria | 5354 |
| 299 | Ga0207660_10237510 | 3300025917 | Bacteria | 1435 |
| 300 | Ga0207657_10002023 | 3300025919 | Bacteria | 21914 |
| 301 | Ga0207657_10002233 | 3300025919 | Bacteria | 20999 |
| 302 | Ga0207657_10036684 | 3300025919 | Bacteria | 4386 |
| 303 | Ga0207657_10140622 | 3300025919 | Unclassified | 1972 |
| 304 | Ga0207657_10200453 | 3300025919 | Unclassified | 1606 |
| 305 | Ga0207657_10421626 | 3300025919 | Unclassified | 1049 |
| 306 | Ga0207649_10235909 | 3300025920 | Bacteria | 1310 |
| 307 | Ga0207652_10001518 | 3300025921 | Bacteria | 20482 |
| 308 | Ga0207652_10145742 | 3300025921 | Bacteria | 2119 |
| 309 | Ga0207652_10341694 | 3300025921 | Bacteria | 1351 |
| 310 | Ga0207681_10033480 | 3300025923 | Bacteria | 3369 |
| 311 | Ga0207694_10006765 | 3300025924 | Bacteria | 8706 |
| 312 | Ga0207694_10138045 | 3300025924 | Unclassified | 1959 |
| 313 | Ga0207694_10224202 | 3300025924 | Bacteria | 1534 |
| 314 | Ga0207659_10034766 | 3300025926 | Bacteria | 3478 |
| 315 | Ga0207659_10096285 | 3300025926 | Unclassified | 2221 |
| 316 | Ga0207659_10218964 | 3300025926 | Bacteria | 1529 |
| 317 | Ga0207659_10443389 | 3300025926 | Bacteria | 1092 |
| 318 | Ga0207644_10174561 | 3300025931 | Bacteria | 1680 |
| 319 | Ga0207690_10524915 | 3300025932 | Bacteria | 960 |
| 320 | Ga0207706_10075430 | 3300025933 | Bacteria | 2965 |
| 321 | Ga0207706_10078503 | 3300025933 | Bacteria | 2903 |
| 322 | Ga0207706_10126064 | 3300025933 | Bacteria | 2252 |
| 323 | Ga0207706_10181342 | 3300025933 | Unclassified | 1849 |
| 324 | Ga0207670_10145676 | 3300025936 | Bacteria | 1751 |
| 325 | Ga0207704_10114233 | 3300025938 | Bacteria | 1833 |
| 326 | Ga0207704_10182089 | 3300025938 | Unclassified | 1519 |
| 327 | Ga0207704_10363330 | 3300025938 | Bacteria | 1131 |
| 328 | Ga0207691_10021597 | 3300025940 | Bacteria | 6076 |
| 329 | Ga0207691_10057333 | 3300025940 | Unclassified | 3545 |
| 330 | Ga0207691_10130071 | 3300025940 | Bacteria | 2224 |
| 331 | Ga0207711_10242169 | 3300025941 | Unclassified | 1654 |
| 332 | Ga0207689_10015187 | 3300025942 | Bacteria | 6522 |
| 333 | Ga0207689_10025247 | 3300025942 | Bacteria | 4980 |
| 334 | Ga0207689_10025491 | 3300025942 | Bacteria | 4955 |
| 335 | Ga0207689_10029369 | 3300025942 | Bacteria | 4592 |
| 336 | Ga0207689_10043294 | 3300025942 | Unclassified | 3722 |
| 337 | Ga0207689_10067755 | 3300025942 | Bacteria | 2933 |
| 338 | Ga0207661_10009265 | 3300025944 | Bacteria | 7056 |
| 339 | Ga0207661_10023367 | 3300025944 | Unclassified | 4670 |
| 340 | Ga0207661_10083486 | 3300025944 | Bacteria | 2644 |
| 341 | Ga0207679_10002262 | 3300025945 | Bacteria | 11874 |
| 342 | Ga0207679_10006678 | 3300025945 | Bacteria | 7305 |
| 343 | Ga0207679_10105616 | 3300025945 | Bacteria | 2212 |
| 344 | Ga0207679_10134493 | 3300025945 | Bacteria | 1989 |
| 345 | Ga0207679_10377223 | 3300025945 | Bacteria | 1242 |
| 346 | Ga0207667_10000309 | 3300025949 | Bacteria | 67726 |
| 347 | Ga0207667_10027014 | 3300025949 | Bacteria | 6259 |
| 348 | Ga0207667_10047851 | 3300025949 | Unclassified | 4524 |
| 349 | Ga0207667_10143809 | 3300025949 | Bacteria | 2455 |
| 350 | Ga0207667_10348756 | 3300025949 | Bacteria | 1510 |
| 351 | Ga0207651_10235640 | 3300025960 | Bacteria | 1489 |
| 352 | Ga0207651_10365944 | 3300025960 | Bacteria | 1218 |
| 353 | Ga0207712_10125881 | 3300025961 | Bacteria | 1945 |
| 354 | Ga0207712_10233797 | 3300025961 | Bacteria | 1477 |
| 355 | Ga0207640_10080920 | 3300025981 | Bacteria | 2219 |
| 356 | Ga0207640_10229612 | 3300025981 | Unclassified | 1427 |
| 357 | Ga0207658_10105992 | 3300025986 | Unclassified | 2212 |
| 358 | Ga0207658_10406770 | 3300025986 | Bacteria | 1197 |
| 359 | Ga0207677_10035643 | 3300026023 | Bacteria | 3233 |
| 360 | Ga0207677_10062988 | 3300026023 | Bacteria | 2575 |
| 361 | Ga0207677_10228766 | 3300026023 | Unclassified | 1496 |
| 362 | Ga0207639_10025530 | 3300026041 | Bacteria | 4284 |
| 363 | Ga0207639_10087142 | 3300026041 | Bacteria | 2488 |
| 364 | Ga0207639_10091132 | 3300026041 | Unclassified | 2440 |
| 365 | Ga0207702_10029233 | 3300026078 | Bacteria | 4585 |
| 366 | Ga0207702_10071162 | 3300026078 | Bacteria | 2994 |
| 367 | Ga0207702_10250424 | 3300026078 | Bacteria | 1663 |
| 368 | Ga0207702_10362295 | 3300026078 | Bacteria | 1390 |
| 369 | Ga0207648_10011745 | 3300026089 | Bacteria | 8235 |
| 370 | Ga0207648_10075459 | 3300026089 | Bacteria | 2939 |
| 371 | Ga0207648_10166448 | 3300026089 | Bacteria | 1948 |
| 372 | Ga0207676_10027042 | 3300026095 | Bacteria | 4269 |
| 373 | Ga0207676_10184372 | 3300026095 | Unclassified | 1830 |
| 374 | Ga0207674_10001219 | 3300026116 | Bacteria | 33514 |
| 375 | Ga0207674_10001797 | 3300026116 | Bacteria | 27330 |
| 376 | Ga0207674_10010086 | 3300026116 | Bacteria | 10741 |
| 377 | Ga0207674_10016092 | 3300026116 | Bacteria | 8193 |
| 378 | Ga0207674_10017867 | 3300026116 | Bacteria | 7731 |
| 379 | Ga0207674_10037790 | 3300026116 | Bacteria | 5017 |
| 380 | Ga0207674_10055340 | 3300026116 | Bacteria | 4034 |
| 381 | Ga0207675_100009509 | 3300026118 | Bacteria | 9096 |
| 382 | Ga0207675_100020210 | 3300026118 | Bacteria | 6208 |
| 383 | Ga0207675_100063332 | 3300026118 | Unclassified | 3455 |
| 384 | Ga0207683_10001534 | 3300026121 | Bacteria | 20806 |
| 385 | Ga0207683_10105575 | 3300026121 | Bacteria | 2518 |
| 386 | Ga0207698_10000848 | 3300026142 | Bacteria | 17751 |
| 387 | Ga0207698_10051989 | 3300026142 | Bacteria | 3136 |
| 388 | Ga0207698_10212905 | 3300026142 | Bacteria | 1740 |
| 389 | Ga0209971_1008470 | 3300027682 | Bacteria | 2438 |
| 390 | Ga0268265_10024213 | 3300028380 | Bacteria | 4292 |
| 391 | Ga0268264_10002281 | 3300028381 | Bacteria | 16987 |
| 392 | Ga0268264_10111257 | 3300028381 | Unclassified | 2399 |
| 393 | Ga0268264_10720014 | 3300028381 | Bacteria | 992 |
| 394 | Ga0307515_10000091 | 3300028794 | Bacteria | 214014 |
| 395 | Ga0265324_10033389 | 3300029957 | Bacteria | 1796 |
| 396 | Ga0265327_10000146 | 3300031251 | Bacteria | 154436 |
| 397 | Ga0265327_10014860 | 3300031251 | Bacteria | 5068 |
| 398 | Ga0265327_10054368 | 3300031251 | Unclassified | 2073 |
| 399 | Ga0307509_10078499 | 3300031507 | Unclassified | 3420 |
| 400 | Ga0307408_100128875 | 3300031548 | Bacteria | 1971 |
| 401 | Ga0316575_10035651 | 3300031665 | Bacteria | 1956 |
| 402 | Ga0316579_10005351 | 3300031691 | Bacteria | 5174 |
| 403 | Ga0316576_10009793 | 3300031727 | Bacteria | 6204 |
| 404 | Ga0316578_10054919 | 3300031728 | Bacteria | 2336 |
| 405 | Ga0316577_10008316 | 3300031733 | Bacteria | 5558 |
| 406 | Ga0307413_10051113 | 3300031824 | Bacteria | 2489 |
| 407 | Ga0307412_10037016 | 3300031911 | Bacteria | 3132 |
| 408 | Ga0307409_100040863 | 3300031995 | Bacteria | 3458 |
| 409 | Ga0307416_100037438 | 3300032002 | Bacteria | 3733 |
| 410 | Ga0307414_10012112 | 3300032004 | Bacteria | 5087 |
| 411 | Ga0307414_10157370 | 3300032004 | Bacteria | 1800 |
| 412 | Ga0307414_10238206 | 3300032004 | Unclassified | 1505 |
| 413 | Ga0307414_10245229 | 3300032004 | Bacteria | 1485 |
| 414 | Ga0307415_100135892 | 3300032126 | Unclassified | 1870 |
| 415 | Ga0373943_0140488 | 3300035170 | Bacteria | 1301 |
| 416 | Ga0316574_0016495 | 3300035398 | Bacteria | 4306 |
| 417 | Ga0316574_0168368 | 3300035398 | Unclassified | 1411 |
| 418 | Ga0373947_0193387 | 3300035725 | Bacteria | 1328 |
| 419 | Ga0373937_0019278 | 3300036401 | Bacteria | 6105 |
| 420 | Ga0373937_0350308 | 3300036401 | Bacteria | 1399 |
| 421 | Ga0316582_0007857 | 3300036647 | Bacteria | 5699 |
| 422 | Ga0316584_0001490 | 3300036712 | Bacteria | 14080 |
| 423 | Ga0316584_0022580 | 3300036712 | Bacteria | 4592 |
| 424 | Ga0395899_0002920 | 3300037312 | Bacteria | 13725 |
| 425 | Ga0395900_0011692 | 3300037418 | Bacteria | 8979 |
| 426 | Ga0395898_0004939 | 3300037466 | Bacteria | 14471 |
| 427 | Ga0395901_0010792 | 3300038443 | Bacteria | 9259 |
| 428 | Ga0436365_1088492 | 3300039437 | Bacteria | 1000 |
| 429 | Ga0451837_1188898 | 3300041494 | Bacteria | 1692 |
| 430 | Ga0451853_3842013 | 3300041512 | Bacteria | 890 |
| 431 | Ga0439431_0075999 | 3300041997 | Bacteria | 901 |
| 432 | Ga0451577_0003069 | 3300042876 | Bacteria | 18896 |
| 433 | Ga0451577_0003255 | 3300042876 | Bacteria | 18261 |
| 434 | Ga0451577_0013409 | 3300042876 | Bacteria | 7671 |
| 435 | Ga0451577_0126667 | 3300042876 | Unclassified | 2289 |
| 436 | Ga0466969_0120636 | 3300044656 | Bacteria | 1221 |
| 437 | Ga0466972_0023199 | 3300044658 | Bacteria | 3086 |
| 438 | Ga0453684_0000841 | 3300044712 | Bacteria | 103501 |
| 439 | Ga0453684_0001009 | 3300044712 | Bacteria | 91051 |
| 440 | Ga0466968_0148479 | 3300044735 | Bacteria | 1076 |
| 441 | Ga0466960_0059218 | 3300044901 | Bacteria | 1873 |
| 442 | Ga0451576_0041294 | 3300045051 | Bacteria | 4878 |
| 443 | Ga0451576_0089988 | 3300045051 | Bacteria | 3192 |
| 444 | Ga0466967_0391468 | 3300045976 | Bacteria | 1351 |
| 445 | Ga0495592_0019105 | 3300046454 | Bacteria | 5215 |
| 446 | Ga0495650_0043054 | 3300046471 | Bacteria | 1919 |
| 447 | Ga0495608_0057504 | 3300046511 | Bacteria | 2566 |
| 448 | Ga0495618_0048685 | 3300046514 | Bacteria | 2676 |
| 449 | Ga0495630_0006627 | 3300046517 | Bacteria | 8251 |
| 450 | Ga0495630_0190278 | 3300046517 | Bacteria | 1566 |
| 451 | Ga0495643_0000248 | 3300046522 | Bacteria | 79547 |
| 452 | Ga0495652_0151729 | 3300046529 | Bacteria | 1810 |
| 453 | Ga0495640_0131983 | 3300046533 | Bacteria | 1616 |
| 454 | Ga0495586_0091179 | 3300046535 | Bacteria | 1684 |
| 455 | Ga0495587_0038650 | 3300046536 | Bacteria | 2860 |
| 456 | Ga0495645_0138010 | 3300046543 | Bacteria | 1704 |
| 457 | Ga0495667_0052224 | 3300046559 | Bacteria | 2694 |
| 458 | Ga0495635_0238961 | 3300046663 | Bacteria | 1226 |
| 459 | Ga0495599_0046550 | 3300046678 | Bacteria | 2720 |
| 460 | Ga0495646_0099015 | 3300046680 | Bacteria | 1674 |
| 461 | Ga0495672_0028866 | 3300047320 | Bacteria | 3503 |
| 462 | Ga0495676_0111818 | 3300047321 | Bacteria | 2003 |
| 463 | Ga0495680_0026620 | 3300047322 | Bacteria | 4764 |
| 464 | Ga0496105_0298598 | 3300048908 | Bacteria | 1295 |
| 465 | Ga0496109_0587835 | 3300048912 | Bacteria | 1049 |
| 466 | Ga0496110_0128358 | 3300048913 | Bacteria | 2288 |
| 467 | Ga0501299_043524 | 3300049522 | Bacteria | 908 |
| 468 | Ga0501033_0033223 | 3300049570 | Bacteria | 3874 |
| 469 | Ga0501034_0029329 | 3300049571 | Bacteria | 5591 |
| 470 | Ga0501034_0160861 | 3300049571 | Bacteria | 2216 |
| 471 | Ga0501034_0210690 | 3300049571 | Bacteria | 1899 |
| 472 | Ga0501034_0475011 | 3300049571 | Unclassified | 1166 |
| 473 | Ga0501037_0006592 | 3300049573 | Bacteria | 8490 |
| 474 | Ga0501038_0010536 | 3300049574 | Bacteria | 8456 |
| 475 | Ga0501043_0003923 | 3300049579 | Bacteria | 12202 |
| 476 | Ga0501043_0008195 | 3300049579 | Bacteria | 8239 |
| 477 | Ga0501043_0043327 | 3300049579 | Unclassified | 3538 |
| 478 | Ga0501047_0009285 | 3300049581 | Bacteria | 9291 |
| 479 | Ga0501047_0125113 | 3300049581 | Bacteria | 2452 |
| 480 | Ga0501217_056218 | 3300049661 | Bacteria | 1040 |
| 481 | Ga0501223_001738 | 3300049663 | Bacteria | 4956 |
| 482 | Ga0501242_000489 | 3300049674 | Bacteria | 3488 |
| 483 | Ga0501257_007115 | 3300049686 | Bacteria | 2496 |
| 484 | Ga0501221_000060 | 3300049704 | Bacteria | 11755 |
| 485 | Ga0501245_010528 | 3300049708 | Bacteria | 1337 |
| 486 | Ga0501080_0047836 | 3300049742 | Bacteria | 3982 |
| 487 | Ga0501035_0091950 | 3300049822 | Unclassified | 2670 |
| 488 | Ga0501035_0138188 | 3300049822 | Unclassified | 2120 |
| 489 | Ga0501044_0016580 | 3300049823 | Bacteria | 7907 |
| 490 | Ga0501044_0075395 | 3300049823 | Bacteria | 3425 |
| 491 | Ga0501044_0224311 | 3300049823 | Bacteria | 1829 |
| 492 | nmdc:mga00v17_57409_c1 | 3300050491 | Bacteria | 2381 |
| 493 | nmdc:mga06z11_130879_c1 | 3300050494 | Bacteria | 1409 |
| 494 | nmdc:mga05p37_205113_c1 | 3300050507 | Bacteria | 2385 |
| 495 | nmdc:mga09592_33894_c1 | 3300050508 | Unclassified | 4266 |
| 496 | nmdc:mga06r32_234100_c1 | 3300050510 | Bacteria | 1825 |
| 497 | nmdc:mga08y16_499740_c1 | 3300050511 | Unclassified | 1236 |
| 498 | Ga0500568_0010919 | 3300053139 | Bacteria | 4234 |
| 499 | Ga0500616_0004086 | 3300053153 | Bacteria | 10599 |
| 500 | Ga0500616_0036197 | 3300053153 | Bacteria | 2680 |
| 501 | Ga0500622_0001810 | 3300053156 | Bacteria | 16284 |
| 502 | Ga0501084_0452975 | 3300054114 | Bacteria | 1085 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027682 | Ga0209971_1008470 | Ga0209971_10084702 | 209 |
| 2 | 3300026118 | Ga0207675_100063332 | Ga0207675_1000633322 | 224 |
| 3 | 3300013100 | Ga0157373_10241560 | Ga0157373_102415602 | 228 |
| 4 | 3300013102 | Ga0157371_10090968 | Ga0157371_100909682 | 228 |
| 5 | 3300005354 | Ga0070675_100274482 | Ga0070675_1002744822 | 229 |
| 6 | 3300025944 | Ga0207661_10083486 | Ga0207661_100834862 | 230 |
| 7 | 3300049704 | Ga0501221_000060 | Ga0501221_000060_51_752 | 233 |
| 8 | 3300005330 | Ga0070690_100056643 | Ga0070690_1000566431 | 234 |
| 9 | 3300005354 | Ga0070675_100121323 | Ga0070675_1001213232 | 234 |
| 10 | 3300005355 | Ga0070671_100076258 | Ga0070671_1000762582 | 234 |
| 11 | 3300005367 | Ga0070667_100108520 | Ga0070667_1001085203 | 234 |
| 12 | 3300005457 | Ga0070662_100108878 | Ga0070662_1001088781 | 234 |
| 13 | 3300005459 | Ga0068867_100056378 | Ga0068867_1000563782 | 234 |
| 14 | 3300005466 | Ga0070685_10065120 | Ga0070685_100651202 | 234 |
| 15 | 3300005843 | Ga0068860_100328540 | Ga0068860_1003285401 | 234 |
| 16 | 3300006237 | Ga0097621_100125831 | Ga0097621_1001258313 | 234 |
| 17 | 3300013296 | Ga0157374_10094217 | Ga0157374_100942172 | 234 |
| 18 | 3300013308 | Ga0157375_10286117 | Ga0157375_102861172 | 234 |
| 19 | 3300014969 | Ga0157376_10212394 | Ga0157376_102123941 | 234 |
| 20 | 3300025926 | Ga0207659_10218964 | Ga0207659_102189642 | 234 |
| 21 | 3300025931 | Ga0207644_10174561 | Ga0207644_101745612 | 234 |
| 22 | 3300025933 | Ga0207706_10126064 | Ga0207706_101260641 | 234 |
| 23 | 3300025941 | Ga0207711_10242169 | Ga0207711_102421692 | 234 |
| 24 | 3300025945 | Ga0207679_10134493 | Ga0207679_101344933 | 234 |
| 25 | 3300025945 | Ga0207679_10377223 | Ga0207679_103772231 | 234 |
| 26 | 3300035725 | Ga0373947_0193387 | Ga0373947_0193387_83_796 | 234 |
| 27 | 3300025911 | Ga0207654_10120342 | Ga0207654_101203422 | 235 |
| 28 | 3300013296 | Ga0157374_10061971 | Ga0157374_100619714 | 238 |
| 29 | 3300005618 | Ga0068864_100070143 | Ga0068864_1000701434 | 239 |
| 30 | 3300009101 | Ga0105247_10110004 | Ga0105247_101100042 | 239 |
| 31 | 3300014325 | Ga0163163_10059837 | Ga0163163_100598375 | 239 |
| 32 | 3300026095 | Ga0207676_10184372 | Ga0207676_101843722 | 239 |
| 33 | 3300005339 | Ga0070660_100280418 | Ga0070660_1002804181 | 245 |
| 34 | 3300013105 | Ga0157369_10435959 | Ga0157369_104359592 | 245 |
| 35 | 3300005336 | Ga0070680_100116804 | Ga0070680_1001168042 | 246 |
| 36 | 3300005458 | Ga0070681_10295220 | Ga0070681_102952202 | 246 |
| 37 | 3300005577 | Ga0068857_100219696 | Ga0068857_1002196962 | 246 |
| 38 | 3300025912 | Ga0207707_10102970 | Ga0207707_101029703 | 246 |
| 39 | 3300025921 | Ga0207652_10145742 | Ga0207652_101457422 | 246 |
| 40 | 3300026116 | Ga0207674_10055340 | Ga0207674_100553402 | 246 |
| 41 | 3300035398 | Ga0316574_0168368 | Ga0316574_0168368_484_1296 | 248 |
| 42 | 3300006051 | Ga0075364_10099580 | Ga0075364_100995802 | 249 |
| 43 | 3300009545 | Ga0105237_10136947 | Ga0105237_101369472 | 249 |
| 44 | 3300025911 | Ga0207654_10101338 | Ga0207654_101013382 | 249 |
| 45 | 3300050491 | nmdc:mga00v17_57409_c1 | nmdc:mga00v17_57409_c1_754_1533 | 249 |
| 46 | 3300046517 | Ga0495630_0190278 | Ga0495630_0190278_322_1122 | 250 |
| 47 | iso_pu_bacteria | 2844533157 | 2844536682 | 250 |
| 48 | iso_pu_bacteria | 8005258706 | 8005263217 | 250 |
| 49 | 3300006880 | Ga0075429_100421559 | Ga0075429_1004215592 | 252 |
| 50 | 3300009093 | Ga0105240_10001165 | Ga0105240_1000116528 | 252 |
| 51 | 3300009101 | Ga0105247_10167630 | Ga0105247_101676302 | 252 |
| 52 | 3300009551 | Ga0105238_10119004 | Ga0105238_101190042 | 252 |
| 53 | 3300010375 | Ga0105239_10014753 | Ga0105239_100147534 | 252 |
| 54 | 3300025913 | Ga0207695_10001138 | Ga0207695_1000113811 | 252 |
| 55 | 3300025924 | Ga0207694_10224202 | Ga0207694_102242022 | 252 |
| 56 | 3300054114 | Ga0501084_0452975 | Ga0501084_0452975_98_874 | 252 |
| 57 | 3300014968 | Ga0157379_10153642 | Ga0157379_101536423 | 253 |
| 58 | 3300050494 | nmdc:mga06z11_130879_c1 | nmdc:mga06z11_130879_c1_244_1035 | 253 |
| 59 | 3300001989 | JGI24739J22299_10104297 | JGI24739J22299_101042971 | 254 |
| 60 | 3300003187 | JGI25151J46595_10000952 | JGI25151J46595_100009527 | 254 |
| 61 | 3300009765 | Ga0123341_1000054 | Ga0123341_100005423 | 254 |
| 62 | 3300009766 | Ga0123342_1006389 | Ga0123342_10063897 | 254 |
| 63 | 3300009986 | Ga0105033_100448 | Ga0105033_1004482 | 254 |
| 64 | 3300025284 | Ga0209130_1000821 | Ga0209130_100082113 | 254 |
| 65 | 3300025294 | Ga0209025_1000282 | Ga0209025_100028259 | 254 |
| 66 | 3300025297 | Ga0209758_1005277 | Ga0209758_10052777 | 254 |
| 67 | 3300025302 | Ga0207426_1000182 | Ga0207426_100018213 | 254 |
| 68 | 3300041997 | Ga0439431_0075999 | Ga0439431_0075999_96_869 | 254 |
| 69 | 3300006237 | Ga0097621_100358551 | Ga0097621_1003585511 | 255 |
| 70 | 3300010375 | Ga0105239_10161438 | Ga0105239_101614382 | 257 |
| 71 | 3300003203 | JGI25406J46586_10002360 | JGI25406J46586_100023604 | 258 |
| 72 | 3300005539 | Ga0068853_100764313 | Ga0068853_1007643131 | 258 |
| 73 | 3300005985 | Ga0081539_10000338 | Ga0081539_1000033837 | 258 |
| 74 | 3300006844 | Ga0075428_100338452 | Ga0075428_1003384522 | 258 |
| 75 | 3300006880 | Ga0075429_100022346 | Ga0075429_1000223464 | 258 |
| 76 | 3300009147 | Ga0114129_10007759 | Ga0114129_100077594 | 258 |
| 77 | 3300013102 | Ga0157371_10012767 | Ga0157371_100127672 | 258 |
| 78 | 3300013102 | Ga0157371_10017210 | Ga0157371_100172102 | 258 |
| 79 | 3300013104 | Ga0157370_10058722 | Ga0157370_100587221 | 258 |
| 80 | 3300013104 | Ga0157370_10634471 | Ga0157370_106344711 | 258 |
| 81 | 3300025913 | Ga0207695_10174415 | Ga0207695_101744152 | 258 |
| 82 | 3300049522 | Ga0501299_043524 | Ga0501299_043524_18_794 | 258 |
| 83 | 3300049663 | Ga0501223_001738 | Ga0501223_001738_1480_2256 | 258 |
| 84 | 3300049674 | Ga0501242_000489 | Ga0501242_000489_969_1745 | 258 |
| 85 | 3300049686 | Ga0501257_007115 | Ga0501257_007115_640_1416 | 258 |
| 86 | 3300049708 | Ga0501245_010528 | Ga0501245_010528_485_1261 | 258 |
| 87 | 3300050507 | nmdc:mga05p37_205113_c1 | nmdc:mga05p37_205113_c1_1039_1815 | 258 |
| 88 | 3300050508 | nmdc:mga09592_33894_c1 | nmdc:mga09592_33894_c1_2553_3329 | 258 |
| 89 | 3300050510 | nmdc:mga06r32_234100_c1 | nmdc:mga06r32_234100_c1_26_802 | 258 |
| 90 | 3300031727 | Ga0316576_10009793 | Ga0316576_100097933 | 259 |
| 91 | 3300035398 | Ga0316574_0016495 | Ga0316574_0016495_3186_3965 | 259 |
| 92 | 3300036712 | Ga0316584_0022580 | Ga0316584_0022580_126_905 | 259 |
| 93 | 3300031665 | Ga0316575_10035651 | Ga0316575_100356513 | 260 |
| 94 | 3300031691 | Ga0316579_10005351 | Ga0316579_100053512 | 260 |
| 95 | 3300031728 | Ga0316578_10054919 | Ga0316578_100549192 | 260 |
| 96 | 3300031733 | Ga0316577_10008316 | Ga0316577_100083165 | 260 |
| 97 | 3300036647 | Ga0316582_0007857 | Ga0316582_0007857_3079_3864 | 260 |
| 98 | 3300036712 | Ga0316584_0001490 | Ga0316584_0001490_4253_5038 | 260 |
| 99 | iso_pu_bacteria | 2910245624 | 2910247868 | 260 |
| 100 | 3300031548 | Ga0307408_100128875 | Ga0307408_1001288752 | 261 |
| 101 | 3300031824 | Ga0307413_10051113 | Ga0307413_100511132 | 261 |
| 102 | 3300031911 | Ga0307412_10037016 | Ga0307412_100370163 | 261 |
| 103 | 3300031995 | Ga0307409_100040863 | Ga0307409_1000408633 | 261 |
| 104 | 3300032002 | Ga0307416_100037438 | Ga0307416_1000374383 | 261 |
| 105 | iso_pu_bacteria | 2919692658 | 2919697728 | 261 |
| 106 | 3300049570 | Ga0501033_0033223 | Ga0501033_0033223_1180_1968 | 262 |
| 107 | 3300049573 | Ga0501037_0006592 | Ga0501037_0006592_34_822 | 262 |
| 108 | 3300049574 | Ga0501038_0010536 | Ga0501038_0010536_863_1651 | 262 |
| 109 | 3300049579 | Ga0501043_0003923 | Ga0501043_0003923_3318_4106 | 262 |
| 110 | 3300049579 | Ga0501043_0008195 | Ga0501043_0008195_7369_8157 | 262 |
| 111 | 3300049581 | Ga0501047_0009285 | Ga0501047_0009285_164_952 | 262 |
| 112 | 3300049823 | Ga0501044_0016580 | Ga0501044_0016580_5923_6711 | 262 |
| 113 | iso_pu_bacteria | 2896085136 | 2896089518 | 262 |
| 114 | 3300003320 | rootH2_10165614 | rootH2_101656142 | 263 |
| 115 | 3300003320 | rootH2_10186666 | rootH2_101866663 | 263 |
| 116 | 3300003322 | rootL2_10106600 | rootL2_101066001 | 263 |
| 117 | 3300003323 | rootH1_10001888 | rootH1_100018887 | 263 |
| 118 | 3300005327 | Ga0070658_10241992 | Ga0070658_102419922 | 263 |
| 119 | 3300005336 | Ga0070680_100008276 | Ga0070680_1000082765 | 263 |
| 120 | 3300005336 | Ga0070680_100318639 | Ga0070680_1003186392 | 263 |
| 121 | 3300005337 | Ga0070682_100043847 | Ga0070682_1000438473 | 263 |
| 122 | 3300005339 | Ga0070660_100000709 | Ga0070660_1000007093 | 263 |
| 123 | 3300005339 | Ga0070660_100188193 | Ga0070660_1001881932 | 263 |
| 124 | 3300005339 | Ga0070660_100217507 | Ga0070660_1002175072 | 263 |
| 125 | 3300005366 | Ga0070659_100184146 | Ga0070659_1001841462 | 263 |
| 126 | 3300005530 | Ga0070679_100201966 | Ga0070679_1002019662 | 263 |
| 127 | 3300005530 | Ga0070679_100202658 | Ga0070679_1002026582 | 263 |
| 128 | 3300005563 | Ga0068855_100006753 | Ga0068855_1000067532 | 263 |
| 129 | 3300005563 | Ga0068855_100016996 | Ga0068855_1000169964 | 263 |
| 130 | 3300005563 | Ga0068855_100408701 | Ga0068855_1004087012 | 263 |
| 131 | 3300005577 | Ga0068857_100003611 | Ga0068857_10000361110 | 263 |
| 132 | 3300005578 | Ga0068854_100045217 | Ga0068854_1000452172 | 263 |
| 133 | 3300005614 | Ga0068856_100042155 | Ga0068856_1000421555 | 263 |
| 134 | 3300005614 | Ga0068856_100420992 | Ga0068856_1004209922 | 263 |
| 135 | 3300005616 | Ga0068852_100000410 | Ga0068852_10000041015 | 263 |
| 136 | 3300005616 | Ga0068852_100415199 | Ga0068852_1004151992 | 263 |
| 137 | 3300009093 | Ga0105240_10001264 | Ga0105240_1000126418 | 263 |
| 138 | 3300009093 | Ga0105240_10005683 | Ga0105240_100056835 | 263 |
| 139 | 3300009094 | Ga0111539_10039960 | Ga0111539_100399602 | 263 |
| 140 | 3300009174 | Ga0105241_10020047 | Ga0105241_100200474 | 263 |
| 141 | 3300009174 | Ga0105241_10114802 | Ga0105241_101148023 | 263 |
| 142 | 3300009545 | Ga0105237_10216184 | Ga0105237_102161842 | 263 |
| 143 | 3300009551 | Ga0105238_10011379 | Ga0105238_100113794 | 263 |
| 144 | 3300009551 | Ga0105238_10035408 | Ga0105238_100354084 | 263 |
| 145 | 3300013102 | Ga0157371_10071117 | Ga0157371_100711173 | 263 |
| 146 | 3300013105 | Ga0157369_10088117 | Ga0157369_100881173 | 263 |
| 147 | 3300013105 | Ga0157369_10148890 | Ga0157369_101488901 | 263 |
| 148 | 3300013307 | Ga0157372_10000230 | Ga0157372_1000023037 | 263 |
| 149 | 3300013307 | Ga0157372_10214162 | Ga0157372_102141622 | 263 |
| 150 | 3300013307 | Ga0157372_10226217 | Ga0157372_102262172 | 263 |
| 151 | 3300025315 | Ga0207697_10020982 | Ga0207697_100209822 | 263 |
| 152 | 3300025909 | Ga0207705_10041871 | Ga0207705_100418712 | 263 |
| 153 | 3300025909 | Ga0207705_10143341 | Ga0207705_101433412 | 263 |
| 154 | 3300025911 | Ga0207654_10048336 | Ga0207654_100483362 | 263 |
| 155 | 3300025911 | Ga0207654_10112796 | Ga0207654_101127962 | 263 |
| 156 | 3300025912 | Ga0207707_10316290 | Ga0207707_103162902 | 263 |
| 157 | 3300025913 | Ga0207695_10000586 | Ga0207695_1000058649 | 263 |
| 158 | 3300025913 | Ga0207695_10060329 | Ga0207695_100603293 | 263 |
| 159 | 3300025914 | Ga0207671_10115826 | Ga0207671_101158262 | 263 |
| 160 | 3300025917 | Ga0207660_10237510 | Ga0207660_102375102 | 263 |
| 161 | 3300025919 | Ga0207657_10002023 | Ga0207657_100020233 | 263 |
| 162 | 3300025919 | Ga0207657_10036684 | Ga0207657_100366844 | 263 |
| 163 | 3300025919 | Ga0207657_10140622 | Ga0207657_101406222 | 263 |
| 164 | 3300025921 | Ga0207652_10341694 | Ga0207652_103416942 | 263 |
| 165 | 3300025924 | Ga0207694_10006765 | Ga0207694_100067653 | 263 |
| 166 | 3300025924 | Ga0207694_10138045 | Ga0207694_101380452 | 263 |
| 167 | 3300025949 | Ga0207667_10000309 | Ga0207667_1000030914 | 263 |
| 168 | 3300025949 | Ga0207667_10047851 | Ga0207667_100478513 | 263 |
| 169 | 3300025949 | Ga0207667_10143809 | Ga0207667_101438092 | 263 |
| 170 | 3300026041 | Ga0207639_10087142 | Ga0207639_100871423 | 263 |
| 171 | 3300026078 | Ga0207702_10071162 | Ga0207702_100711623 | 263 |
| 172 | 3300026078 | Ga0207702_10362295 | Ga0207702_103622952 | 263 |
| 173 | 3300026116 | Ga0207674_10001219 | Ga0207674_1000121919 | 263 |
| 174 | 3300026116 | Ga0207674_10037790 | Ga0207674_100377904 | 263 |
| 175 | 3300026142 | Ga0207698_10000848 | Ga0207698_100008482 | 263 |
| 176 | 3300032004 | Ga0307414_10012112 | Ga0307414_100121125 | 263 |
| 177 | 3300032004 | Ga0307414_10157370 | Ga0307414_101573702 | 263 |
| 178 | 3300032004 | Ga0307414_10245229 | Ga0307414_102452292 | 263 |
| 179 | 3300041494 | Ga0451837_1188898 | Ga0451837_1188898_178_969 | 263 |
| 180 | 3300042876 | Ga0451577_0003069 | Ga0451577_0003069_2240_3031 | 263 |
| 181 | 3300044658 | Ga0466972_0023199 | Ga0466972_0023199_1909_2700 | 263 |
| 182 | 3300044712 | Ga0453684_0001009 | Ga0453684_0001009_65624_66415 | 263 |
| 183 | 3300044735 | Ga0466968_0148479 | Ga0466968_0148479_228_1019 | 263 |
| 184 | 3300044901 | Ga0466960_0059218 | Ga0466960_0059218_637_1428 | 263 |
| 185 | 3300045051 | Ga0451576_0041294 | Ga0451576_0041294_3424_4215 | 263 |
| 186 | 3300049571 | Ga0501034_0475011 | Ga0501034_0475011_74_865 | 263 |
| 187 | 3300049822 | Ga0501035_0138188 | Ga0501035_0138188_449_1240 | 263 |
| 188 | 3300053153 | Ga0500616_0036197 | Ga0500616_0036197_1265_2056 | 263 |
| 189 | 3300053156 | Ga0500622_0001810 | Ga0500622_0001810_10459_11250 | 263 |
| 190 | 3300005367 | Ga0070667_100736383 | Ga0070667_1007363831 | 264 |
| 191 | 3300005543 | Ga0070672_100541141 | Ga0070672_1005411412 | 264 |
| 192 | 3300006844 | Ga0075428_100007909 | Ga0075428_1000079094 | 264 |
| 193 | 3300006880 | Ga0075429_100447183 | Ga0075429_1004471832 | 264 |
| 194 | 3300009094 | Ga0111539_10001995 | Ga0111539_100019954 | 264 |
| 195 | 3300025986 | Ga0207658_10406770 | Ga0207658_104067701 | 264 |
| 196 | 3300039437 | Ga0436365_1088492 | Ga0436365_1088492_183_977 | 264 |
| 197 | 3300049571 | Ga0501034_0210690 | Ga0501034_0210690_623_1417 | 264 |
| 198 | 3300049661 | Ga0501217_056218 | Ga0501217_056218_23_817 | 264 |
| 199 | 3300049822 | Ga0501035_0091950 | Ga0501035_0091950_1337_2131 | 264 |
| 200 | 3300049823 | Ga0501044_0224311 | Ga0501044_0224311_314_1108 | 264 |
| 201 | 3300003316 | rootH1_10072465 | rootH1_100724652 | 265 |
| 202 | 3300003354 | JGI25160J50197_1000662 | JGI25160J50197_100066211 | 265 |
| 203 | 3300005329 | Ga0070683_100002417 | Ga0070683_1000024172 | 265 |
| 204 | 3300005333 | Ga0070677_10061330 | Ga0070677_100613302 | 265 |
| 205 | 3300005334 | Ga0068869_100053980 | Ga0068869_1000539802 | 265 |
| 206 | 3300005334 | Ga0068869_100197578 | Ga0068869_1001975782 | 265 |
| 207 | 3300005335 | Ga0070666_10133269 | Ga0070666_101332692 | 265 |
| 208 | 3300005338 | Ga0068868_100041008 | Ga0068868_1000410083 | 265 |
| 209 | 3300005339 | Ga0070660_100019733 | Ga0070660_1000197335 | 265 |
| 210 | 3300005347 | Ga0070668_100033492 | Ga0070668_1000334923 | 265 |
| 211 | 3300005353 | Ga0070669_100019533 | Ga0070669_1000195334 | 265 |
| 212 | 3300005353 | Ga0070669_100286466 | Ga0070669_1002864662 | 265 |
| 213 | 3300005354 | Ga0070675_100476566 | Ga0070675_1004765661 | 265 |
| 214 | 3300005355 | Ga0070671_100292184 | Ga0070671_1002921842 | 265 |
| 215 | 3300005355 | Ga0070671_100413834 | Ga0070671_1004138342 | 265 |
| 216 | 3300005356 | Ga0070674_100050165 | Ga0070674_1000501653 | 265 |
| 217 | 3300005364 | Ga0070673_100063853 | Ga0070673_1000638532 | 265 |
| 218 | 3300005366 | Ga0070659_100007003 | Ga0070659_1000070035 | 265 |
| 219 | 3300005367 | Ga0070667_100043984 | Ga0070667_1000439843 | 265 |
| 220 | 3300005367 | Ga0070667_100399836 | Ga0070667_1003998362 | 265 |
| 221 | 3300005367 | Ga0070667_100754951 | Ga0070667_1007549511 | 265 |
| 222 | 3300005456 | Ga0070678_100124117 | Ga0070678_1001241172 | 265 |
| 223 | 3300005457 | Ga0070662_100025036 | Ga0070662_1000250366 | 265 |
| 224 | 3300005459 | Ga0068867_100092884 | Ga0068867_1000928842 | 265 |
| 225 | 3300005539 | Ga0068853_100004573 | Ga0068853_1000045737 | 265 |
| 226 | 3300005543 | Ga0070672_100045223 | Ga0070672_1000452232 | 265 |
| 227 | 3300005548 | Ga0070665_100051542 | Ga0070665_1000515422 | 265 |
| 228 | 3300005563 | Ga0068855_100018440 | Ga0068855_1000184407 | 265 |
| 229 | 3300005564 | Ga0070664_100062152 | Ga0070664_1000621523 | 265 |
| 230 | 3300005577 | Ga0068857_100020090 | Ga0068857_1000200904 | 265 |
| 231 | 3300005578 | Ga0068854_100317772 | Ga0068854_1003177722 | 265 |
| 232 | 3300005614 | Ga0068856_100296011 | Ga0068856_1002960111 | 265 |
| 233 | 3300005616 | Ga0068852_100005821 | Ga0068852_1000058218 | 265 |
| 234 | 3300005617 | Ga0068859_100024651 | Ga0068859_1000246514 | 265 |
| 235 | 3300005617 | Ga0068859_100161511 | Ga0068859_1001615112 | 265 |
| 236 | 3300005841 | Ga0068863_100271099 | Ga0068863_1002710992 | 265 |
| 237 | 3300005843 | Ga0068860_100035569 | Ga0068860_1000355695 | 265 |
| 238 | 3300005843 | Ga0068860_100056169 | Ga0068860_1000561693 | 265 |
| 239 | 3300005844 | Ga0068862_100009417 | Ga0068862_1000094174 | 265 |
| 240 | 3300005844 | Ga0068862_100099588 | Ga0068862_1000995883 | 265 |
| 241 | 3300006237 | Ga0097621_100189009 | Ga0097621_1001890092 | 265 |
| 242 | 3300006237 | Ga0097621_100347834 | Ga0097621_1003478342 | 265 |
| 243 | 3300006881 | Ga0068865_100150648 | Ga0068865_1001506482 | 265 |
| 244 | 3300006931 | Ga0097620_100024651 | Ga0097620_1000246514 | 265 |
| 245 | 3300006931 | Ga0097620_100161510 | Ga0097620_1001615102 | 265 |
| 246 | 3300009094 | Ga0111539_10066664 | Ga0111539_100666642 | 265 |
| 247 | 3300013104 | Ga0157370_10168298 | Ga0157370_101682982 | 265 |
| 248 | 3300013296 | Ga0157374_10023391 | Ga0157374_100233913 | 265 |
| 249 | 3300013296 | Ga0157374_10066516 | Ga0157374_100665163 | 265 |
| 250 | 3300014326 | Ga0157380_10007608 | Ga0157380_100076085 | 265 |
| 251 | 3300014745 | Ga0157377_10116799 | Ga0157377_101167992 | 265 |
| 252 | 3300014968 | Ga0157379_10140999 | Ga0157379_101409992 | 265 |
| 253 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026201 | 265 |
| 254 | 3300025893 | Ga0207682_10009901 | Ga0207682_100099012 | 265 |
| 255 | 3300025903 | Ga0207680_10159496 | Ga0207680_101594961 | 265 |
| 256 | 3300025907 | Ga0207645_10008724 | Ga0207645_100087245 | 265 |
| 257 | 3300025919 | Ga0207657_10002233 | Ga0207657_1000223311 | 265 |
| 258 | 3300025926 | Ga0207659_10443389 | Ga0207659_104433891 | 265 |
| 259 | 3300025933 | Ga0207706_10078503 | Ga0207706_100785033 | 265 |
| 260 | 3300025933 | Ga0207706_10181342 | Ga0207706_101813422 | 265 |
| 261 | 3300025940 | Ga0207691_10057333 | Ga0207691_100573334 | 265 |
| 262 | 3300025942 | Ga0207689_10015187 | Ga0207689_100151871 | 265 |
| 263 | 3300025942 | Ga0207689_10067755 | Ga0207689_100677552 | 265 |
| 264 | 3300025986 | Ga0207658_10105992 | Ga0207658_101059922 | 265 |
| 265 | 3300026023 | Ga0207677_10228766 | Ga0207677_102287662 | 265 |
| 266 | 3300026078 | Ga0207702_10250424 | Ga0207702_102504242 | 265 |
| 267 | 3300026089 | Ga0207648_10011745 | Ga0207648_100117453 | 265 |
| 268 | 3300026116 | Ga0207674_10016092 | Ga0207674_100160926 | 265 |
| 269 | 3300026121 | Ga0207683_10001534 | Ga0207683_100015344 | 265 |
| 270 | 3300026142 | Ga0207698_10212905 | Ga0207698_102129052 | 265 |
| 271 | 3300028380 | Ga0268265_10024213 | Ga0268265_100242132 | 265 |
| 272 | 3300028381 | Ga0268264_10111257 | Ga0268264_101112572 | 265 |
| 273 | 3300031251 | Ga0265327_10000146 | Ga0265327_10000146121 | 265 |
| 274 | 3300031251 | Ga0265327_10054368 | Ga0265327_100543681 | 265 |
| 275 | 3300042876 | Ga0451577_0003255 | Ga0451577_0003255_721_1521 | 265 |
| 276 | 3300044656 | Ga0466969_0120636 | Ga0466969_0120636_116_913 | 265 |
| 277 | 3300045976 | Ga0466967_0391468 | Ga0466967_0391468_470_1267 | 265 |
| 278 | 3300049571 | Ga0501034_0029329 | Ga0501034_0029329_4433_5230 | 265 |
| 279 | 3300049571 | Ga0501034_0160861 | Ga0501034_0160861_693_1490 | 265 |
| 280 | 3300049579 | Ga0501043_0043327 | Ga0501043_0043327_2297_3094 | 265 |
| 281 | 3300049581 | Ga0501047_0125113 | Ga0501047_0125113_1491_2288 | 265 |
| 282 | 3300001979 | JGI24740J21852_10009163 | JGI24740J21852_100091634 | 266 |
| 283 | 3300003323 | rootH1_10195033 | rootH1_101950333 | 266 |
| 284 | 3300005293 | Ga0065715_10105285 | Ga0065715_101052853 | 266 |
| 285 | 3300005327 | Ga0070658_10220953 | Ga0070658_102209532 | 266 |
| 286 | 3300005329 | Ga0070683_100002178 | Ga0070683_1000021787 | 266 |
| 287 | 3300005329 | Ga0070683_100011503 | Ga0070683_1000115037 | 266 |
| 288 | 3300005329 | Ga0070683_100030627 | Ga0070683_1000306273 | 266 |
| 289 | 3300005330 | Ga0070690_100093667 | Ga0070690_1000936672 | 266 |
| 290 | 3300005331 | Ga0070670_100092248 | Ga0070670_1000922483 | 266 |
| 291 | 3300005334 | Ga0068869_100009364 | Ga0068869_1000093644 | 266 |
| 292 | 3300005334 | Ga0068869_100029840 | Ga0068869_1000298402 | 266 |
| 293 | 3300005334 | Ga0068869_100031122 | Ga0068869_1000311225 | 266 |
| 294 | 3300005334 | Ga0068869_100056294 | Ga0068869_1000562942 | 266 |
| 295 | 3300005334 | Ga0068869_100070401 | Ga0068869_1000704012 | 266 |
| 296 | 3300005334 | Ga0068869_100221071 | Ga0068869_1002210712 | 266 |
| 297 | 3300005334 | Ga0068869_100439729 | Ga0068869_1004397292 | 266 |
| 298 | 3300005335 | Ga0070666_10014461 | Ga0070666_100144614 | 266 |
| 299 | 3300005336 | Ga0070680_100007029 | Ga0070680_1000070293 | 266 |
| 300 | 3300005337 | Ga0070682_100002037 | Ga0070682_1000020372 | 266 |
| 301 | 3300005339 | Ga0070660_100108139 | Ga0070660_1001081392 | 266 |
| 302 | 3300005340 | Ga0070689_100192282 | Ga0070689_1001922822 | 266 |
| 303 | 3300005341 | Ga0070691_10014719 | Ga0070691_100147192 | 266 |
| 304 | 3300005343 | Ga0070687_100118240 | Ga0070687_1001182401 | 266 |
| 305 | 3300005344 | Ga0070661_100001463 | Ga0070661_10000146311 | 266 |
| 306 | 3300005344 | Ga0070661_100003861 | Ga0070661_1000038614 | 266 |
| 307 | 3300005347 | Ga0070668_100030905 | Ga0070668_1000309053 | 266 |
| 308 | 3300005353 | Ga0070669_100009965 | Ga0070669_1000099657 | 266 |
| 309 | 3300005354 | Ga0070675_100060546 | Ga0070675_1000605463 | 266 |
| 310 | 3300005354 | Ga0070675_100061227 | Ga0070675_1000612271 | 266 |
| 311 | 3300005364 | Ga0070673_100069030 | Ga0070673_1000690302 | 266 |
| 312 | 3300005364 | Ga0070673_100379397 | Ga0070673_1003793972 | 266 |
| 313 | 3300005365 | Ga0070688_100391450 | Ga0070688_1003914501 | 266 |
| 314 | 3300005366 | Ga0070659_100008743 | Ga0070659_1000087432 | 266 |
| 315 | 3300005456 | Ga0070678_100039308 | Ga0070678_1000393083 | 266 |
| 316 | 3300005456 | Ga0070678_100144629 | Ga0070678_1001446292 | 266 |
| 317 | 3300005457 | Ga0070662_100091358 | Ga0070662_1000913581 | 266 |
| 318 | 3300005457 | Ga0070662_100259634 | Ga0070662_1002596342 | 266 |
| 319 | 3300005458 | Ga0070681_10029132 | Ga0070681_100291322 | 266 |
| 320 | 3300005459 | Ga0068867_100054306 | Ga0068867_1000543063 | 266 |
| 321 | 3300005459 | Ga0068867_100159032 | Ga0068867_1001590322 | 266 |
| 322 | 3300005466 | Ga0070685_10169085 | Ga0070685_101690852 | 266 |
| 323 | 3300005530 | Ga0070679_100068617 | Ga0070679_1000686173 | 266 |
| 324 | 3300005530 | Ga0070679_100238660 | Ga0070679_1002386602 | 266 |
| 325 | 3300005535 | Ga0070684_100008384 | Ga0070684_1000083843 | 266 |
| 326 | 3300005535 | Ga0070684_100123197 | Ga0070684_1001231972 | 266 |
| 327 | 3300005535 | Ga0070684_100214237 | Ga0070684_1002142372 | 266 |
| 328 | 3300005539 | Ga0068853_100331735 | Ga0068853_1003317352 | 266 |
| 329 | 3300005543 | Ga0070672_100277492 | Ga0070672_1002774922 | 266 |
| 330 | 3300005548 | Ga0070665_100179809 | Ga0070665_1001798092 | 266 |
| 331 | 3300005563 | Ga0068855_100332881 | Ga0068855_1003328812 | 266 |
| 332 | 3300005564 | Ga0070664_100016825 | Ga0070664_1000168253 | 266 |
| 333 | 3300005564 | Ga0070664_100058799 | Ga0070664_1000587992 | 266 |
| 334 | 3300005564 | Ga0070664_100201285 | Ga0070664_1002012851 | 266 |
| 335 | 3300005564 | Ga0070664_100621121 | Ga0070664_1006211211 | 266 |
| 336 | 3300005577 | Ga0068857_100001588 | Ga0068857_1000015885 | 266 |
| 337 | 3300005577 | Ga0068857_100010207 | Ga0068857_1000102074 | 266 |
| 338 | 3300005577 | Ga0068857_100015293 | Ga0068857_1000152937 | 266 |
| 339 | 3300005578 | Ga0068854_100446468 | Ga0068854_1004464681 | 266 |
| 340 | 3300005614 | Ga0068856_100009543 | Ga0068856_1000095439 | 266 |
| 341 | 3300005616 | Ga0068852_100076693 | Ga0068852_1000766933 | 266 |
| 342 | 3300005616 | Ga0068852_100181987 | Ga0068852_1001819872 | 266 |
| 343 | 3300005616 | Ga0068852_100676743 | Ga0068852_1006767431 | 266 |
| 344 | 3300005617 | Ga0068859_100016717 | Ga0068859_1000167178 | 266 |
| 345 | 3300005618 | Ga0068864_100083315 | Ga0068864_1000833152 | 266 |
| 346 | 3300005719 | Ga0068861_100007343 | Ga0068861_1000073437 | 266 |
| 347 | 3300005719 | Ga0068861_100016538 | Ga0068861_1000165384 | 266 |
| 348 | 3300005843 | Ga0068860_100004009 | Ga0068860_10000400912 | 266 |
| 349 | 3300005843 | Ga0068860_100014023 | Ga0068860_1000140237 | 266 |
| 350 | 3300005843 | Ga0068860_100523107 | Ga0068860_1005231071 | 266 |
| 351 | 3300005844 | Ga0068862_100039601 | Ga0068862_1000396012 | 266 |
| 352 | 3300006237 | Ga0097621_100025618 | Ga0097621_1000256185 | 266 |
| 353 | 3300006237 | Ga0097621_100096643 | Ga0097621_1000966433 | 266 |
| 354 | 3300006237 | Ga0097621_100244900 | Ga0097621_1002449002 | 266 |
| 355 | 3300006358 | Ga0068871_100004069 | Ga0068871_1000040694 | 266 |
| 356 | 3300006358 | Ga0068871_100191390 | Ga0068871_1001913902 | 266 |
| 357 | 3300006881 | Ga0068865_100276612 | Ga0068865_1002766122 | 266 |
| 358 | 3300006931 | Ga0097620_100016719 | Ga0097620_1000167193 | 266 |
| 359 | 3300009093 | Ga0105240_10004678 | Ga0105240_100046787 | 266 |
| 360 | 3300009093 | Ga0105240_10144907 | Ga0105240_101449073 | 266 |
| 361 | 3300009174 | Ga0105241_10001366 | Ga0105241_1000136610 | 266 |
| 362 | 3300009174 | Ga0105241_10327022 | Ga0105241_103270222 | 266 |
| 363 | 3300009174 | Ga0105241_10528224 | Ga0105241_105282242 | 266 |
| 364 | 3300009176 | Ga0105242_10088686 | Ga0105242_100886862 | 266 |
| 365 | 3300009176 | Ga0105242_10208089 | Ga0105242_102080892 | 266 |
| 366 | 3300009177 | Ga0105248_10265123 | Ga0105248_102651232 | 266 |
| 367 | 3300009545 | Ga0105237_10014557 | Ga0105237_100145576 | 266 |
| 368 | 3300009553 | Ga0105249_10094322 | Ga0105249_100943223 | 266 |
| 369 | 3300009553 | Ga0105249_10158730 | Ga0105249_101587302 | 266 |
| 370 | 3300009553 | Ga0105249_10350113 | Ga0105249_103501132 | 266 |
| 371 | 3300010375 | Ga0105239_10032134 | Ga0105239_100321343 | 266 |
| 372 | 3300010375 | Ga0105239_10108166 | Ga0105239_101081663 | 266 |
| 373 | 3300013100 | Ga0157373_10034656 | Ga0157373_100346563 | 266 |
| 374 | 3300013102 | Ga0157371_10048931 | Ga0157371_100489312 | 266 |
| 375 | 3300013102 | Ga0157371_10190028 | Ga0157371_101900282 | 266 |
| 376 | 3300013104 | Ga0157370_10020571 | Ga0157370_100205713 | 266 |
| 377 | 3300013104 | Ga0157370_10176928 | Ga0157370_101769282 | 266 |
| 378 | 3300013105 | Ga0157369_10025905 | Ga0157369_100259053 | 266 |
| 379 | 3300013105 | Ga0157369_10085498 | Ga0157369_100854983 | 266 |
| 380 | 3300013296 | Ga0157374_10001327 | Ga0157374_1000132715 | 266 |
| 381 | 3300013296 | Ga0157374_10355879 | Ga0157374_103558792 | 266 |
| 382 | 3300013297 | Ga0157378_10047291 | Ga0157378_100472913 | 266 |
| 383 | 3300013297 | Ga0157378_10077309 | Ga0157378_100773093 | 266 |
| 384 | 3300013306 | Ga0163162_10018838 | Ga0163162_100188383 | 266 |
| 385 | 3300013306 | Ga0163162_10049855 | Ga0163162_100498552 | 266 |
| 386 | 3300013306 | Ga0163162_10127133 | Ga0163162_101271333 | 266 |
| 387 | 3300013306 | Ga0163162_10239760 | Ga0163162_102397602 | 266 |
| 388 | 3300013307 | Ga0157372_10373667 | Ga0157372_103736672 | 266 |
| 389 | 3300013307 | Ga0157372_10537569 | Ga0157372_105375691 | 266 |
| 390 | 3300013308 | Ga0157375_10026629 | Ga0157375_100266296 | 266 |
| 391 | 3300013308 | Ga0157375_10041917 | Ga0157375_100419172 | 266 |
| 392 | 3300013308 | Ga0157375_10050185 | Ga0157375_100501855 | 266 |
| 393 | 3300013308 | Ga0157375_10152197 | Ga0157375_101521973 | 266 |
| 394 | 3300014325 | Ga0163163_10034751 | Ga0163163_100347512 | 266 |
| 395 | 3300014325 | Ga0163163_10372647 | Ga0163163_103726472 | 266 |
| 396 | 3300014326 | Ga0157380_10008489 | Ga0157380_100084896 | 266 |
| 397 | 3300014745 | Ga0157377_10006525 | Ga0157377_100065253 | 266 |
| 398 | 3300014745 | Ga0157377_10013421 | Ga0157377_100134212 | 266 |
| 399 | 3300014968 | Ga0157379_10226584 | Ga0157379_102265842 | 266 |
| 400 | 3300014969 | Ga0157376_10038566 | Ga0157376_100385662 | 266 |
| 401 | 3300014969 | Ga0157376_10112340 | Ga0157376_101123402 | 266 |
| 402 | 3300017792 | Ga0163161_10049702 | Ga0163161_100497023 | 266 |
| 403 | 3300017792 | Ga0163161_10060791 | Ga0163161_100607912 | 266 |
| 404 | 3300017792 | Ga0163161_10254391 | Ga0163161_102543912 | 266 |
| 405 | 3300025899 | Ga0207642_10118887 | Ga0207642_101188872 | 266 |
| 406 | 3300025903 | Ga0207680_10032469 | Ga0207680_100324692 | 266 |
| 407 | 3300025907 | Ga0207645_10019000 | Ga0207645_100190004 | 266 |
| 408 | 3300025911 | Ga0207654_10003604 | Ga0207654_100036046 | 266 |
| 409 | 3300025911 | Ga0207654_10008598 | Ga0207654_100085985 | 266 |
| 410 | 3300025912 | Ga0207707_10002309 | Ga0207707_100023097 | 266 |
| 411 | 3300025913 | Ga0207695_10008355 | Ga0207695_100083558 | 266 |
| 412 | 3300025913 | Ga0207695_10025284 | Ga0207695_100252843 | 266 |
| 413 | 3300025914 | Ga0207671_10085076 | Ga0207671_100850762 | 266 |
| 414 | 3300025917 | Ga0207660_10013491 | Ga0207660_100134912 | 266 |
| 415 | 3300025919 | Ga0207657_10200453 | Ga0207657_102004532 | 266 |
| 416 | 3300025919 | Ga0207657_10421626 | Ga0207657_104216262 | 266 |
| 417 | 3300025920 | Ga0207649_10235909 | Ga0207649_102359092 | 266 |
| 418 | 3300025921 | Ga0207652_10001518 | Ga0207652_100015188 | 266 |
| 419 | 3300025923 | Ga0207681_10033480 | Ga0207681_100334803 | 266 |
| 420 | 3300025926 | Ga0207659_10034766 | Ga0207659_100347662 | 266 |
| 421 | 3300025926 | Ga0207659_10096285 | Ga0207659_100962852 | 266 |
| 422 | 3300025932 | Ga0207690_10524915 | Ga0207690_105249151 | 266 |
| 423 | 3300025933 | Ga0207706_10075430 | Ga0207706_100754302 | 266 |
| 424 | 3300025936 | Ga0207670_10145676 | Ga0207670_101456762 | 266 |
| 425 | 3300025938 | Ga0207704_10114233 | Ga0207704_101142332 | 266 |
| 426 | 3300025938 | Ga0207704_10182089 | Ga0207704_101820892 | 266 |
| 427 | 3300025938 | Ga0207704_10363330 | Ga0207704_103633302 | 266 |
| 428 | 3300025940 | Ga0207691_10021597 | Ga0207691_100215973 | 266 |
| 429 | 3300025940 | Ga0207691_10130071 | Ga0207691_101300712 | 266 |
| 430 | 3300025942 | Ga0207689_10025247 | Ga0207689_100252476 | 266 |
| 431 | 3300025942 | Ga0207689_10025491 | Ga0207689_100254916 | 266 |
| 432 | 3300025942 | Ga0207689_10029369 | Ga0207689_100293694 | 266 |
| 433 | 3300025942 | Ga0207689_10043294 | Ga0207689_100432944 | 266 |
| 434 | 3300025944 | Ga0207661_10009265 | Ga0207661_100092652 | 266 |
| 435 | 3300025944 | Ga0207661_10023367 | Ga0207661_100233675 | 266 |
| 436 | 3300025945 | Ga0207679_10002262 | Ga0207679_100022625 | 266 |
| 437 | 3300025945 | Ga0207679_10006678 | Ga0207679_100066785 | 266 |
| 438 | 3300025945 | Ga0207679_10105616 | Ga0207679_101056163 | 266 |
| 439 | 3300025949 | Ga0207667_10027014 | Ga0207667_100270142 | 266 |
| 440 | 3300025949 | Ga0207667_10348756 | Ga0207667_103487562 | 266 |
| 441 | 3300025960 | Ga0207651_10235640 | Ga0207651_102356401 | 266 |
| 442 | 3300025960 | Ga0207651_10365944 | Ga0207651_103659441 | 266 |
| 443 | 3300025961 | Ga0207712_10125881 | Ga0207712_101258812 | 266 |
| 444 | 3300025961 | Ga0207712_10233797 | Ga0207712_102337971 | 266 |
| 445 | 3300025981 | Ga0207640_10080920 | Ga0207640_100809202 | 266 |
| 446 | 3300025981 | Ga0207640_10229612 | Ga0207640_102296122 | 266 |
| 447 | 3300026023 | Ga0207677_10035643 | Ga0207677_100356433 | 266 |
| 448 | 3300026023 | Ga0207677_10062988 | Ga0207677_100629883 | 266 |
| 449 | 3300026041 | Ga0207639_10025530 | Ga0207639_100255304 | 266 |
| 450 | 3300026041 | Ga0207639_10091132 | Ga0207639_100911322 | 266 |
| 451 | 3300026078 | Ga0207702_10029233 | Ga0207702_100292333 | 266 |
| 452 | 3300026089 | Ga0207648_10075459 | Ga0207648_100754593 | 266 |
| 453 | 3300026089 | Ga0207648_10166448 | Ga0207648_101664482 | 266 |
| 454 | 3300026095 | Ga0207676_10027042 | Ga0207676_100270422 | 266 |
| 455 | 3300026116 | Ga0207674_10001797 | Ga0207674_1000179728 | 266 |
| 456 | 3300026116 | Ga0207674_10010086 | Ga0207674_100100866 | 266 |
| 457 | 3300026116 | Ga0207674_10017867 | Ga0207674_100178677 | 266 |
| 458 | 3300026118 | Ga0207675_100009509 | Ga0207675_1000095093 | 266 |
| 459 | 3300026118 | Ga0207675_100020210 | Ga0207675_1000202105 | 266 |
| 460 | 3300026121 | Ga0207683_10105575 | Ga0207683_101055752 | 266 |
| 461 | 3300026142 | Ga0207698_10051989 | Ga0207698_100519892 | 266 |
| 462 | 3300028381 | Ga0268264_10002281 | Ga0268264_100022817 | 266 |
| 463 | 3300028381 | Ga0268264_10720014 | Ga0268264_107200141 | 266 |
| 464 | 3300028794 | Ga0307515_10000091 | Ga0307515_10000091175 | 266 |
| 465 | 3300029957 | Ga0265324_10033389 | Ga0265324_100333892 | 266 |
| 466 | 3300031251 | Ga0265327_10014860 | Ga0265327_100148604 | 266 |
| 467 | 3300031507 | Ga0307509_10078499 | Ga0307509_100784992 | 266 |
| 468 | 3300032004 | Ga0307414_10238206 | Ga0307414_102382062 | 266 |
| 469 | 3300032126 | Ga0307415_100135892 | Ga0307415_1001358922 | 266 |
| 470 | 3300035170 | Ga0373943_0140488 | Ga0373943_0140488_112_921 | 266 |
| 471 | 3300036401 | Ga0373937_0019278 | Ga0373937_0019278_2118_2927 | 266 |
| 472 | 3300036401 | Ga0373937_0350308 | Ga0373937_0350308_411_1211 | 266 |
| 473 | 3300037312 | Ga0395899_0002920 | Ga0395899_0002920_7581_8381 | 266 |
| 474 | 3300037418 | Ga0395900_0011692 | Ga0395900_0011692_1573_2373 | 266 |
| 475 | 3300037466 | Ga0395898_0004939 | Ga0395898_0004939_7251_8051 | 266 |
| 476 | 3300038443 | Ga0395901_0010792 | Ga0395901_0010792_3135_3935 | 266 |
| 477 | 3300041512 | Ga0451853_3842013 | Ga0451853_3842013_17_820 | 266 |
| 478 | 3300042876 | Ga0451577_0013409 | Ga0451577_0013409_162_962 | 266 |
| 479 | 3300042876 | Ga0451577_0126667 | Ga0451577_0126667_1254_2063 | 266 |
| 480 | 3300044712 | Ga0453684_0000841 | Ga0453684_0000841_95888_96688 | 266 |
| 481 | 3300045051 | Ga0451576_0089988 | Ga0451576_0089988_1719_2519 | 266 |
| 482 | 3300046454 | Ga0495592_0019105 | Ga0495592_0019105_778_1587 | 266 |
| 483 | 3300046471 | Ga0495650_0043054 | Ga0495650_0043054_38_838 | 266 |
| 484 | 3300046511 | Ga0495608_0057504 | Ga0495608_0057504_136_945 | 266 |
| 485 | 3300046514 | Ga0495618_0048685 | Ga0495618_0048685_1014_1823 | 266 |
| 486 | 3300046517 | Ga0495630_0006627 | Ga0495630_0006627_4482_5291 | 266 |
| 487 | 3300046522 | Ga0495643_0000248 | Ga0495643_0000248_34826_35656 | 266 |
| 488 | 3300046529 | Ga0495652_0151729 | Ga0495652_0151729_513_1322 | 266 |
| 489 | 3300046533 | Ga0495640_0131983 | Ga0495640_0131983_456_1265 | 266 |
| 490 | 3300046535 | Ga0495586_0091179 | Ga0495586_0091179_619_1428 | 266 |
| 491 | 3300046536 | Ga0495587_0038650 | Ga0495587_0038650_1241_2050 | 266 |
| 492 | 3300046543 | Ga0495645_0138010 | Ga0495645_0138010_844_1653 | 266 |
| 493 | 3300046559 | Ga0495667_0052224 | Ga0495667_0052224_179_988 | 266 |
| 494 | 3300046663 | Ga0495635_0238961 | Ga0495635_0238961_92_901 | 266 |
| 495 | 3300046678 | Ga0495599_0046550 | Ga0495599_0046550_1549_2358 | 266 |
| 496 | 3300046680 | Ga0495646_0099015 | Ga0495646_0099015_788_1597 | 266 |
| 497 | 3300047320 | Ga0495672_0028866 | Ga0495672_0028866_2061_2867 | 266 |
| 498 | 3300047321 | Ga0495676_0111818 | Ga0495676_0111818_606_1415 | 266 |
| 499 | 3300047322 | Ga0495680_0026620 | Ga0495680_0026620_3129_3938 | 266 |
| 500 | 3300048908 | Ga0496105_0298598 | Ga0496105_0298598_369_1169 | 266 |
| 501 | 3300048912 | Ga0496109_0587835 | Ga0496109_0587835_109_918 | 266 |
| 502 | 3300048913 | Ga0496110_0128358 | Ga0496110_0128358_1405_2214 | 266 |
| 503 | 3300049742 | Ga0501080_0047836 | Ga0501080_0047836_1181_1984 | 266 |
| 504 | 3300049823 | Ga0501044_0075395 | Ga0501044_0075395_62_865 | 266 |
| 505 | 3300050511 | nmdc:mga08y16_499740_c1 | nmdc:mga08y16_499740_c1_320_1144 | 266 |
| 506 | 3300053139 | Ga0500568_0010919 | Ga0500568_0010919_1420_2229 | 266 |
| 507 | 3300053153 | Ga0500616_0004086 | Ga0500616_0004086_9525_10334 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i5g-assembly1.cif.gz_C | crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a | 0.9448 | 2 | 246 |
| 4i5d-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form | 0.9444 | 2 | 245 |
| 4bmn-assembly1.cif.gz_B | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9433 | 2 | 245 |
| 6ihi-assembly1.cif.gz_C | crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o | 0.9425 | 2 | 246 |
| 5itv-assembly3.cif.gz_D | crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh | 0.9417 | 3 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0X9U1_21_128_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 2 | 90 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9464 | 3 | 188 | 3.40.50.720 |
| 3dijB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9433 | 7 | 245 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9431 | 3 | 183 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9417 | 3 | 247 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R2Q4J9-F1-model_v4 | Short-chain dehydrogenase | 0.9749 | 1 | 209 |
GO:0016491
|
| AF-A0A0R2Q4J9-F1-model_v4 | Short-chain dehydrogenase | 0.9658 | 1 | 209 |
GO:0016491
|
| AF-A0A2E7QPT6-F1-model_v4 | Short-chain dehydrogenase | 0.9652 | 1 | 179 |
GO:0016491
|
| AF-A0A3G2DSW8-F1-model_v4 | deleted | 0.9638 | 2 | 188 |
|
| AF-A0A7J6ZPE6-F1-model_v4 | deleted | 0.9634 | 3 | 258 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar