F456618

General Info

Members Datasets Scaffolds Average Seq Length
507 231 502 263

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10165614|rootH2_101656142
Length 283
Sequence MHLKKCTTATWSRVSSNLYNMRLLDKVIIVTGSTTGIGKAIAIRCAAEGAKILLHGLEQDWGNEVLTAIGPEKAALHIEDISAEGAPQRLVDKALQTFGKLDAVVNNAAWVVSSNITTTDIPFLQKVLNINTRAPFLLIKEALPHLSRTKGAVLNIGSVNAYSGEPDLMAYSISKGALMTMTRNLGDTLHREYGVRVNQINPGWVLTETEIQRKKEHGLADNWYEALPRVYAPAGRILRPAEIAAAAVYWLADESGPISGQVVDLEQHPFIGRNPPKDNTTIK

Samples

Sample ID Description Type Environment
1 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
2 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
80 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
81 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
214 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
217 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 8005258706 Rhizobium sp. R693 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0.59
Rhizoplane 0.59
Rhizosphere 93.49
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009163 3300001979 Bacteria 3891
2 JGI24739J22299_10104297 3300001989 Bacteria 854
3 JGI25151J46595_10000952 3300003187 Bacteria 22247
4 JGI25406J46586_10002360 3300003203 Bacteria 8925
5 rootH1_10072465 3300003316 Bacteria 2170
6 rootH2_10165614 3300003320 Bacteria 1800
7 rootH2_10186666 3300003320 Unclassified 3045
8 rootL2_10106600 3300003322 Bacteria 1923
9 rootH1_10001888 3300003323 Bacteria 7128
10 rootH1_10195033 3300003323 Bacteria 1451
11 JGI25160J50197_1000662 3300003354 Bacteria 19194
12 Ga0065715_10105285 3300005293 Unclassified 2901
13 Ga0070658_10220953 3300005327 Unclassified 1602
14 Ga0070658_10241992 3300005327 Unclassified 1529
15 Ga0070683_100002178 3300005329 Bacteria 15494
16 Ga0070683_100002417 3300005329 Bacteria 14841
17 Ga0070683_100011503 3300005329 Bacteria 7655
18 Ga0070683_100030627 3300005329 Bacteria 4887
19 Ga0070690_100056643 3300005330 Bacteria 2514
20 Ga0070690_100093667 3300005330 Unclassified 1982
21 Ga0070670_100092248 3300005331 Bacteria 2604
22 Ga0070677_10061330 3300005333 Bacteria 1552
23 Ga0068869_100009364 3300005334 Bacteria 6355
24 Ga0068869_100029840 3300005334 Unclassified 3824
25 Ga0068869_100031122 3300005334 Bacteria 3753
26 Ga0068869_100053980 3300005334 Bacteria 2923
27 Ga0068869_100056294 3300005334 Bacteria 2868
28 Ga0068869_100070401 3300005334 Bacteria 2588
29 Ga0068869_100197578 3300005334 Bacteria 1584
30 Ga0068869_100221071 3300005334 Bacteria 1501
31 Ga0068869_100439729 3300005334 Bacteria 1079
32 Ga0070666_10014461 3300005335 Bacteria 5025
33 Ga0070666_10133269 3300005335 Bacteria 1727
34 Ga0070680_100007029 3300005336 Bacteria 8579
35 Ga0070680_100008276 3300005336 Bacteria 7955
36 Ga0070680_100116804 3300005336 Bacteria 2224
37 Ga0070680_100318639 3300005336 Bacteria 1320
38 Ga0070682_100002037 3300005337 Bacteria 11287
39 Ga0070682_100043847 3300005337 Bacteria 2767
40 Ga0068868_100041008 3300005338 Unclassified 3605
41 Ga0070660_100000709 3300005339 Bacteria 22037
42 Ga0070660_100019733 3300005339 Bacteria 4944
43 Ga0070660_100108139 3300005339 Bacteria 2210
44 Ga0070660_100188193 3300005339 Bacteria 1671
45 Ga0070660_100217507 3300005339 Bacteria 1552
46 Ga0070660_100280418 3300005339 Bacteria 1363
47 Ga0070689_100192282 3300005340 Bacteria 1662
48 Ga0070691_10014719 3300005341 Bacteria 3591
49 Ga0070687_100118240 3300005343 Bacteria 1511
50 Ga0070661_100001463 3300005344 Bacteria 16401
51 Ga0070661_100003861 3300005344 Bacteria 10311
52 Ga0070668_100030905 3300005347 Bacteria 4074
53 Ga0070668_100033492 3300005347 Unclassified 3913
54 Ga0070669_100009965 3300005353 Bacteria 6758
55 Ga0070669_100019533 3300005353 Bacteria 4839
56 Ga0070669_100286466 3300005353 Unclassified 1321
57 Ga0070675_100060546 3300005354 Bacteria 3126
58 Ga0070675_100061227 3300005354 Bacteria 3107
59 Ga0070675_100121323 3300005354 Unclassified 2221
60 Ga0070675_100274482 3300005354 Bacteria 1480
61 Ga0070675_100476566 3300005354 Bacteria 1122
62 Ga0070671_100076258 3300005355 Bacteria 2801
63 Ga0070671_100292184 3300005355 Bacteria 1387
64 Ga0070671_100413834 3300005355 Bacteria 1154
65 Ga0070674_100050165 3300005356 Unclassified 2872
66 Ga0070673_100063853 3300005364 Unclassified 2932
67 Ga0070673_100069030 3300005364 Bacteria 2832
68 Ga0070673_100379397 3300005364 Unclassified 1260
69 Ga0070688_100391450 3300005365 Bacteria 1027
70 Ga0070659_100007003 3300005366 Bacteria 8164
71 Ga0070659_100008743 3300005366 Bacteria 7412
72 Ga0070659_100184146 3300005366 Bacteria 1714
73 Ga0070667_100043984 3300005367 Bacteria 3749
74 Ga0070667_100108520 3300005367 Bacteria 2405
75 Ga0070667_100399836 3300005367 Bacteria 1250
76 Ga0070667_100736383 3300005367 Bacteria 913
77 Ga0070667_100754951 3300005367 Bacteria 902
78 Ga0070678_100039308 3300005456 Unclassified 3336
79 Ga0070678_100124117 3300005456 Bacteria 2041
80 Ga0070678_100144629 3300005456 Bacteria 1907
81 Ga0070662_100025036 3300005457 Bacteria 4118
82 Ga0070662_100091358 3300005457 Unclassified 2286
83 Ga0070662_100108878 3300005457 Bacteria 2108
84 Ga0070662_100259634 3300005457 Bacteria 1399
85 Ga0070681_10029132 3300005458 Bacteria 5543
86 Ga0070681_10295220 3300005458 Bacteria 1531
87 Ga0068867_100054306 3300005459 Bacteria 2960
88 Ga0068867_100056378 3300005459 Unclassified 2907
89 Ga0068867_100092884 3300005459 Unclassified 2292
90 Ga0068867_100159032 3300005459 Bacteria 1780
91 Ga0070685_10065120 3300005466 Bacteria 2145
92 Ga0070685_10169085 3300005466 Bacteria 1400
93 Ga0070679_100068617 3300005530 Bacteria 3536
94 Ga0070679_100201966 3300005530 Bacteria 1953
95 Ga0070679_100202658 3300005530 Unclassified 1949
96 Ga0070679_100238660 3300005530 Unclassified 1776
97 Ga0070684_100008384 3300005535 Bacteria 8074
98 Ga0070684_100123197 3300005535 Unclassified 2333
99 Ga0070684_100214237 3300005535 Bacteria 1756
100 Ga0068853_100004573 3300005539 Bacteria 10729
101 Ga0068853_100331735 3300005539 Bacteria 1412
102 Ga0068853_100764313 3300005539 Unclassified 924
103 Ga0070672_100045223 3300005543 Unclassified 3404
104 Ga0070672_100277492 3300005543 Bacteria 1416
105 Ga0070672_100541141 3300005543 Bacteria 1010
106 Ga0070665_100051542 3300005548 Unclassified 4127
107 Ga0070665_100179809 3300005548 Unclassified 2116
108 Ga0068855_100006753 3300005563 Bacteria 13918
109 Ga0068855_100016996 3300005563 Bacteria 8749
110 Ga0068855_100018440 3300005563 Bacteria 8386
111 Ga0068855_100332881 3300005563 Bacteria 1676
112 Ga0068855_100408701 3300005563 Bacteria 1486
113 Ga0070664_100016825 3300005564 Bacteria 6003
114 Ga0070664_100058799 3300005564 Unclassified 3270
115 Ga0070664_100062152 3300005564 Bacteria 3183
116 Ga0070664_100201285 3300005564 Bacteria 1777
117 Ga0070664_100621121 3300005564 Unclassified 1003
118 Ga0068857_100001588 3300005577 Bacteria 18219
119 Ga0068857_100003611 3300005577 Bacteria 12957
120 Ga0068857_100010207 3300005577 Bacteria 8165
121 Ga0068857_100015293 3300005577 Bacteria 6698
122 Ga0068857_100020090 3300005577 Bacteria 5871
123 Ga0068857_100219696 3300005577 Bacteria 1735
124 Ga0068854_100045217 3300005578 Bacteria 3130
125 Ga0068854_100317772 3300005578 Bacteria 1265
126 Ga0068854_100446468 3300005578 Unclassified 1079
127 Ga0068856_100009543 3300005614 Bacteria 9429
128 Ga0068856_100042155 3300005614 Bacteria 4489
129 Ga0068856_100296011 3300005614 Bacteria 1635
130 Ga0068856_100420992 3300005614 Bacteria 1355
131 Ga0068852_100000410 3300005616 Bacteria 28619
132 Ga0068852_100005821 3300005616 Bacteria 8851
133 Ga0068852_100076693 3300005616 Bacteria 2952
134 Ga0068852_100181987 3300005616 Bacteria 1977
135 Ga0068852_100415199 3300005616 Bacteria 1326
136 Ga0068852_100676743 3300005616 Bacteria 1041
137 Ga0068859_100016717 3300005617 Bacteria 7365
138 Ga0068859_100024651 3300005617 Bacteria 6037
139 Ga0068859_100161511 3300005617 Bacteria 2319
140 Ga0068864_100070143 3300005618 Bacteria 3049
141 Ga0068864_100083315 3300005618 Bacteria 2808
142 Ga0068861_100007343 3300005719 Bacteria 7550
143 Ga0068861_100016538 3300005719 Bacteria 5222
144 Ga0068863_100271099 3300005841 Bacteria 1643
145 Ga0068860_100004009 3300005843 Bacteria 15116
146 Ga0068860_100014023 3300005843 Bacteria 7862
147 Ga0068860_100035569 3300005843 Bacteria 4777
148 Ga0068860_100056169 3300005843 Unclassified 3744
149 Ga0068860_100328540 3300005843 Bacteria 1502
150 Ga0068860_100523107 3300005843 Unclassified 1186
151 Ga0068862_100009417 3300005844 Bacteria 8080
152 Ga0068862_100039601 3300005844 Bacteria 4003
153 Ga0068862_100099588 3300005844 Unclassified 2541
154 Ga0081539_10000338 3300005985 Bacteria 103849
155 Ga0075364_10099580 3300006051 Bacteria 1935
156 Ga0097621_100025618 3300006237 Bacteria 4616
157 Ga0097621_100096643 3300006237 Bacteria 2479
158 Ga0097621_100125831 3300006237 Bacteria 2177
159 Ga0097621_100189009 3300006237 Bacteria 1783
160 Ga0097621_100244900 3300006237 Unclassified 1568
161 Ga0097621_100347834 3300006237 Bacteria 1318
162 Ga0097621_100358551 3300006237 Bacteria 1298
163 Ga0068871_100004069 3300006358 Bacteria 10115
164 Ga0068871_100191390 3300006358 Unclassified 1762
165 Ga0075428_100007909 3300006844 Bacteria 11789
166 Ga0075428_100338452 3300006844 Bacteria 1616
167 Ga0075429_100022346 3300006880 Bacteria 5486
168 Ga0075429_100421559 3300006880 Bacteria 1169
169 Ga0075429_100447183 3300006880 Unclassified 1132
170 Ga0068865_100150648 3300006881 Bacteria 1764
171 Ga0068865_100276612 3300006881 Bacteria 1335
172 Ga0097620_100016719 3300006931 Bacteria 7365
173 Ga0097620_100024651 3300006931 Bacteria 6037
174 Ga0097620_100161510 3300006931 Bacteria 2319
175 Ga0105240_10001165 3300009093 Bacteria 46077
176 Ga0105240_10001264 3300009093 Bacteria 43767
177 Ga0105240_10004678 3300009093 Bacteria 20688
178 Ga0105240_10005683 3300009093 Bacteria 18511
179 Ga0105240_10144907 3300009093 Bacteria 2835
180 Ga0111539_10001995 3300009094 Bacteria 27227
181 Ga0111539_10039960 3300009094 Bacteria 5649
182 Ga0111539_10066664 3300009094 Bacteria 4252
183 Ga0105247_10110004 3300009101 Bacteria 1772
184 Ga0105247_10167630 3300009101 Bacteria 1458
185 Ga0114129_10007759 3300009147 Bacteria 15265
186 Ga0105241_10001366 3300009174 Bacteria 18591
187 Ga0105241_10020047 3300009174 Bacteria 4938
188 Ga0105241_10114802 3300009174 Unclassified 2161
189 Ga0105241_10327022 3300009174 Unclassified 1324
190 Ga0105241_10528224 3300009174 Unclassified 1056
191 Ga0105242_10088686 3300009176 Unclassified 2599
192 Ga0105242_10208089 3300009176 Bacteria 1741
193 Ga0105248_10265123 3300009177 Bacteria 1934
194 Ga0105237_10014557 3300009545 Bacteria 8220
195 Ga0105237_10136947 3300009545 Bacteria 2443
196 Ga0105237_10216184 3300009545 Unclassified 1917
197 Ga0105238_10011379 3300009551 Bacteria 8957
198 Ga0105238_10035408 3300009551 Bacteria 5076
199 Ga0105238_10119004 3300009551 Bacteria 2621
200 Ga0105249_10094322 3300009553 Bacteria 2805
201 Ga0105249_10158730 3300009553 Bacteria 2184
202 Ga0105249_10350113 3300009553 Bacteria 1496
203 Ga0123341_1000054 3300009765 Bacteria 48678
204 Ga0123342_1006389 3300009766 Bacteria 16386
205 Ga0105033_100448 3300009986 Bacteria 3198
206 Ga0105239_10014753 3300010375 Bacteria 8665
207 Ga0105239_10032134 3300010375 Bacteria 5768
208 Ga0105239_10108166 3300010375 Bacteria 3081
209 Ga0105239_10161438 3300010375 Unclassified 2504
210 Ga0157373_10034656 3300013100 Bacteria 3626
211 Ga0157373_10241560 3300013100 Unclassified 1277
212 Ga0157371_10012767 3300013102 Bacteria 6404
213 Ga0157371_10017210 3300013102 Bacteria 5374
214 Ga0157371_10048931 3300013102 Unclassified 3004
215 Ga0157371_10071117 3300013102 Unclassified 2463
216 Ga0157371_10090968 3300013102 Unclassified 2161
217 Ga0157371_10190028 3300013102 Bacteria 1470
218 Ga0157370_10020571 3300013104 Bacteria 6589
219 Ga0157370_10058722 3300013104 Bacteria 3656
220 Ga0157370_10168298 3300013104 Unclassified 2038
221 Ga0157370_10176928 3300013104 Unclassified 1983
222 Ga0157370_10634471 3300013104 Bacteria 977
223 Ga0157369_10025905 3300013105 Bacteria 6507
224 Ga0157369_10085498 3300013105 Bacteria 3370
225 Ga0157369_10088117 3300013105 Bacteria 3313
226 Ga0157369_10148890 3300013105 Bacteria 2474
227 Ga0157369_10435959 3300013105 Bacteria 1358
228 Ga0157374_10001327 3300013296 Bacteria 21026
229 Ga0157374_10023391 3300013296 Bacteria 5527
230 Ga0157374_10061971 3300013296 Bacteria 3504
231 Ga0157374_10066516 3300013296 Bacteria 3387
232 Ga0157374_10094217 3300013296 Bacteria 2861
233 Ga0157374_10355879 3300013296 Bacteria 1455
234 Ga0157378_10047291 3300013297 Unclassified 3825
235 Ga0157378_10077309 3300013297 Bacteria 3000
236 Ga0163162_10018838 3300013306 Bacteria 6767
237 Ga0163162_10049855 3300013306 Bacteria 4198
238 Ga0163162_10127133 3300013306 Bacteria 2656
239 Ga0163162_10239760 3300013306 Bacteria 1944
240 Ga0157372_10000230 3300013307 Bacteria 62343
241 Ga0157372_10214162 3300013307 Bacteria 2232
242 Ga0157372_10226217 3300013307 Bacteria 2169
243 Ga0157372_10373667 3300013307 Bacteria 1661
244 Ga0157372_10537569 3300013307 Bacteria 1362
245 Ga0157375_10026629 3300013308 Bacteria 5393
246 Ga0157375_10041917 3300013308 Bacteria 4425
247 Ga0157375_10050185 3300013308 Bacteria 4092
248 Ga0157375_10152197 3300013308 Bacteria 2450
249 Ga0157375_10286117 3300013308 Bacteria 1811
250 Ga0163163_10034751 3300014325 Bacteria 4885
251 Ga0163163_10059837 3300014325 Bacteria 3769
252 Ga0163163_10372647 3300014325 Unclassified 1485
253 Ga0157380_10007608 3300014326 Bacteria 7700
254 Ga0157380_10008489 3300014326 Bacteria 7338
255 Ga0157377_10006525 3300014745 Bacteria 5570
256 Ga0157377_10013421 3300014745 Bacteria 4146
257 Ga0157377_10116799 3300014745 Bacteria 1611
258 Ga0157379_10140999 3300014968 Unclassified 2173
259 Ga0157379_10153642 3300014968 Unclassified 2076
260 Ga0157379_10226584 3300014968 Bacteria 1694
261 Ga0157376_10038566 3300014969 Unclassified 3888
262 Ga0157376_10112340 3300014969 Unclassified 2400
263 Ga0157376_10212394 3300014969 Bacteria 1787
264 Ga0163161_10049702 3300017792 Unclassified 3032
265 Ga0163161_10060791 3300017792 Unclassified 2750
266 Ga0163161_10254391 3300017792 Unclassified 1370
267 Ga0209130_1000821 3300025284 Bacteria 26175
268 Ga0209025_1000282 3300025294 Bacteria 115627
269 Ga0209758_1005277 3300025297 Bacteria 10099
270 Ga0207426_1000026 3300025302 Bacteria 515228
271 Ga0207426_1000182 3300025302 Bacteria 155724
272 Ga0207697_10020982 3300025315 Bacteria 2675
273 Ga0207682_10009901 3300025893 Bacteria 3746
274 Ga0207642_10118887 3300025899 Bacteria 1359
275 Ga0207680_10032469 3300025903 Unclassified 2968
276 Ga0207680_10159496 3300025903 Bacteria 1511
277 Ga0207645_10008724 3300025907 Bacteria 7060
278 Ga0207645_10019000 3300025907 Bacteria 4512
279 Ga0207705_10041871 3300025909 Unclassified 3286
280 Ga0207705_10143341 3300025909 Bacteria 1785
281 Ga0207654_10003604 3300025911 Bacteria 7821
282 Ga0207654_10008598 3300025911 Bacteria 5170
283 Ga0207654_10048336 3300025911 Unclassified 2434
284 Ga0207654_10101338 3300025911 Bacteria 1775
285 Ga0207654_10112796 3300025911 Unclassified 1694
286 Ga0207654_10120342 3300025911 Bacteria 1647
287 Ga0207707_10002309 3300025912 Bacteria 17195
288 Ga0207707_10102970 3300025912 Bacteria 2496
289 Ga0207707_10316290 3300025912 Bacteria 1348
290 Ga0207695_10000586 3300025913 Bacteria 73584
291 Ga0207695_10001138 3300025913 Bacteria 46094
292 Ga0207695_10008355 3300025913 Bacteria 12968
293 Ga0207695_10025284 3300025913 Bacteria 6651
294 Ga0207695_10060329 3300025913 Bacteria 3927
295 Ga0207695_10174415 3300025913 Bacteria 2073
296 Ga0207671_10085076 3300025914 Bacteria 2376
297 Ga0207671_10115826 3300025914 Unclassified 2044
298 Ga0207660_10013491 3300025917 Bacteria 5354
299 Ga0207660_10237510 3300025917 Bacteria 1435
300 Ga0207657_10002023 3300025919 Bacteria 21914
301 Ga0207657_10002233 3300025919 Bacteria 20999
302 Ga0207657_10036684 3300025919 Bacteria 4386
303 Ga0207657_10140622 3300025919 Unclassified 1972
304 Ga0207657_10200453 3300025919 Unclassified 1606
305 Ga0207657_10421626 3300025919 Unclassified 1049
306 Ga0207649_10235909 3300025920 Bacteria 1310
307 Ga0207652_10001518 3300025921 Bacteria 20482
308 Ga0207652_10145742 3300025921 Bacteria 2119
309 Ga0207652_10341694 3300025921 Bacteria 1351
310 Ga0207681_10033480 3300025923 Bacteria 3369
311 Ga0207694_10006765 3300025924 Bacteria 8706
312 Ga0207694_10138045 3300025924 Unclassified 1959
313 Ga0207694_10224202 3300025924 Bacteria 1534
314 Ga0207659_10034766 3300025926 Bacteria 3478
315 Ga0207659_10096285 3300025926 Unclassified 2221
316 Ga0207659_10218964 3300025926 Bacteria 1529
317 Ga0207659_10443389 3300025926 Bacteria 1092
318 Ga0207644_10174561 3300025931 Bacteria 1680
319 Ga0207690_10524915 3300025932 Bacteria 960
320 Ga0207706_10075430 3300025933 Bacteria 2965
321 Ga0207706_10078503 3300025933 Bacteria 2903
322 Ga0207706_10126064 3300025933 Bacteria 2252
323 Ga0207706_10181342 3300025933 Unclassified 1849
324 Ga0207670_10145676 3300025936 Bacteria 1751
325 Ga0207704_10114233 3300025938 Bacteria 1833
326 Ga0207704_10182089 3300025938 Unclassified 1519
327 Ga0207704_10363330 3300025938 Bacteria 1131
328 Ga0207691_10021597 3300025940 Bacteria 6076
329 Ga0207691_10057333 3300025940 Unclassified 3545
330 Ga0207691_10130071 3300025940 Bacteria 2224
331 Ga0207711_10242169 3300025941 Unclassified 1654
332 Ga0207689_10015187 3300025942 Bacteria 6522
333 Ga0207689_10025247 3300025942 Bacteria 4980
334 Ga0207689_10025491 3300025942 Bacteria 4955
335 Ga0207689_10029369 3300025942 Bacteria 4592
336 Ga0207689_10043294 3300025942 Unclassified 3722
337 Ga0207689_10067755 3300025942 Bacteria 2933
338 Ga0207661_10009265 3300025944 Bacteria 7056
339 Ga0207661_10023367 3300025944 Unclassified 4670
340 Ga0207661_10083486 3300025944 Bacteria 2644
341 Ga0207679_10002262 3300025945 Bacteria 11874
342 Ga0207679_10006678 3300025945 Bacteria 7305
343 Ga0207679_10105616 3300025945 Bacteria 2212
344 Ga0207679_10134493 3300025945 Bacteria 1989
345 Ga0207679_10377223 3300025945 Bacteria 1242
346 Ga0207667_10000309 3300025949 Bacteria 67726
347 Ga0207667_10027014 3300025949 Bacteria 6259
348 Ga0207667_10047851 3300025949 Unclassified 4524
349 Ga0207667_10143809 3300025949 Bacteria 2455
350 Ga0207667_10348756 3300025949 Bacteria 1510
351 Ga0207651_10235640 3300025960 Bacteria 1489
352 Ga0207651_10365944 3300025960 Bacteria 1218
353 Ga0207712_10125881 3300025961 Bacteria 1945
354 Ga0207712_10233797 3300025961 Bacteria 1477
355 Ga0207640_10080920 3300025981 Bacteria 2219
356 Ga0207640_10229612 3300025981 Unclassified 1427
357 Ga0207658_10105992 3300025986 Unclassified 2212
358 Ga0207658_10406770 3300025986 Bacteria 1197
359 Ga0207677_10035643 3300026023 Bacteria 3233
360 Ga0207677_10062988 3300026023 Bacteria 2575
361 Ga0207677_10228766 3300026023 Unclassified 1496
362 Ga0207639_10025530 3300026041 Bacteria 4284
363 Ga0207639_10087142 3300026041 Bacteria 2488
364 Ga0207639_10091132 3300026041 Unclassified 2440
365 Ga0207702_10029233 3300026078 Bacteria 4585
366 Ga0207702_10071162 3300026078 Bacteria 2994
367 Ga0207702_10250424 3300026078 Bacteria 1663
368 Ga0207702_10362295 3300026078 Bacteria 1390
369 Ga0207648_10011745 3300026089 Bacteria 8235
370 Ga0207648_10075459 3300026089 Bacteria 2939
371 Ga0207648_10166448 3300026089 Bacteria 1948
372 Ga0207676_10027042 3300026095 Bacteria 4269
373 Ga0207676_10184372 3300026095 Unclassified 1830
374 Ga0207674_10001219 3300026116 Bacteria 33514
375 Ga0207674_10001797 3300026116 Bacteria 27330
376 Ga0207674_10010086 3300026116 Bacteria 10741
377 Ga0207674_10016092 3300026116 Bacteria 8193
378 Ga0207674_10017867 3300026116 Bacteria 7731
379 Ga0207674_10037790 3300026116 Bacteria 5017
380 Ga0207674_10055340 3300026116 Bacteria 4034
381 Ga0207675_100009509 3300026118 Bacteria 9096
382 Ga0207675_100020210 3300026118 Bacteria 6208
383 Ga0207675_100063332 3300026118 Unclassified 3455
384 Ga0207683_10001534 3300026121 Bacteria 20806
385 Ga0207683_10105575 3300026121 Bacteria 2518
386 Ga0207698_10000848 3300026142 Bacteria 17751
387 Ga0207698_10051989 3300026142 Bacteria 3136
388 Ga0207698_10212905 3300026142 Bacteria 1740
389 Ga0209971_1008470 3300027682 Bacteria 2438
390 Ga0268265_10024213 3300028380 Bacteria 4292
391 Ga0268264_10002281 3300028381 Bacteria 16987
392 Ga0268264_10111257 3300028381 Unclassified 2399
393 Ga0268264_10720014 3300028381 Bacteria 992
394 Ga0307515_10000091 3300028794 Bacteria 214014
395 Ga0265324_10033389 3300029957 Bacteria 1796
396 Ga0265327_10000146 3300031251 Bacteria 154436
397 Ga0265327_10014860 3300031251 Bacteria 5068
398 Ga0265327_10054368 3300031251 Unclassified 2073
399 Ga0307509_10078499 3300031507 Unclassified 3420
400 Ga0307408_100128875 3300031548 Bacteria 1971
401 Ga0316575_10035651 3300031665 Bacteria 1956
402 Ga0316579_10005351 3300031691 Bacteria 5174
403 Ga0316576_10009793 3300031727 Bacteria 6204
404 Ga0316578_10054919 3300031728 Bacteria 2336
405 Ga0316577_10008316 3300031733 Bacteria 5558
406 Ga0307413_10051113 3300031824 Bacteria 2489
407 Ga0307412_10037016 3300031911 Bacteria 3132
408 Ga0307409_100040863 3300031995 Bacteria 3458
409 Ga0307416_100037438 3300032002 Bacteria 3733
410 Ga0307414_10012112 3300032004 Bacteria 5087
411 Ga0307414_10157370 3300032004 Bacteria 1800
412 Ga0307414_10238206 3300032004 Unclassified 1505
413 Ga0307414_10245229 3300032004 Bacteria 1485
414 Ga0307415_100135892 3300032126 Unclassified 1870
415 Ga0373943_0140488 3300035170 Bacteria 1301
416 Ga0316574_0016495 3300035398 Bacteria 4306
417 Ga0316574_0168368 3300035398 Unclassified 1411
418 Ga0373947_0193387 3300035725 Bacteria 1328
419 Ga0373937_0019278 3300036401 Bacteria 6105
420 Ga0373937_0350308 3300036401 Bacteria 1399
421 Ga0316582_0007857 3300036647 Bacteria 5699
422 Ga0316584_0001490 3300036712 Bacteria 14080
423 Ga0316584_0022580 3300036712 Bacteria 4592
424 Ga0395899_0002920 3300037312 Bacteria 13725
425 Ga0395900_0011692 3300037418 Bacteria 8979
426 Ga0395898_0004939 3300037466 Bacteria 14471
427 Ga0395901_0010792 3300038443 Bacteria 9259
428 Ga0436365_1088492 3300039437 Bacteria 1000
429 Ga0451837_1188898 3300041494 Bacteria 1692
430 Ga0451853_3842013 3300041512 Bacteria 890
431 Ga0439431_0075999 3300041997 Bacteria 901
432 Ga0451577_0003069 3300042876 Bacteria 18896
433 Ga0451577_0003255 3300042876 Bacteria 18261
434 Ga0451577_0013409 3300042876 Bacteria 7671
435 Ga0451577_0126667 3300042876 Unclassified 2289
436 Ga0466969_0120636 3300044656 Bacteria 1221
437 Ga0466972_0023199 3300044658 Bacteria 3086
438 Ga0453684_0000841 3300044712 Bacteria 103501
439 Ga0453684_0001009 3300044712 Bacteria 91051
440 Ga0466968_0148479 3300044735 Bacteria 1076
441 Ga0466960_0059218 3300044901 Bacteria 1873
442 Ga0451576_0041294 3300045051 Bacteria 4878
443 Ga0451576_0089988 3300045051 Bacteria 3192
444 Ga0466967_0391468 3300045976 Bacteria 1351
445 Ga0495592_0019105 3300046454 Bacteria 5215
446 Ga0495650_0043054 3300046471 Bacteria 1919
447 Ga0495608_0057504 3300046511 Bacteria 2566
448 Ga0495618_0048685 3300046514 Bacteria 2676
449 Ga0495630_0006627 3300046517 Bacteria 8251
450 Ga0495630_0190278 3300046517 Bacteria 1566
451 Ga0495643_0000248 3300046522 Bacteria 79547
452 Ga0495652_0151729 3300046529 Bacteria 1810
453 Ga0495640_0131983 3300046533 Bacteria 1616
454 Ga0495586_0091179 3300046535 Bacteria 1684
455 Ga0495587_0038650 3300046536 Bacteria 2860
456 Ga0495645_0138010 3300046543 Bacteria 1704
457 Ga0495667_0052224 3300046559 Bacteria 2694
458 Ga0495635_0238961 3300046663 Bacteria 1226
459 Ga0495599_0046550 3300046678 Bacteria 2720
460 Ga0495646_0099015 3300046680 Bacteria 1674
461 Ga0495672_0028866 3300047320 Bacteria 3503
462 Ga0495676_0111818 3300047321 Bacteria 2003
463 Ga0495680_0026620 3300047322 Bacteria 4764
464 Ga0496105_0298598 3300048908 Bacteria 1295
465 Ga0496109_0587835 3300048912 Bacteria 1049
466 Ga0496110_0128358 3300048913 Bacteria 2288
467 Ga0501299_043524 3300049522 Bacteria 908
468 Ga0501033_0033223 3300049570 Bacteria 3874
469 Ga0501034_0029329 3300049571 Bacteria 5591
470 Ga0501034_0160861 3300049571 Bacteria 2216
471 Ga0501034_0210690 3300049571 Bacteria 1899
472 Ga0501034_0475011 3300049571 Unclassified 1166
473 Ga0501037_0006592 3300049573 Bacteria 8490
474 Ga0501038_0010536 3300049574 Bacteria 8456
475 Ga0501043_0003923 3300049579 Bacteria 12202
476 Ga0501043_0008195 3300049579 Bacteria 8239
477 Ga0501043_0043327 3300049579 Unclassified 3538
478 Ga0501047_0009285 3300049581 Bacteria 9291
479 Ga0501047_0125113 3300049581 Bacteria 2452
480 Ga0501217_056218 3300049661 Bacteria 1040
481 Ga0501223_001738 3300049663 Bacteria 4956
482 Ga0501242_000489 3300049674 Bacteria 3488
483 Ga0501257_007115 3300049686 Bacteria 2496
484 Ga0501221_000060 3300049704 Bacteria 11755
485 Ga0501245_010528 3300049708 Bacteria 1337
486 Ga0501080_0047836 3300049742 Bacteria 3982
487 Ga0501035_0091950 3300049822 Unclassified 2670
488 Ga0501035_0138188 3300049822 Unclassified 2120
489 Ga0501044_0016580 3300049823 Bacteria 7907
490 Ga0501044_0075395 3300049823 Bacteria 3425
491 Ga0501044_0224311 3300049823 Bacteria 1829
492 nmdc:mga00v17_57409_c1 3300050491 Bacteria 2381
493 nmdc:mga06z11_130879_c1 3300050494 Bacteria 1409
494 nmdc:mga05p37_205113_c1 3300050507 Bacteria 2385
495 nmdc:mga09592_33894_c1 3300050508 Unclassified 4266
496 nmdc:mga06r32_234100_c1 3300050510 Bacteria 1825
497 nmdc:mga08y16_499740_c1 3300050511 Unclassified 1236
498 Ga0500568_0010919 3300053139 Bacteria 4234
499 Ga0500616_0004086 3300053153 Bacteria 10599
500 Ga0500616_0036197 3300053153 Bacteria 2680
501 Ga0500622_0001810 3300053156 Bacteria 16284
502 Ga0501084_0452975 3300054114 Bacteria 1085

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027682 Ga0209971_1008470 Ga0209971_10084702 209
2 3300026118 Ga0207675_100063332 Ga0207675_1000633322 224
3 3300013100 Ga0157373_10241560 Ga0157373_102415602 228
4 3300013102 Ga0157371_10090968 Ga0157371_100909682 228
5 3300005354 Ga0070675_100274482 Ga0070675_1002744822 229
6 3300025944 Ga0207661_10083486 Ga0207661_100834862 230
7 3300049704 Ga0501221_000060 Ga0501221_000060_51_752 233
8 3300005330 Ga0070690_100056643 Ga0070690_1000566431 234
9 3300005354 Ga0070675_100121323 Ga0070675_1001213232 234
10 3300005355 Ga0070671_100076258 Ga0070671_1000762582 234
11 3300005367 Ga0070667_100108520 Ga0070667_1001085203 234
12 3300005457 Ga0070662_100108878 Ga0070662_1001088781 234
13 3300005459 Ga0068867_100056378 Ga0068867_1000563782 234
14 3300005466 Ga0070685_10065120 Ga0070685_100651202 234
15 3300005843 Ga0068860_100328540 Ga0068860_1003285401 234
16 3300006237 Ga0097621_100125831 Ga0097621_1001258313 234
17 3300013296 Ga0157374_10094217 Ga0157374_100942172 234
18 3300013308 Ga0157375_10286117 Ga0157375_102861172 234
19 3300014969 Ga0157376_10212394 Ga0157376_102123941 234
20 3300025926 Ga0207659_10218964 Ga0207659_102189642 234
21 3300025931 Ga0207644_10174561 Ga0207644_101745612 234
22 3300025933 Ga0207706_10126064 Ga0207706_101260641 234
23 3300025941 Ga0207711_10242169 Ga0207711_102421692 234
24 3300025945 Ga0207679_10134493 Ga0207679_101344933 234
25 3300025945 Ga0207679_10377223 Ga0207679_103772231 234
26 3300035725 Ga0373947_0193387 Ga0373947_0193387_83_796 234
27 3300025911 Ga0207654_10120342 Ga0207654_101203422 235
28 3300013296 Ga0157374_10061971 Ga0157374_100619714 238
29 3300005618 Ga0068864_100070143 Ga0068864_1000701434 239
30 3300009101 Ga0105247_10110004 Ga0105247_101100042 239
31 3300014325 Ga0163163_10059837 Ga0163163_100598375 239
32 3300026095 Ga0207676_10184372 Ga0207676_101843722 239
33 3300005339 Ga0070660_100280418 Ga0070660_1002804181 245
34 3300013105 Ga0157369_10435959 Ga0157369_104359592 245
35 3300005336 Ga0070680_100116804 Ga0070680_1001168042 246
36 3300005458 Ga0070681_10295220 Ga0070681_102952202 246
37 3300005577 Ga0068857_100219696 Ga0068857_1002196962 246
38 3300025912 Ga0207707_10102970 Ga0207707_101029703 246
39 3300025921 Ga0207652_10145742 Ga0207652_101457422 246
40 3300026116 Ga0207674_10055340 Ga0207674_100553402 246
41 3300035398 Ga0316574_0168368 Ga0316574_0168368_484_1296 248
42 3300006051 Ga0075364_10099580 Ga0075364_100995802 249
43 3300009545 Ga0105237_10136947 Ga0105237_101369472 249
44 3300025911 Ga0207654_10101338 Ga0207654_101013382 249
45 3300050491 nmdc:mga00v17_57409_c1 nmdc:mga00v17_57409_c1_754_1533 249
46 3300046517 Ga0495630_0190278 Ga0495630_0190278_322_1122 250
47 iso_pu_bacteria 2844533157 2844536682 250
48 iso_pu_bacteria 8005258706 8005263217 250
49 3300006880 Ga0075429_100421559 Ga0075429_1004215592 252
50 3300009093 Ga0105240_10001165 Ga0105240_1000116528 252
51 3300009101 Ga0105247_10167630 Ga0105247_101676302 252
52 3300009551 Ga0105238_10119004 Ga0105238_101190042 252
53 3300010375 Ga0105239_10014753 Ga0105239_100147534 252
54 3300025913 Ga0207695_10001138 Ga0207695_1000113811 252
55 3300025924 Ga0207694_10224202 Ga0207694_102242022 252
56 3300054114 Ga0501084_0452975 Ga0501084_0452975_98_874 252
57 3300014968 Ga0157379_10153642 Ga0157379_101536423 253
58 3300050494 nmdc:mga06z11_130879_c1 nmdc:mga06z11_130879_c1_244_1035 253
59 3300001989 JGI24739J22299_10104297 JGI24739J22299_101042971 254
60 3300003187 JGI25151J46595_10000952 JGI25151J46595_100009527 254
61 3300009765 Ga0123341_1000054 Ga0123341_100005423 254
62 3300009766 Ga0123342_1006389 Ga0123342_10063897 254
63 3300009986 Ga0105033_100448 Ga0105033_1004482 254
64 3300025284 Ga0209130_1000821 Ga0209130_100082113 254
65 3300025294 Ga0209025_1000282 Ga0209025_100028259 254
66 3300025297 Ga0209758_1005277 Ga0209758_10052777 254
67 3300025302 Ga0207426_1000182 Ga0207426_100018213 254
68 3300041997 Ga0439431_0075999 Ga0439431_0075999_96_869 254
69 3300006237 Ga0097621_100358551 Ga0097621_1003585511 255
70 3300010375 Ga0105239_10161438 Ga0105239_101614382 257
71 3300003203 JGI25406J46586_10002360 JGI25406J46586_100023604 258
72 3300005539 Ga0068853_100764313 Ga0068853_1007643131 258
73 3300005985 Ga0081539_10000338 Ga0081539_1000033837 258
74 3300006844 Ga0075428_100338452 Ga0075428_1003384522 258
75 3300006880 Ga0075429_100022346 Ga0075429_1000223464 258
76 3300009147 Ga0114129_10007759 Ga0114129_100077594 258
77 3300013102 Ga0157371_10012767 Ga0157371_100127672 258
78 3300013102 Ga0157371_10017210 Ga0157371_100172102 258
79 3300013104 Ga0157370_10058722 Ga0157370_100587221 258
80 3300013104 Ga0157370_10634471 Ga0157370_106344711 258
81 3300025913 Ga0207695_10174415 Ga0207695_101744152 258
82 3300049522 Ga0501299_043524 Ga0501299_043524_18_794 258
83 3300049663 Ga0501223_001738 Ga0501223_001738_1480_2256 258
84 3300049674 Ga0501242_000489 Ga0501242_000489_969_1745 258
85 3300049686 Ga0501257_007115 Ga0501257_007115_640_1416 258
86 3300049708 Ga0501245_010528 Ga0501245_010528_485_1261 258
87 3300050507 nmdc:mga05p37_205113_c1 nmdc:mga05p37_205113_c1_1039_1815 258
88 3300050508 nmdc:mga09592_33894_c1 nmdc:mga09592_33894_c1_2553_3329 258
89 3300050510 nmdc:mga06r32_234100_c1 nmdc:mga06r32_234100_c1_26_802 258
90 3300031727 Ga0316576_10009793 Ga0316576_100097933 259
91 3300035398 Ga0316574_0016495 Ga0316574_0016495_3186_3965 259
92 3300036712 Ga0316584_0022580 Ga0316584_0022580_126_905 259
93 3300031665 Ga0316575_10035651 Ga0316575_100356513 260
94 3300031691 Ga0316579_10005351 Ga0316579_100053512 260
95 3300031728 Ga0316578_10054919 Ga0316578_100549192 260
96 3300031733 Ga0316577_10008316 Ga0316577_100083165 260
97 3300036647 Ga0316582_0007857 Ga0316582_0007857_3079_3864 260
98 3300036712 Ga0316584_0001490 Ga0316584_0001490_4253_5038 260
99 iso_pu_bacteria 2910245624 2910247868 260
100 3300031548 Ga0307408_100128875 Ga0307408_1001288752 261
101 3300031824 Ga0307413_10051113 Ga0307413_100511132 261
102 3300031911 Ga0307412_10037016 Ga0307412_100370163 261
103 3300031995 Ga0307409_100040863 Ga0307409_1000408633 261
104 3300032002 Ga0307416_100037438 Ga0307416_1000374383 261
105 iso_pu_bacteria 2919692658 2919697728 261
106 3300049570 Ga0501033_0033223 Ga0501033_0033223_1180_1968 262
107 3300049573 Ga0501037_0006592 Ga0501037_0006592_34_822 262
108 3300049574 Ga0501038_0010536 Ga0501038_0010536_863_1651 262
109 3300049579 Ga0501043_0003923 Ga0501043_0003923_3318_4106 262
110 3300049579 Ga0501043_0008195 Ga0501043_0008195_7369_8157 262
111 3300049581 Ga0501047_0009285 Ga0501047_0009285_164_952 262
112 3300049823 Ga0501044_0016580 Ga0501044_0016580_5923_6711 262
113 iso_pu_bacteria 2896085136 2896089518 262
114 3300003320 rootH2_10165614 rootH2_101656142 263
115 3300003320 rootH2_10186666 rootH2_101866663 263
116 3300003322 rootL2_10106600 rootL2_101066001 263
117 3300003323 rootH1_10001888 rootH1_100018887 263
118 3300005327 Ga0070658_10241992 Ga0070658_102419922 263
119 3300005336 Ga0070680_100008276 Ga0070680_1000082765 263
120 3300005336 Ga0070680_100318639 Ga0070680_1003186392 263
121 3300005337 Ga0070682_100043847 Ga0070682_1000438473 263
122 3300005339 Ga0070660_100000709 Ga0070660_1000007093 263
123 3300005339 Ga0070660_100188193 Ga0070660_1001881932 263
124 3300005339 Ga0070660_100217507 Ga0070660_1002175072 263
125 3300005366 Ga0070659_100184146 Ga0070659_1001841462 263
126 3300005530 Ga0070679_100201966 Ga0070679_1002019662 263
127 3300005530 Ga0070679_100202658 Ga0070679_1002026582 263
128 3300005563 Ga0068855_100006753 Ga0068855_1000067532 263
129 3300005563 Ga0068855_100016996 Ga0068855_1000169964 263
130 3300005563 Ga0068855_100408701 Ga0068855_1004087012 263
131 3300005577 Ga0068857_100003611 Ga0068857_10000361110 263
132 3300005578 Ga0068854_100045217 Ga0068854_1000452172 263
133 3300005614 Ga0068856_100042155 Ga0068856_1000421555 263
134 3300005614 Ga0068856_100420992 Ga0068856_1004209922 263
135 3300005616 Ga0068852_100000410 Ga0068852_10000041015 263
136 3300005616 Ga0068852_100415199 Ga0068852_1004151992 263
137 3300009093 Ga0105240_10001264 Ga0105240_1000126418 263
138 3300009093 Ga0105240_10005683 Ga0105240_100056835 263
139 3300009094 Ga0111539_10039960 Ga0111539_100399602 263
140 3300009174 Ga0105241_10020047 Ga0105241_100200474 263
141 3300009174 Ga0105241_10114802 Ga0105241_101148023 263
142 3300009545 Ga0105237_10216184 Ga0105237_102161842 263
143 3300009551 Ga0105238_10011379 Ga0105238_100113794 263
144 3300009551 Ga0105238_10035408 Ga0105238_100354084 263
145 3300013102 Ga0157371_10071117 Ga0157371_100711173 263
146 3300013105 Ga0157369_10088117 Ga0157369_100881173 263
147 3300013105 Ga0157369_10148890 Ga0157369_101488901 263
148 3300013307 Ga0157372_10000230 Ga0157372_1000023037 263
149 3300013307 Ga0157372_10214162 Ga0157372_102141622 263
150 3300013307 Ga0157372_10226217 Ga0157372_102262172 263
151 3300025315 Ga0207697_10020982 Ga0207697_100209822 263
152 3300025909 Ga0207705_10041871 Ga0207705_100418712 263
153 3300025909 Ga0207705_10143341 Ga0207705_101433412 263
154 3300025911 Ga0207654_10048336 Ga0207654_100483362 263
155 3300025911 Ga0207654_10112796 Ga0207654_101127962 263
156 3300025912 Ga0207707_10316290 Ga0207707_103162902 263
157 3300025913 Ga0207695_10000586 Ga0207695_1000058649 263
158 3300025913 Ga0207695_10060329 Ga0207695_100603293 263
159 3300025914 Ga0207671_10115826 Ga0207671_101158262 263
160 3300025917 Ga0207660_10237510 Ga0207660_102375102 263
161 3300025919 Ga0207657_10002023 Ga0207657_100020233 263
162 3300025919 Ga0207657_10036684 Ga0207657_100366844 263
163 3300025919 Ga0207657_10140622 Ga0207657_101406222 263
164 3300025921 Ga0207652_10341694 Ga0207652_103416942 263
165 3300025924 Ga0207694_10006765 Ga0207694_100067653 263
166 3300025924 Ga0207694_10138045 Ga0207694_101380452 263
167 3300025949 Ga0207667_10000309 Ga0207667_1000030914 263
168 3300025949 Ga0207667_10047851 Ga0207667_100478513 263
169 3300025949 Ga0207667_10143809 Ga0207667_101438092 263
170 3300026041 Ga0207639_10087142 Ga0207639_100871423 263
171 3300026078 Ga0207702_10071162 Ga0207702_100711623 263
172 3300026078 Ga0207702_10362295 Ga0207702_103622952 263
173 3300026116 Ga0207674_10001219 Ga0207674_1000121919 263
174 3300026116 Ga0207674_10037790 Ga0207674_100377904 263
175 3300026142 Ga0207698_10000848 Ga0207698_100008482 263
176 3300032004 Ga0307414_10012112 Ga0307414_100121125 263
177 3300032004 Ga0307414_10157370 Ga0307414_101573702 263
178 3300032004 Ga0307414_10245229 Ga0307414_102452292 263
179 3300041494 Ga0451837_1188898 Ga0451837_1188898_178_969 263
180 3300042876 Ga0451577_0003069 Ga0451577_0003069_2240_3031 263
181 3300044658 Ga0466972_0023199 Ga0466972_0023199_1909_2700 263
182 3300044712 Ga0453684_0001009 Ga0453684_0001009_65624_66415 263
183 3300044735 Ga0466968_0148479 Ga0466968_0148479_228_1019 263
184 3300044901 Ga0466960_0059218 Ga0466960_0059218_637_1428 263
185 3300045051 Ga0451576_0041294 Ga0451576_0041294_3424_4215 263
186 3300049571 Ga0501034_0475011 Ga0501034_0475011_74_865 263
187 3300049822 Ga0501035_0138188 Ga0501035_0138188_449_1240 263
188 3300053153 Ga0500616_0036197 Ga0500616_0036197_1265_2056 263
189 3300053156 Ga0500622_0001810 Ga0500622_0001810_10459_11250 263
190 3300005367 Ga0070667_100736383 Ga0070667_1007363831 264
191 3300005543 Ga0070672_100541141 Ga0070672_1005411412 264
192 3300006844 Ga0075428_100007909 Ga0075428_1000079094 264
193 3300006880 Ga0075429_100447183 Ga0075429_1004471832 264
194 3300009094 Ga0111539_10001995 Ga0111539_100019954 264
195 3300025986 Ga0207658_10406770 Ga0207658_104067701 264
196 3300039437 Ga0436365_1088492 Ga0436365_1088492_183_977 264
197 3300049571 Ga0501034_0210690 Ga0501034_0210690_623_1417 264
198 3300049661 Ga0501217_056218 Ga0501217_056218_23_817 264
199 3300049822 Ga0501035_0091950 Ga0501035_0091950_1337_2131 264
200 3300049823 Ga0501044_0224311 Ga0501044_0224311_314_1108 264
201 3300003316 rootH1_10072465 rootH1_100724652 265
202 3300003354 JGI25160J50197_1000662 JGI25160J50197_100066211 265
203 3300005329 Ga0070683_100002417 Ga0070683_1000024172 265
204 3300005333 Ga0070677_10061330 Ga0070677_100613302 265
205 3300005334 Ga0068869_100053980 Ga0068869_1000539802 265
206 3300005334 Ga0068869_100197578 Ga0068869_1001975782 265
207 3300005335 Ga0070666_10133269 Ga0070666_101332692 265
208 3300005338 Ga0068868_100041008 Ga0068868_1000410083 265
209 3300005339 Ga0070660_100019733 Ga0070660_1000197335 265
210 3300005347 Ga0070668_100033492 Ga0070668_1000334923 265
211 3300005353 Ga0070669_100019533 Ga0070669_1000195334 265
212 3300005353 Ga0070669_100286466 Ga0070669_1002864662 265
213 3300005354 Ga0070675_100476566 Ga0070675_1004765661 265
214 3300005355 Ga0070671_100292184 Ga0070671_1002921842 265
215 3300005355 Ga0070671_100413834 Ga0070671_1004138342 265
216 3300005356 Ga0070674_100050165 Ga0070674_1000501653 265
217 3300005364 Ga0070673_100063853 Ga0070673_1000638532 265
218 3300005366 Ga0070659_100007003 Ga0070659_1000070035 265
219 3300005367 Ga0070667_100043984 Ga0070667_1000439843 265
220 3300005367 Ga0070667_100399836 Ga0070667_1003998362 265
221 3300005367 Ga0070667_100754951 Ga0070667_1007549511 265
222 3300005456 Ga0070678_100124117 Ga0070678_1001241172 265
223 3300005457 Ga0070662_100025036 Ga0070662_1000250366 265
224 3300005459 Ga0068867_100092884 Ga0068867_1000928842 265
225 3300005539 Ga0068853_100004573 Ga0068853_1000045737 265
226 3300005543 Ga0070672_100045223 Ga0070672_1000452232 265
227 3300005548 Ga0070665_100051542 Ga0070665_1000515422 265
228 3300005563 Ga0068855_100018440 Ga0068855_1000184407 265
229 3300005564 Ga0070664_100062152 Ga0070664_1000621523 265
230 3300005577 Ga0068857_100020090 Ga0068857_1000200904 265
231 3300005578 Ga0068854_100317772 Ga0068854_1003177722 265
232 3300005614 Ga0068856_100296011 Ga0068856_1002960111 265
233 3300005616 Ga0068852_100005821 Ga0068852_1000058218 265
234 3300005617 Ga0068859_100024651 Ga0068859_1000246514 265
235 3300005617 Ga0068859_100161511 Ga0068859_1001615112 265
236 3300005841 Ga0068863_100271099 Ga0068863_1002710992 265
237 3300005843 Ga0068860_100035569 Ga0068860_1000355695 265
238 3300005843 Ga0068860_100056169 Ga0068860_1000561693 265
239 3300005844 Ga0068862_100009417 Ga0068862_1000094174 265
240 3300005844 Ga0068862_100099588 Ga0068862_1000995883 265
241 3300006237 Ga0097621_100189009 Ga0097621_1001890092 265
242 3300006237 Ga0097621_100347834 Ga0097621_1003478342 265
243 3300006881 Ga0068865_100150648 Ga0068865_1001506482 265
244 3300006931 Ga0097620_100024651 Ga0097620_1000246514 265
245 3300006931 Ga0097620_100161510 Ga0097620_1001615102 265
246 3300009094 Ga0111539_10066664 Ga0111539_100666642 265
247 3300013104 Ga0157370_10168298 Ga0157370_101682982 265
248 3300013296 Ga0157374_10023391 Ga0157374_100233913 265
249 3300013296 Ga0157374_10066516 Ga0157374_100665163 265
250 3300014326 Ga0157380_10007608 Ga0157380_100076085 265
251 3300014745 Ga0157377_10116799 Ga0157377_101167992 265
252 3300014968 Ga0157379_10140999 Ga0157379_101409992 265
253 3300025302 Ga0207426_1000026 Ga0207426_1000026201 265
254 3300025893 Ga0207682_10009901 Ga0207682_100099012 265
255 3300025903 Ga0207680_10159496 Ga0207680_101594961 265
256 3300025907 Ga0207645_10008724 Ga0207645_100087245 265
257 3300025919 Ga0207657_10002233 Ga0207657_1000223311 265
258 3300025926 Ga0207659_10443389 Ga0207659_104433891 265
259 3300025933 Ga0207706_10078503 Ga0207706_100785033 265
260 3300025933 Ga0207706_10181342 Ga0207706_101813422 265
261 3300025940 Ga0207691_10057333 Ga0207691_100573334 265
262 3300025942 Ga0207689_10015187 Ga0207689_100151871 265
263 3300025942 Ga0207689_10067755 Ga0207689_100677552 265
264 3300025986 Ga0207658_10105992 Ga0207658_101059922 265
265 3300026023 Ga0207677_10228766 Ga0207677_102287662 265
266 3300026078 Ga0207702_10250424 Ga0207702_102504242 265
267 3300026089 Ga0207648_10011745 Ga0207648_100117453 265
268 3300026116 Ga0207674_10016092 Ga0207674_100160926 265
269 3300026121 Ga0207683_10001534 Ga0207683_100015344 265
270 3300026142 Ga0207698_10212905 Ga0207698_102129052 265
271 3300028380 Ga0268265_10024213 Ga0268265_100242132 265
272 3300028381 Ga0268264_10111257 Ga0268264_101112572 265
273 3300031251 Ga0265327_10000146 Ga0265327_10000146121 265
274 3300031251 Ga0265327_10054368 Ga0265327_100543681 265
275 3300042876 Ga0451577_0003255 Ga0451577_0003255_721_1521 265
276 3300044656 Ga0466969_0120636 Ga0466969_0120636_116_913 265
277 3300045976 Ga0466967_0391468 Ga0466967_0391468_470_1267 265
278 3300049571 Ga0501034_0029329 Ga0501034_0029329_4433_5230 265
279 3300049571 Ga0501034_0160861 Ga0501034_0160861_693_1490 265
280 3300049579 Ga0501043_0043327 Ga0501043_0043327_2297_3094 265
281 3300049581 Ga0501047_0125113 Ga0501047_0125113_1491_2288 265
282 3300001979 JGI24740J21852_10009163 JGI24740J21852_100091634 266
283 3300003323 rootH1_10195033 rootH1_101950333 266
284 3300005293 Ga0065715_10105285 Ga0065715_101052853 266
285 3300005327 Ga0070658_10220953 Ga0070658_102209532 266
286 3300005329 Ga0070683_100002178 Ga0070683_1000021787 266
287 3300005329 Ga0070683_100011503 Ga0070683_1000115037 266
288 3300005329 Ga0070683_100030627 Ga0070683_1000306273 266
289 3300005330 Ga0070690_100093667 Ga0070690_1000936672 266
290 3300005331 Ga0070670_100092248 Ga0070670_1000922483 266
291 3300005334 Ga0068869_100009364 Ga0068869_1000093644 266
292 3300005334 Ga0068869_100029840 Ga0068869_1000298402 266
293 3300005334 Ga0068869_100031122 Ga0068869_1000311225 266
294 3300005334 Ga0068869_100056294 Ga0068869_1000562942 266
295 3300005334 Ga0068869_100070401 Ga0068869_1000704012 266
296 3300005334 Ga0068869_100221071 Ga0068869_1002210712 266
297 3300005334 Ga0068869_100439729 Ga0068869_1004397292 266
298 3300005335 Ga0070666_10014461 Ga0070666_100144614 266
299 3300005336 Ga0070680_100007029 Ga0070680_1000070293 266
300 3300005337 Ga0070682_100002037 Ga0070682_1000020372 266
301 3300005339 Ga0070660_100108139 Ga0070660_1001081392 266
302 3300005340 Ga0070689_100192282 Ga0070689_1001922822 266
303 3300005341 Ga0070691_10014719 Ga0070691_100147192 266
304 3300005343 Ga0070687_100118240 Ga0070687_1001182401 266
305 3300005344 Ga0070661_100001463 Ga0070661_10000146311 266
306 3300005344 Ga0070661_100003861 Ga0070661_1000038614 266
307 3300005347 Ga0070668_100030905 Ga0070668_1000309053 266
308 3300005353 Ga0070669_100009965 Ga0070669_1000099657 266
309 3300005354 Ga0070675_100060546 Ga0070675_1000605463 266
310 3300005354 Ga0070675_100061227 Ga0070675_1000612271 266
311 3300005364 Ga0070673_100069030 Ga0070673_1000690302 266
312 3300005364 Ga0070673_100379397 Ga0070673_1003793972 266
313 3300005365 Ga0070688_100391450 Ga0070688_1003914501 266
314 3300005366 Ga0070659_100008743 Ga0070659_1000087432 266
315 3300005456 Ga0070678_100039308 Ga0070678_1000393083 266
316 3300005456 Ga0070678_100144629 Ga0070678_1001446292 266
317 3300005457 Ga0070662_100091358 Ga0070662_1000913581 266
318 3300005457 Ga0070662_100259634 Ga0070662_1002596342 266
319 3300005458 Ga0070681_10029132 Ga0070681_100291322 266
320 3300005459 Ga0068867_100054306 Ga0068867_1000543063 266
321 3300005459 Ga0068867_100159032 Ga0068867_1001590322 266
322 3300005466 Ga0070685_10169085 Ga0070685_101690852 266
323 3300005530 Ga0070679_100068617 Ga0070679_1000686173 266
324 3300005530 Ga0070679_100238660 Ga0070679_1002386602 266
325 3300005535 Ga0070684_100008384 Ga0070684_1000083843 266
326 3300005535 Ga0070684_100123197 Ga0070684_1001231972 266
327 3300005535 Ga0070684_100214237 Ga0070684_1002142372 266
328 3300005539 Ga0068853_100331735 Ga0068853_1003317352 266
329 3300005543 Ga0070672_100277492 Ga0070672_1002774922 266
330 3300005548 Ga0070665_100179809 Ga0070665_1001798092 266
331 3300005563 Ga0068855_100332881 Ga0068855_1003328812 266
332 3300005564 Ga0070664_100016825 Ga0070664_1000168253 266
333 3300005564 Ga0070664_100058799 Ga0070664_1000587992 266
334 3300005564 Ga0070664_100201285 Ga0070664_1002012851 266
335 3300005564 Ga0070664_100621121 Ga0070664_1006211211 266
336 3300005577 Ga0068857_100001588 Ga0068857_1000015885 266
337 3300005577 Ga0068857_100010207 Ga0068857_1000102074 266
338 3300005577 Ga0068857_100015293 Ga0068857_1000152937 266
339 3300005578 Ga0068854_100446468 Ga0068854_1004464681 266
340 3300005614 Ga0068856_100009543 Ga0068856_1000095439 266
341 3300005616 Ga0068852_100076693 Ga0068852_1000766933 266
342 3300005616 Ga0068852_100181987 Ga0068852_1001819872 266
343 3300005616 Ga0068852_100676743 Ga0068852_1006767431 266
344 3300005617 Ga0068859_100016717 Ga0068859_1000167178 266
345 3300005618 Ga0068864_100083315 Ga0068864_1000833152 266
346 3300005719 Ga0068861_100007343 Ga0068861_1000073437 266
347 3300005719 Ga0068861_100016538 Ga0068861_1000165384 266
348 3300005843 Ga0068860_100004009 Ga0068860_10000400912 266
349 3300005843 Ga0068860_100014023 Ga0068860_1000140237 266
350 3300005843 Ga0068860_100523107 Ga0068860_1005231071 266
351 3300005844 Ga0068862_100039601 Ga0068862_1000396012 266
352 3300006237 Ga0097621_100025618 Ga0097621_1000256185 266
353 3300006237 Ga0097621_100096643 Ga0097621_1000966433 266
354 3300006237 Ga0097621_100244900 Ga0097621_1002449002 266
355 3300006358 Ga0068871_100004069 Ga0068871_1000040694 266
356 3300006358 Ga0068871_100191390 Ga0068871_1001913902 266
357 3300006881 Ga0068865_100276612 Ga0068865_1002766122 266
358 3300006931 Ga0097620_100016719 Ga0097620_1000167193 266
359 3300009093 Ga0105240_10004678 Ga0105240_100046787 266
360 3300009093 Ga0105240_10144907 Ga0105240_101449073 266
361 3300009174 Ga0105241_10001366 Ga0105241_1000136610 266
362 3300009174 Ga0105241_10327022 Ga0105241_103270222 266
363 3300009174 Ga0105241_10528224 Ga0105241_105282242 266
364 3300009176 Ga0105242_10088686 Ga0105242_100886862 266
365 3300009176 Ga0105242_10208089 Ga0105242_102080892 266
366 3300009177 Ga0105248_10265123 Ga0105248_102651232 266
367 3300009545 Ga0105237_10014557 Ga0105237_100145576 266
368 3300009553 Ga0105249_10094322 Ga0105249_100943223 266
369 3300009553 Ga0105249_10158730 Ga0105249_101587302 266
370 3300009553 Ga0105249_10350113 Ga0105249_103501132 266
371 3300010375 Ga0105239_10032134 Ga0105239_100321343 266
372 3300010375 Ga0105239_10108166 Ga0105239_101081663 266
373 3300013100 Ga0157373_10034656 Ga0157373_100346563 266
374 3300013102 Ga0157371_10048931 Ga0157371_100489312 266
375 3300013102 Ga0157371_10190028 Ga0157371_101900282 266
376 3300013104 Ga0157370_10020571 Ga0157370_100205713 266
377 3300013104 Ga0157370_10176928 Ga0157370_101769282 266
378 3300013105 Ga0157369_10025905 Ga0157369_100259053 266
379 3300013105 Ga0157369_10085498 Ga0157369_100854983 266
380 3300013296 Ga0157374_10001327 Ga0157374_1000132715 266
381 3300013296 Ga0157374_10355879 Ga0157374_103558792 266
382 3300013297 Ga0157378_10047291 Ga0157378_100472913 266
383 3300013297 Ga0157378_10077309 Ga0157378_100773093 266
384 3300013306 Ga0163162_10018838 Ga0163162_100188383 266
385 3300013306 Ga0163162_10049855 Ga0163162_100498552 266
386 3300013306 Ga0163162_10127133 Ga0163162_101271333 266
387 3300013306 Ga0163162_10239760 Ga0163162_102397602 266
388 3300013307 Ga0157372_10373667 Ga0157372_103736672 266
389 3300013307 Ga0157372_10537569 Ga0157372_105375691 266
390 3300013308 Ga0157375_10026629 Ga0157375_100266296 266
391 3300013308 Ga0157375_10041917 Ga0157375_100419172 266
392 3300013308 Ga0157375_10050185 Ga0157375_100501855 266
393 3300013308 Ga0157375_10152197 Ga0157375_101521973 266
394 3300014325 Ga0163163_10034751 Ga0163163_100347512 266
395 3300014325 Ga0163163_10372647 Ga0163163_103726472 266
396 3300014326 Ga0157380_10008489 Ga0157380_100084896 266
397 3300014745 Ga0157377_10006525 Ga0157377_100065253 266
398 3300014745 Ga0157377_10013421 Ga0157377_100134212 266
399 3300014968 Ga0157379_10226584 Ga0157379_102265842 266
400 3300014969 Ga0157376_10038566 Ga0157376_100385662 266
401 3300014969 Ga0157376_10112340 Ga0157376_101123402 266
402 3300017792 Ga0163161_10049702 Ga0163161_100497023 266
403 3300017792 Ga0163161_10060791 Ga0163161_100607912 266
404 3300017792 Ga0163161_10254391 Ga0163161_102543912 266
405 3300025899 Ga0207642_10118887 Ga0207642_101188872 266
406 3300025903 Ga0207680_10032469 Ga0207680_100324692 266
407 3300025907 Ga0207645_10019000 Ga0207645_100190004 266
408 3300025911 Ga0207654_10003604 Ga0207654_100036046 266
409 3300025911 Ga0207654_10008598 Ga0207654_100085985 266
410 3300025912 Ga0207707_10002309 Ga0207707_100023097 266
411 3300025913 Ga0207695_10008355 Ga0207695_100083558 266
412 3300025913 Ga0207695_10025284 Ga0207695_100252843 266
413 3300025914 Ga0207671_10085076 Ga0207671_100850762 266
414 3300025917 Ga0207660_10013491 Ga0207660_100134912 266
415 3300025919 Ga0207657_10200453 Ga0207657_102004532 266
416 3300025919 Ga0207657_10421626 Ga0207657_104216262 266
417 3300025920 Ga0207649_10235909 Ga0207649_102359092 266
418 3300025921 Ga0207652_10001518 Ga0207652_100015188 266
419 3300025923 Ga0207681_10033480 Ga0207681_100334803 266
420 3300025926 Ga0207659_10034766 Ga0207659_100347662 266
421 3300025926 Ga0207659_10096285 Ga0207659_100962852 266
422 3300025932 Ga0207690_10524915 Ga0207690_105249151 266
423 3300025933 Ga0207706_10075430 Ga0207706_100754302 266
424 3300025936 Ga0207670_10145676 Ga0207670_101456762 266
425 3300025938 Ga0207704_10114233 Ga0207704_101142332 266
426 3300025938 Ga0207704_10182089 Ga0207704_101820892 266
427 3300025938 Ga0207704_10363330 Ga0207704_103633302 266
428 3300025940 Ga0207691_10021597 Ga0207691_100215973 266
429 3300025940 Ga0207691_10130071 Ga0207691_101300712 266
430 3300025942 Ga0207689_10025247 Ga0207689_100252476 266
431 3300025942 Ga0207689_10025491 Ga0207689_100254916 266
432 3300025942 Ga0207689_10029369 Ga0207689_100293694 266
433 3300025942 Ga0207689_10043294 Ga0207689_100432944 266
434 3300025944 Ga0207661_10009265 Ga0207661_100092652 266
435 3300025944 Ga0207661_10023367 Ga0207661_100233675 266
436 3300025945 Ga0207679_10002262 Ga0207679_100022625 266
437 3300025945 Ga0207679_10006678 Ga0207679_100066785 266
438 3300025945 Ga0207679_10105616 Ga0207679_101056163 266
439 3300025949 Ga0207667_10027014 Ga0207667_100270142 266
440 3300025949 Ga0207667_10348756 Ga0207667_103487562 266
441 3300025960 Ga0207651_10235640 Ga0207651_102356401 266
442 3300025960 Ga0207651_10365944 Ga0207651_103659441 266
443 3300025961 Ga0207712_10125881 Ga0207712_101258812 266
444 3300025961 Ga0207712_10233797 Ga0207712_102337971 266
445 3300025981 Ga0207640_10080920 Ga0207640_100809202 266
446 3300025981 Ga0207640_10229612 Ga0207640_102296122 266
447 3300026023 Ga0207677_10035643 Ga0207677_100356433 266
448 3300026023 Ga0207677_10062988 Ga0207677_100629883 266
449 3300026041 Ga0207639_10025530 Ga0207639_100255304 266
450 3300026041 Ga0207639_10091132 Ga0207639_100911322 266
451 3300026078 Ga0207702_10029233 Ga0207702_100292333 266
452 3300026089 Ga0207648_10075459 Ga0207648_100754593 266
453 3300026089 Ga0207648_10166448 Ga0207648_101664482 266
454 3300026095 Ga0207676_10027042 Ga0207676_100270422 266
455 3300026116 Ga0207674_10001797 Ga0207674_1000179728 266
456 3300026116 Ga0207674_10010086 Ga0207674_100100866 266
457 3300026116 Ga0207674_10017867 Ga0207674_100178677 266
458 3300026118 Ga0207675_100009509 Ga0207675_1000095093 266
459 3300026118 Ga0207675_100020210 Ga0207675_1000202105 266
460 3300026121 Ga0207683_10105575 Ga0207683_101055752 266
461 3300026142 Ga0207698_10051989 Ga0207698_100519892 266
462 3300028381 Ga0268264_10002281 Ga0268264_100022817 266
463 3300028381 Ga0268264_10720014 Ga0268264_107200141 266
464 3300028794 Ga0307515_10000091 Ga0307515_10000091175 266
465 3300029957 Ga0265324_10033389 Ga0265324_100333892 266
466 3300031251 Ga0265327_10014860 Ga0265327_100148604 266
467 3300031507 Ga0307509_10078499 Ga0307509_100784992 266
468 3300032004 Ga0307414_10238206 Ga0307414_102382062 266
469 3300032126 Ga0307415_100135892 Ga0307415_1001358922 266
470 3300035170 Ga0373943_0140488 Ga0373943_0140488_112_921 266
471 3300036401 Ga0373937_0019278 Ga0373937_0019278_2118_2927 266
472 3300036401 Ga0373937_0350308 Ga0373937_0350308_411_1211 266
473 3300037312 Ga0395899_0002920 Ga0395899_0002920_7581_8381 266
474 3300037418 Ga0395900_0011692 Ga0395900_0011692_1573_2373 266
475 3300037466 Ga0395898_0004939 Ga0395898_0004939_7251_8051 266
476 3300038443 Ga0395901_0010792 Ga0395901_0010792_3135_3935 266
477 3300041512 Ga0451853_3842013 Ga0451853_3842013_17_820 266
478 3300042876 Ga0451577_0013409 Ga0451577_0013409_162_962 266
479 3300042876 Ga0451577_0126667 Ga0451577_0126667_1254_2063 266
480 3300044712 Ga0453684_0000841 Ga0453684_0000841_95888_96688 266
481 3300045051 Ga0451576_0089988 Ga0451576_0089988_1719_2519 266
482 3300046454 Ga0495592_0019105 Ga0495592_0019105_778_1587 266
483 3300046471 Ga0495650_0043054 Ga0495650_0043054_38_838 266
484 3300046511 Ga0495608_0057504 Ga0495608_0057504_136_945 266
485 3300046514 Ga0495618_0048685 Ga0495618_0048685_1014_1823 266
486 3300046517 Ga0495630_0006627 Ga0495630_0006627_4482_5291 266
487 3300046522 Ga0495643_0000248 Ga0495643_0000248_34826_35656 266
488 3300046529 Ga0495652_0151729 Ga0495652_0151729_513_1322 266
489 3300046533 Ga0495640_0131983 Ga0495640_0131983_456_1265 266
490 3300046535 Ga0495586_0091179 Ga0495586_0091179_619_1428 266
491 3300046536 Ga0495587_0038650 Ga0495587_0038650_1241_2050 266
492 3300046543 Ga0495645_0138010 Ga0495645_0138010_844_1653 266
493 3300046559 Ga0495667_0052224 Ga0495667_0052224_179_988 266
494 3300046663 Ga0495635_0238961 Ga0495635_0238961_92_901 266
495 3300046678 Ga0495599_0046550 Ga0495599_0046550_1549_2358 266
496 3300046680 Ga0495646_0099015 Ga0495646_0099015_788_1597 266
497 3300047320 Ga0495672_0028866 Ga0495672_0028866_2061_2867 266
498 3300047321 Ga0495676_0111818 Ga0495676_0111818_606_1415 266
499 3300047322 Ga0495680_0026620 Ga0495680_0026620_3129_3938 266
500 3300048908 Ga0496105_0298598 Ga0496105_0298598_369_1169 266
501 3300048912 Ga0496109_0587835 Ga0496109_0587835_109_918 266
502 3300048913 Ga0496110_0128358 Ga0496110_0128358_1405_2214 266
503 3300049742 Ga0501080_0047836 Ga0501080_0047836_1181_1984 266
504 3300049823 Ga0501044_0075395 Ga0501044_0075395_62_865 266
505 3300050511 nmdc:mga08y16_499740_c1 nmdc:mga08y16_499740_c1_320_1144 266
506 3300053139 Ga0500568_0010919 Ga0500568_0010919_1420_2229 266
507 3300053153 Ga0500616_0004086 Ga0500616_0004086_9525_10334 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

218

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

266

0.9

PF23441

78

229

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9448 2 246
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9444 2 245
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9433 2 245
6ihi-assembly1.cif.gz_C crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9425 2 246
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9417 3 247
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 2 90 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 3 188 3.40.50.720
3dijB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9433 7 245 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 3 183 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9417 3 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0R2Q4J9-F1-model_v4 Short-chain dehydrogenase 0.9749 1 209 GO:0016491
AF-A0A0R2Q4J9-F1-model_v4 Short-chain dehydrogenase 0.9658 1 209 GO:0016491
AF-A0A2E7QPT6-F1-model_v4 Short-chain dehydrogenase 0.9652 1 179 GO:0016491
AF-A0A3G2DSW8-F1-model_v4 deleted 0.9638 2 188
AF-A0A7J6ZPE6-F1-model_v4 deleted 0.9634 3 258

Feature Viewer

pLDDT pTM Quality
93.59 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map