F456600

General Info

Members Datasets Scaffolds Average Seq Length
506 352 1013 238

Family's Representative Sequence

Representative Sequence 3300053143|Ga0500579_145039|Ga0500579_145039_132_965
Length 277
Sequence LTADRRAQLAANLDEVRGRSARACSAVGRDPSSVTLVAITKTYPASDVELLASLGVTDVGENKDQEAAAKAAAVPAELRWHFVGQLQRNKAKSVVRYADVVESVDSLRLVAALSKAAVEHRSSTVDILIQVSLDGDPSRGGAVASGTSLSVRSSSLSVPLSQPVVASSPSAPNRASSDISGFPEAVDPERDLWRVADAVAAAEGLRLAGVMAVAPIGWDPDRAFKKLALIVERLRAKHPGAVVVSAGMSGDLEAAIKHGATHVRIGTSLLGMRNTLR

Samples

Sample ID Description Type Environment
1 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
80 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
81 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
289 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
291 2501939600 Micromonospora sp. L5 Isolate Unclassified
292 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
293 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
294 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
295 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
296 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
297 2547132424 Nocardia nova SH22a Isolate Unclassified
298 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
299 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
300 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
301 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
302 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
303 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
304 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
305 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
306 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
307 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
308 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
309 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
310 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
311 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
312 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
313 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
314 2855683550 Micromonospora sp. RP3T Isolate Unclassified
315 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
316 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
317 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
318 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
319 2858882152 Micromonospora noduli MED15 Isolate Nodule
320 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
321 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
322 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
323 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
324 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
325 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
326 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
327 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
328 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
329 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
330 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
331 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
332 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
333 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
334 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
335 2902582711 Micromonospora sp. AP08 Isolate Unclassified
336 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
337 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
338 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
339 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
340 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
341 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
342 649633069 Micromonospora sp. L5 Isolate Unclassified
343 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
344 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
345 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
346 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
347 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
348 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
349 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
350 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
351 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
352 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.35
Metatranscriptomes 0.4
Isolates 12.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 1.19
Rhizoplane 5.14
Rhizosphere 78.66
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500579_145039 3300053143 Bacteria 1057
2 LJQas_1002868 3300000549 Bacteria 2347
3 JGI25406J46586_10006290 3300003203 Bacteria 5477
4 JGI25406J46586_10089217 3300003203 Bacteria 932
5 rootH1_10148274 3300003316 Bacteria 1683
6 rootH1_10148274 3300003323 Bacteria 1321
7 rootH2_10074132 3300003320 Bacteria 1060
8 rootH1_10180766 3300003323 Bacteria 1363
9 Ga0055542_1004753 3300003762 Bacteria 3200
10 Ga0070683_100091627 3300005329 Bacteria 2854
11 Ga0070683_100772135 3300005329 Bacteria 921
12 Ga0070690_100042270 3300005330 Bacteria 2886
13 Ga0070670_100285385 3300005331 Bacteria 1442
14 Ga0070666_10083322 3300005335 Bacteria 2187
15 Ga0070680_100000165 3300005336 Bacteria 41910
16 Ga0070680_100044897 3300005336 Bacteria 3591
17 Ga0070682_100220179 3300005337 Bacteria 1350
18 Ga0070660_100068698 3300005339 Bacteria 2762
19 Ga0070689_100067617 3300005340 Bacteria 2786
20 Ga0070689_100179907 3300005340 Bacteria 1717
21 Ga0070668_100002892 3300005347 Bacteria 12673
22 Ga0070668_100211509 3300005347 Bacteria 1596
23 Ga0070671_100023036 3300005355 Bacteria 5090
24 Ga0070673_100012267 3300005364 Bacteria 5877
25 Ga0070688_100226652 3300005365 Bacteria 1320
26 Ga0070667_100135303 3300005367 Bacteria 2155
27 Ga0070667_100375530 3300005367 Bacteria 1291
28 Ga0070709_10280023 3300005434 Bacteria 1211
29 Ga0070709_10324183 3300005434 Bacteria 1131
30 Ga0070714_100031053 3300005435 Bacteria 4454
31 Ga0070714_100316916 3300005435 Bacteria 1457
32 Ga0070713_100307349 3300005436 Bacteria 1461
33 Ga0070713_100746021 3300005436 Bacteria 936
34 Ga0070710_10144529 3300005437 Bacteria 1461
35 Ga0070710_10421960 3300005437 Bacteria 898
36 Ga0070701_10019961 3300005438 Bacteria 3173
37 Ga0070700_100044181 3300005441 Bacteria 2743
38 Ga0070700_100681296 3300005441 Bacteria 815
39 Ga0070708_100116764 3300005445 Bacteria 2457
40 Ga0070708_100246310 3300005445 Bacteria 1678
41 Ga0070708_100273973 3300005445 Bacteria 1587
42 Ga0070663_100020671 3300005455 Bacteria 4361
43 Ga0070678_100171766 3300005456 Bacteria 1766
44 Ga0070662_100193082 3300005457 Bacteria 1612
45 Ga0070681_10000004 3300005458 Bacteria 205157
46 Ga0068867_100264413 3300005459 Bacteria 1404
47 Ga0070685_10026737 3300005466 Bacteria 3182
48 Ga0070706_100208592 3300005467 Bacteria 1824
49 Ga0070706_100242112 3300005467 Bacteria 1684
50 Ga0070707_100077217 3300005468 Bacteria 3213
51 Ga0070707_100251952 3300005468 Bacteria 1718
52 Ga0070707_100459393 3300005468 Bacteria 1234
53 Ga0070698_100000354 3300005471 Bacteria 47476
54 Ga0070698_100297321 3300005471 Bacteria 1545
55 Ga0070698_100375321 3300005471 Bacteria 1354
56 Ga0070699_100003340 3300005518 Bacteria 14198
57 Ga0070679_100000012 3300005530 Bacteria 155885
58 Ga0070679_100035748 3300005530 Bacteria 4928
59 Ga0070684_100032267 3300005535 Bacteria 4463
60 Ga0070697_100007103 3300005536 Bacteria 8708
61 Ga0070672_100330569 3300005543 Bacteria 1297
62 Ga0070693_100011730 3300005547 Bacteria 4419
63 Ga0070665_100340665 3300005548 Bacteria 1504
64 Ga0070665_100621470 3300005548 Bacteria 1093
65 Ga0070665_100894610 3300005548 Bacteria 900
66 Ga0070704_100020309 3300005549 Bacteria 4281
67 Ga0068855_100146153 3300005563 Bacteria 2691
68 Ga0070664_100040315 3300005564 Bacteria 3936
69 Ga0068857_100029626 3300005577 Bacteria 4830
70 Ga0068857_100062056 3300005577 Bacteria 3322
71 Ga0068854_100284080 3300005578 Bacteria 1334
72 Ga0068856_100489358 3300005614 Bacteria 1251
73 Ga0070702_100009148 3300005615 Bacteria 4835
74 Ga0068859_100173112 3300005617 Bacteria 2240
75 Ga0068864_100003251 3300005618 Bacteria 13431
76 Ga0068864_100318281 3300005618 Bacteria 1461
77 Ga0068863_100108651 3300005841 Bacteria 2640
78 Ga0068863_100251795 3300005841 Bacteria 1706
79 Ga0068858_100113433 3300005842 Bacteria 2531
80 Ga0068862_100040832 3300005844 Bacteria 3945
81 Ga0068862_100127654 3300005844 Bacteria 2247
82 Ga0068862_100314038 3300005844 Bacteria 1445
83 Ga0081455_10112538 3300005937 Bacteria 2160
84 Ga0081540_1000601 3300005983 Bacteria 34296
85 Ga0081539_10000385 3300005985 Bacteria 95511
86 Ga0081539_10011227 3300005985 Bacteria 7124
87 Ga0081539_10030734 3300005985 Bacteria 3328
88 Ga0081539_10065488 3300005985 Bacteria 1973
89 Ga0070717_10046520 3300006028 Bacteria 3550
90 Ga0070717_10264508 3300006028 Bacteria 1522
91 Ga0070717_10286699 3300006028 Bacteria 1461
92 Ga0070715_10063959 3300006163 Bacteria 1623
93 Ga0070712_100112892 3300006175 Bacteria 2031
94 Ga0070712_100124557 3300006175 Bacteria 1944
95 Ga0097621_100248347 3300006237 Bacteria 1557
96 Ga0068871_100226493 3300006358 Bacteria 1621
97 Ga0075428_100281982 3300006844 Bacteria 1788
98 Ga0075434_100187217 3300006871 Bacteria 2090
99 Ga0075434_100485797 3300006871 Bacteria 1256
100 Ga0075434_100647504 3300006871 Bacteria 1075
101 Ga0075436_100292278 3300006914 Bacteria 1167
102 Ga0097620_100173110 3300006931 Bacteria 2240
103 Ga0075435_100737728 3300007076 Bacteria 857
104 Ga0099795_10016701 3300007788 Bacteria 2326
105 Ga0105251_10024815 3300009011 Bacteria 3074
106 Ga0105244_10059068 3300009036 Bacteria 1934
107 Ga0105250_10127630 3300009092 Bacteria 1048
108 Ga0105247_10062315 3300009101 Bacteria 2313
109 Ga0105247_10081848 3300009101 Bacteria 2036
110 Ga0114129_10631387 3300009147 Bacteria 1384
111 Ga0105241_10620851 3300009174 Bacteria 979
112 Ga0105241_11105680 3300009174 Bacteria 747
113 Ga0105248_10561455 3300009177 Bacteria 1288
114 Ga0105249_11178886 3300009553 Bacteria 837
115 Ga0105246_10040123 3300011119 Bacteria 3158
116 Ga0157328_1003163 3300012478 Bacteria 843
117 Ga0157320_1002518 3300012481 Bacteria 1041
118 Ga0157329_1003879 3300012491 Bacteria 941
119 Ga0157369_10009540 3300013105 Bacteria 11100
120 Ga0157369_10577448 3300013105 Bacteria 1161
121 Ga0163162_10095477 3300013306 Bacteria 3060
122 Ga0163163_10003315 3300014325 Bacteria 13656
123 Ga0163163_10140929 3300014325 Bacteria 2453
124 Ga0163163_10602645 3300014325 Bacteria 1162
125 Ga0157377_10008988 3300014745 Bacteria 4893
126 Ga0157379_10699519 3300014968 Bacteria 951
127 Ga0157376_10775741 3300014969 Bacteria 969
128 Ga0206353_11233563 3300020082 Bacteria 1713
129 Ga0206353_11700370 3300020082 Bacteria 2389
130 Ga0213875_10055940 3300021388 Bacteria 1847
131 Ga0213875_10171734 3300021388 Bacteria 1018
132 Ga0209148_1002288 3300025254 Bacteria 6896
133 Ga0207655_1047826 3300025728 Bacteria 1761
134 Ga0207653_10009411 3300025885 Bacteria 3042
135 Ga0207692_10124400 3300025898 Bacteria 1448
136 Ga0207692_10228947 3300025898 Bacteria 1105
137 Ga0207688_10023836 3300025901 Bacteria 3354
138 Ga0207647_10035013 3300025904 Bacteria 3202
139 Ga0207699_10097350 3300025906 Bacteria 1859
140 Ga0207699_10177419 3300025906 Bacteria 1430
141 Ga0207699_10571715 3300025906 Bacteria 821
142 Ga0207643_10023667 3300025908 Bacteria 3388
143 Ga0207705_10337669 3300025909 Bacteria 1159
144 Ga0207684_10036510 3300025910 Bacteria 4170
145 Ga0207684_10164735 3300025910 Bacteria 1910
146 Ga0207707_10000159 3300025912 Bacteria 70857
147 Ga0207693_10059274 3300025915 Bacteria 2998
148 Ga0207663_10040359 3300025916 Bacteria 2836
149 Ga0207663_10488096 3300025916 Bacteria 955
150 Ga0207660_10000767 3300025917 Bacteria 21346
151 Ga0207662_10000783 3300025918 Bacteria 14598
152 Ga0207657_10004292 3300025919 Bacteria 15096
153 Ga0207649_10117871 3300025920 Bacteria 1785
154 Ga0207649_10383492 3300025920 Bacteria 1048
155 Ga0207652_10000106 3300025921 Bacteria 90763
156 Ga0207652_10303825 3300025921 Bacteria 1440
157 Ga0207646_10021116 3300025922 Bacteria 6021
158 Ga0207694_10058375 3300025924 Bacteria 3001
159 Ga0207650_10390393 3300025925 Bacteria 1150
160 Ga0207700_10037130 3300025928 Bacteria 3525
161 Ga0207664_10147035 3300025929 Bacteria 1999
162 Ga0207664_10312730 3300025929 Unclassified 1384
163 Ga0207644_10044547 3300025931 Bacteria 3152
164 Ga0207706_10365095 3300025933 Bacteria 1254
165 Ga0207669_10326332 3300025937 Bacteria 1177
166 Ga0207704_10202143 3300025938 Bacteria 1455
167 Ga0207691_10215970 3300025940 Bacteria 1664
168 Ga0207711_10014674 3300025941 Bacteria 6511
169 Ga0207689_10006984 3300025942 Bacteria 9925
170 Ga0207689_10581020 3300025942 Bacteria 942
171 Ga0207661_10239740 3300025944 Bacteria 1609
172 Ga0207712_10435437 3300025961 Bacteria 1109
173 Ga0207668_10012335 3300025972 Bacteria 5228
174 Ga0207668_10016140 3300025972 Bacteria 4655
175 Ga0207668_10353730 3300025972 Bacteria 1229
176 Ga0207658_10027877 3300025986 Bacteria 3973
177 Ga0207703_10162876 3300026035 Bacteria 1955
178 Ga0207703_10344172 3300026035 Bacteria 1371
179 Ga0207678_10001032 3300026067 Bacteria 25428
180 Ga0207708_10047027 3300026075 Bacteria 3287
181 Ga0207702_10384539 3300026078 Bacteria 1350
182 Ga0207702_10799120 3300026078 Bacteria 932
183 Ga0207641_10076276 3300026088 Bacteria 2897
184 Ga0207648_10050646 3300026089 Bacteria 3631
185 Ga0207676_10273157 3300026095 Bacteria 1531
186 Ga0207676_10534936 3300026095 Bacteria 1117
187 Ga0207674_10004665 3300026116 Bacteria 16451
188 Ga0207674_10019554 3300026116 Bacteria 7334
189 Ga0207675_100173448 3300026118 Bacteria 2062
190 Ga0207683_10001927 3300026121 Bacteria 18372
191 Ga0207698_10023457 3300026142 Bacteria 4311
192 Ga0268265_10056578 3300028380 Bacteria 2985
193 Ga0268265_10291793 3300028380 Bacteria 1464
194 Ga0268265_10314507 3300028380 Bacteria 1415
195 Ga0268264_10089520 3300028381 Bacteria 2650
196 Ga0307517_10045700 3300028786 Bacteria 4592
197 Ga0307515_10014818 3300028794 Bacteria 14420
198 Ga0307515_10035175 3300028794 Bacteria 8161
199 Ga0307515_10127395 3300028794 Bacteria 2832
200 Ga0307512_10005296 3300030522 Bacteria 13532
201 Ga0307512_10084078 3300030522 Bacteria 2264
202 Ga0265325_10034503 3300031241 Bacteria 2690
203 Ga0265340_10004678 3300031247 Bacteria 7617
204 Ga0265340_10025072 3300031247 Bacteria 3024
205 Ga0265339_10053608 3300031249 Bacteria 2193
206 Ga0307513_10006692 3300031456 Bacteria 15039
207 Ga0307513_10063118 3300031456 Bacteria 3911
208 Ga0307513_10169838 3300031456 Bacteria 2060
209 Ga0307509_10039438 3300031507 Bacteria 5147
210 Ga0307509_10196127 3300031507 Bacteria 1863
211 Ga0307408_100002461 3300031548 Bacteria 12990
212 Ga0307408_100878921 3300031548 Bacteria 819
213 Ga0307508_10001138 3300031616 Bacteria 30634
214 Ga0307508_10006929 3300031616 Bacteria 10583
215 Ga0307508_10030360 3300031616 Bacteria 4885
216 Ga0307508_10128239 3300031616 Bacteria 2140
217 Ga0307516_10045302 3300031730 Bacteria 4345
218 Ga0307516_10082654 3300031730 Bacteria 3053
219 Ga0307405_10008771 3300031731 Bacteria 5145
220 Ga0307405_10549151 3300031731 Bacteria 935
221 Ga0307413_10013304 3300031824 Bacteria 4132
222 Ga0307413_10026654 3300031824 Bacteria 3188
223 Ga0307518_10000874 3300031838 Bacteria 22507
224 Ga0307410_10104474 3300031852 Bacteria 2037
225 Ga0307406_10036507 3300031901 Bacteria 3029
226 Ga0307406_10144845 3300031901 Bacteria 1687
227 Ga0307407_10029110 3300031903 Bacteria 2962
228 Ga0307407_10190598 3300031903 Bacteria 1366
229 Ga0307412_10000783 3300031911 Bacteria 18367
230 Ga0307409_100039031 3300031995 Bacteria 3519
231 Ga0307409_100861442 3300031995 Bacteria 917
232 Ga0307416_100028774 3300032002 Bacteria 4139
233 Ga0307416_100122152 3300032002 Bacteria 2324
234 Ga0307414_10014016 3300032004 Bacteria 4790
235 Ga0307411_10010342 3300032005 Bacteria 4967
236 Ga0307411_10165003 3300032005 Bacteria 1664
237 Ga0307415_100199357 3300032126 Bacteria 1587
238 Ga0307415_101013019 3300032126 Bacteria 773
239 Ga0307507_10117118 3300033179 Bacteria 2149
240 Ga0307507_10211938 3300033179 Bacteria 1319
241 Ga0307510_10140914 3300033180 Bacteria 2055
242 Ga0373930_0016850 3300034816 Bacteria 1387
243 Ga0373948_0009737 3300034817 Bacteria 1664
244 Ga0373938_0003646 3300034957 Bacteria 2537
245 Ga0373934_0001456 3300035086 Bacteria 8663
246 Ga0373944_0022665 3300035089 Bacteria 1826
247 Ga0373923_0032320 3300035111 Bacteria 2113
248 Ga0373932_0005689 3300035112 Bacteria 2933
249 Ga0373936_0001294 3300035113 Bacteria 9053
250 Ga0373941_0010285 3300035115 Bacteria 2386
251 Ga0373941_0010449 3300035115 Bacteria 2371
252 Ga0373953_0001163 3300035117 Bacteria 7477
253 Ga0373953_0049218 3300035117 Bacteria 1700
254 Ga0373960_0013006 3300035121 Bacteria 2079
255 Ga0373943_0014033 3300035170 Bacteria 3622
256 Ga0373946_0007573 3300035171 Bacteria 3973
257 Ga0373955_0052909 3300035172 Bacteria 2215
258 Ga0373955_0446229 3300035172 Unclassified 788
259 Ga0373942_0000022 3300035207 Bacteria 30229
260 Ga0373961_0026281 3300035241 Bacteria 1590
261 Ga0373962_0009708 3300035242 Bacteria 2389
262 Ga0373924_0001826 3300035410 Bacteria 7033
263 Ga0373924_0011769 3300035410 Bacteria 3255
264 Ga0373935_0038127 3300035692 Bacteria 3007
265 Ga0373927_0004335 3300035695 Bacteria 9949
266 Ga0373933_0034397 3300035724 Bacteria 2953
267 Ga0373933_0069432 3300035724 Bacteria 2141
268 Ga0373947_0026846 3300035725 Bacteria 3367
269 Ga0373937_0042918 3300036401 Bacteria 4128
270 Ga0373937_0055014 3300036401 Bacteria 3652
271 Ga0373937_0065436 3300036401 Bacteria 3346
272 Ga0373937_0080642 3300036401 Bacteria 3010
273 Ga0373937_0400894 3300036401 Bacteria 1302
274 Ga0373925_0003097 3300037068 Bacteria 13059
275 Ga0373925_0424816 3300037068 Bacteria 1086
276 Ga0395899_0012577 3300037312 Bacteria 6487
277 Ga0395899_0292813 3300037312 Bacteria 1104
278 Ga0395900_0012950 3300037418 Bacteria 8521
279 Ga0395905_0256296 3300037471 Bacteria 1634
280 Ga0436364_0497227 3300037853 Bacteria 1926
281 Ga0436364_0965738 3300037853 Bacteria 1066
282 Ga0395901_0027419 3300038443 Bacteria 5853
283 Ga0436363_1408076 3300039450 Bacteria 852
284 Ga0439439_0056998 3300041406 Bacteria 1033
285 Ga0466972_0001687 3300044658 Bacteria 10808
286 Ga0466961_0259045 3300044693 Bacteria 1067
287 Ga0466964_0046978 3300044706 Bacteria 1761
288 Ga0466958_0723707 3300045836 Bacteria 648
289 Ga0466967_0001019 3300045976 Bacteria 15351
290 Ga0466967_0225966 3300045976 Bacteria 1781
291 Ga0466967_0245895 3300045976 Bacteria 1707
292 Ga0466967_0605765 3300045976 Bacteria 1081
293 Ga0466967_0743796 3300045976 Bacteria 972
294 Ga0495592_0010177 3300046454 Bacteria 7091
295 Ga0495603_0002334 3300046455 Bacteria 11136
296 Ga0495629_0010979 3300046459 Bacteria 6579
297 Ga0495629_0095926 3300046459 Bacteria 2069
298 Ga0495638_0089967 3300046460 Bacteria 1851
299 Ga0495641_0020161 3300046461 Bacteria 3390
300 Ga0495651_0032681 3300046462 Bacteria 4057
301 Ga0495651_0267185 3300046462 Bacteria 1161
302 Ga0495653_0094694 3300046463 Bacteria 2175
303 Ga0495653_0260019 3300046463 Bacteria 1148
304 Ga0495650_0030313 3300046471 Bacteria 2452
305 Ga0495580_0046283 3300046472 Bacteria 3087
306 Ga0495582_0000170 3300046473 Bacteria 35330
307 Ga0495582_0047721 3300046473 Bacteria 2359
308 Ga0495639_0003769 3300046475 Bacteria 6516
309 Ga0495662_0000486 3300046476 Bacteria 18095
310 Ga0495664_0009621 3300046477 Bacteria 5410
311 Ga0495664_0144822 3300046477 Bacteria 1440
312 Ga0495664_0191542 3300046477 Bacteria 1239
313 Ga0495594_0011171 3300046499 Bacteria 4662
314 Ga0495608_0033823 3300046511 Bacteria 3452
315 Ga0495618_0112466 3300046514 Bacteria 1743
316 Ga0495618_0178801 3300046514 Bacteria 1348
317 Ga0495628_0062155 3300046516 Bacteria 2927
318 Ga0495628_0105726 3300046516 Bacteria 2168
319 Ga0495630_0011867 3300046517 Bacteria 6316
320 Ga0495630_0170534 3300046517 Bacteria 1658
321 Ga0495631_0025240 3300046518 Bacteria 2739
322 Ga0495632_0192643 3300046519 Bacteria 931
323 Ga0495632_0240343 3300046519 Bacteria 815
324 Ga0495666_0001945 3300046526 Bacteria 10179
325 Ga0495652_0141221 3300046529 Bacteria 1893
326 Ga0495652_0160964 3300046529 Bacteria 1743
327 Ga0495652_0182189 3300046529 Bacteria 1610
328 Ga0495665_0062767 3300046531 Bacteria 1961
329 Ga0495640_0064418 3300046533 Bacteria 2478
330 Ga0495640_0076303 3300046533 Bacteria 2236
331 Ga0495586_0029831 3300046535 Bacteria 2919
332 Ga0495586_0186335 3300046535 Bacteria 1175
333 Ga0495587_0002361 3300046536 Bacteria 12608
334 Ga0495587_0040849 3300046536 Bacteria 2770
335 Ga0495645_0088444 3300046543 Bacteria 2215
336 Ga0495622_0049415 3300046557 Bacteria 1953
337 Ga0495667_0036011 3300046559 Bacteria 3305
338 Ga0495667_0103197 3300046559 Bacteria 1844
339 Ga0495667_0136947 3300046559 Bacteria 1578
340 Ga0495634_0023875 3300046642 Bacteria 4294
341 Ga0495635_0062774 3300046663 Bacteria 2551
342 Ga0495635_0293072 3300046663 Bacteria 1091
343 Ga0495635_0300420 3300046663 Bacteria 1076
344 Ga0495588_0051653 3300046674 Bacteria 2118
345 Ga0495588_0116436 3300046674 Bacteria 1408
346 Ga0495657_0036758 3300046675 Bacteria 3381
347 Ga0495657_0050816 3300046675 Bacteria 2786
348 Ga0495599_0159109 3300046678 Bacteria 1396
349 Ga0495599_0163445 3300046678 Bacteria 1375
350 Ga0495599_0209873 3300046678 Bacteria 1194
351 Ga0495623_0046616 3300046679 Bacteria 2750
352 Ga0495623_0070505 3300046679 Bacteria 2177
353 Ga0495623_0135026 3300046679 Bacteria 1473
354 Ga0495646_0013397 3300046680 Bacteria 5212
355 Ga0495647_0018182 3300046681 Bacteria 2498
356 Ga0495658_0001523 3300046683 Bacteria 12151
357 Ga0495613_0079377 3300046689 Bacteria 2386
358 Ga0495624_0015020 3300046690 Bacteria 5242
359 Ga0495670_0037057 3300046691 Bacteria 2430
360 Ga0495600_0004555 3300046809 Bacteria 8308
361 Ga0495600_0030638 3300046809 Bacteria 3484
362 Ga0495600_0399635 3300046809 Bacteria 855
363 Ga0495581_0011234 3300047315 Bacteria 5176
364 Ga0495581_0062752 3300047315 Bacteria 2147
365 Ga0495581_0200572 3300047315 Bacteria 1167
366 Ga0495604_0336288 3300047317 Unclassified 1006
367 Ga0495674_0006999 3300047319 Bacteria 10789
368 Ga0495674_0113637 3300047319 Bacteria 2293
369 Ga0495676_0029649 3300047321 Bacteria 4657
370 Ga0495680_0038168 3300047322 Bacteria 3840
371 Ga0495680_0057473 3300047322 Bacteria 3008
372 Ga0495680_0117464 3300047322 Bacteria 1966
373 Ga0495675_0009175 3300047444 Bacteria 6150
374 Ga0495675_0485067 3300047444 Unclassified 711
375 Ga0495684_0061789 3300047471 Bacteria 2849
376 Ga0495684_0122290 3300047471 Bacteria 1959
377 Ga0495684_0340862 3300047471 Bacteria 1067
378 Ga0495593_0000136 3300047673 Bacteria 35468
379 Ga0495602_0047590 3300048088 Bacteria 3862
380 Ga0495602_0062609 3300048088 Bacteria 3227
381 Ga0495602_0475679 3300048088 Bacteria 877
382 Ga0496100_0047761 3300048903 Bacteria 2760
383 Ga0496101_0058842 3300048904 Bacteria 2784
384 Ga0496102_0091915 3300048905 Bacteria 2809
385 Ga0496102_0125827 3300048905 Bacteria 2395
386 Ga0496103_0054279 3300048906 Bacteria 2483
387 Ga0496104_0045969 3300048907 Bacteria 4107
388 Ga0496105_0082496 3300048908 Bacteria 2655
389 Ga0496105_0317554 3300048908 Bacteria 1249
390 Ga0496106_0057571 3300048909 Bacteria 2939
391 Ga0496106_0059487 3300048909 Bacteria 2894
392 Ga0496107_0036359 3300048910 Bacteria 3532
393 Ga0496107_0055193 3300048910 Bacteria 2869
394 Ga0496108_0089744 3300048911 Bacteria 2612
395 Ga0496108_0228830 3300048911 Bacteria 1616
396 Ga0496109_0009973 3300048912 Bacteria 8110
397 Ga0496109_0362376 3300048912 Bacteria 1369
398 Ga0496109_0527313 3300048912 Bacteria 1114
399 Ga0496110_0002495 3300048913 Bacteria 13810
400 Ga0496110_0037585 3300048913 Bacteria 4208
401 Ga0496110_0166268 3300048913 Bacteria 2000
402 Ga0496110_0385248 3300048913 Bacteria 1277
403 Ga0496111_0040802 3300048914 Bacteria 3329
404 Ga0496112_0145734 3300048915 Bacteria 2336
405 Ga0496112_0515158 3300048915 Bacteria 1131
406 Ga0496113_0653835 3300048916 Bacteria 840
407 Ga0496114_0245664 3300048917 Bacteria 1575
408 Ga0501031_0248631 3300049568 Bacteria 1156
409 Ga0501032_0020813 3300049569 Bacteria 4566
410 Ga0501032_0135859 3300049569 Bacteria 1621
411 Ga0501032_0138735 3300049569 Bacteria 1602
412 Ga0501034_0467235 3300049571 Bacteria 1178
413 Ga0501036_0143615 3300049572 Bacteria 2013
414 Ga0501038_0114055 3300049574 Bacteria 2235
415 Ga0501039_0078054 3300049575 Bacteria 2575
416 Ga0501069_0021844 3300049585 Bacteria 3476
417 Ga0501070_0001777 3300049586 Bacteria 19049
418 Ga0501070_0008340 3300049586 Bacteria 8755
419 Ga0501070_0013675 3300049586 Bacteria 6836
420 Ga0501070_0175270 3300049586 Bacteria 1766
421 Ga0501073_0073261 3300049589 Bacteria 2385
422 Ga0501073_0154606 3300049589 Bacteria 1590
423 Ga0501074_0051899 3300049590 Bacteria 2960
424 Ga0501080_0000253 3300049742 Bacteria 40425
425 Ga0501080_0354149 3300049742 Bacteria 1325
426 Ga0501044_0000983 3300049823 Bacteria 34250
427 nmdc:mga05p37_960111_c1 3300050507 Bacteria 913
428 nmdc:mga0n895_443116_c1 3300050512 Bacteria 1312
429 nmdc:mga0n895_758791_c1 3300050512 Bacteria 963
430 Ga0495601_0135313 3300053077 Bacteria 1606
431 Ga0495601_0148312 3300053077 Bacteria 1531
432 Ga0495612_0019635 3300053078 Bacteria 2706
433 Ga0495612_0140165 3300053078 Bacteria 1048
434 Ga0495595_0085928 3300053084 Bacteria 1504
435 Ga0495619_0016819 3300053085 Bacteria 4630
436 Ga0495619_0127514 3300053085 Bacteria 1747
437 Ga0500646_0010728 3300053090 Bacteria 2352
438 Ga0500651_0066781 3300053093 Bacteria 2240
439 Ga0500641_0149175 3300053096 Bacteria 1010
440 Ga0500650_0075355 3300053098 Bacteria 1577
441 Ga0500594_0006742 3300053118 Bacteria 2586
442 Ga0500652_009761 3300053131 Bacteria 3261
443 Ga0500577_0115948 3300053142 Bacteria 1110
444 Ga0500633_0101012 3300053160 Bacteria 1062
445 Ga0530510_0138788 3300061734 Bacteria 1790
446 2501944230 2501939600 Bacteria 6907073
447 2515495151 2515154088 Bacteria 5526283
448 2515719151 2515154129 Bacteria 5584369
449 2515754894 2515154137 Bacteria 5711575
450 2516083358 2515154202 Bacteria 5471270
451 2516088537 2515154203 Bacteria 5458536
452 2548694635 2547132424 Bacteria 8348532
453 2586059620 2585427649 Bacteria 9053857
454 2623590804 2622736626 Bacteria 7181580
455 2676483568 2675903059 Bacteria 8644972
456 2691513575 2690315906 Bacteria 4517044
457 2744957586 2744054611 Bacteria 5611514
458 2753268295 2751185782 Bacteria 11227053
459 2772644219 2772190715 Bacteria 6959372
460 2776377013 2775506925 Bacteria 7237746
461 2791913438 2791354901 Bacteria 8322202
462 2795795964 2795385472 Bacteria 6627535
463 2808890761 2808606370 Bacteria 4942454
464 2809591613 2808606522 Bacteria 9488490
465 2831936275 2831935698 Bacteria 5963223
466 2832010498 2832004796 Bacteria 6538017
467 2855676451 2855670206 Bacteria 7120389
468 2855678627 2855676851 Bacteria 7063653
469 2855684710 2855683550 Bacteria 7134265
470 2856864468 2856858025 Bacteria 7255264
471 2857294587 2857288857 Bacteria 7189066
472 2857481525 2857479173 Bacteria 2469263
473 2857634977 2857632687 Bacteria 2448521
474 2858888711 2858882152 Bacteria 7230291
475 2858888965 2858888857 Bacteria 7060307
476 2858897441 2858895516 Bacteria 7378898
477 2858905740 2858902515 Bacteria 7086037
478 2863071275 2863067949 Bacteria 8541735
479 2866066467 2866065130 Bacteria 6518152
480 2866552494 2866552031 Bacteria 5824618
481 2867511788 2867507094 Bacteria 6506033
482 2869050190 2869048445 Bacteria 6875584
483 2869062122 2869061728 Bacteria 7112407
484 2869074203 2869068681 Bacteria 7205615
485 2870802284 2870801768 Bacteria 2710986
486 2870804366 2870804320 Bacteria 2552467
487 2880489697 2880489317 Bacteria 7096270
488 2880496005 2880495981 Bacteria 7340502
489 2891330938 2891326441 Bacteria 6439512
490 2902583451 2902582711 Bacteria 6187705
491 2915772910 2915768154 Bacteria 8424322
492 2919051631 2919051321 Bacteria 4210889
493 2919718751 2919713450 Bacteria 7431245
494 2929224679 2929219909 Bacteria 6984360
495 2929232380 2929226422 Bacteria 7248583
496 2996227586 2996221748 Bacteria 6799777
497 649814004 649633069 Bacteria 6962533
498 8003323752 8003314358 Bacteria 10575343
499 8003832488 8003830390 Bacteria 6541657
500 8003863739 8003856774 Bacteria 7675274
501 8003876596 8003870546 Bacteria 7396674
502 8004026324 8004025490 Bacteria 4327753
503 8054707786 8054704163 Bacteria 7247792
504 8054732770 8054727385 Bacteria 7558670
505 8054737956 8054734606 Bacteria 6947278
506 8055416240 8055412473 Bacteria 6257500
507 8056212239 8056207758 Bacteria 8639239
508 Ga0500579_145039
509 LJQas_1002868
510 JGI25406J46586_10006290
511 JGI25406J46586_10089217
512 rootH1_10148274
513 rootH2_10074132
514 rootH1_10180766
515 Ga0055542_1004753
516 Ga0070683_100091627
517 Ga0070683_100772135
518 Ga0070690_100042270
519 Ga0070670_100285385
520 Ga0070666_10083322
521 Ga0070680_100000165
522 Ga0070680_100044897
523 Ga0070682_100220179
524 Ga0070660_100068698
525 Ga0070689_100067617
526 Ga0070689_100179907
527 Ga0070668_100002892
528 Ga0070668_100211509
529 Ga0070671_100023036
530 Ga0070673_100012267
531 Ga0070688_100226652
532 Ga0070667_100135303
533 Ga0070667_100375530
534 Ga0070709_10280023
535 Ga0070709_10324183
536 Ga0070714_100031053
537 Ga0070714_100316916
538 Ga0070713_100307349
539 Ga0070713_100746021
540 Ga0070710_10144529
541 Ga0070710_10421960
542 Ga0070701_10019961
543 Ga0070700_100044181
544 Ga0070700_100681296
545 Ga0070708_100116764
546 Ga0070708_100246310
547 Ga0070708_100273973
548 Ga0070663_100020671
549 Ga0070678_100171766
550 Ga0070662_100193082
551 Ga0070681_10000004
552 Ga0068867_100264413
553 Ga0070685_10026737
554 Ga0070706_100208592
555 Ga0070706_100242112
556 Ga0070707_100077217
557 Ga0070707_100251952
558 Ga0070707_100459393
559 Ga0070698_100000354
560 Ga0070698_100297321
561 Ga0070698_100375321
562 Ga0070699_100003340
563 Ga0070679_100000012
564 Ga0070679_100035748
565 Ga0070684_100032267
566 Ga0070697_100007103
567 Ga0070672_100330569
568 Ga0070693_100011730
569 Ga0070665_100340665
570 Ga0070665_100621470
571 Ga0070665_100894610
572 Ga0070704_100020309
573 Ga0068855_100146153
574 Ga0070664_100040315
575 Ga0068857_100029626
576 Ga0068857_100062056
577 Ga0068854_100284080
578 Ga0068856_100489358
579 Ga0070702_100009148
580 Ga0068859_100173112
581 Ga0068864_100003251
582 Ga0068864_100318281
583 Ga0068863_100108651
584 Ga0068863_100251795
585 Ga0068858_100113433
586 Ga0068862_100040832
587 Ga0068862_100127654
588 Ga0068862_100314038
589 Ga0081455_10112538
590 Ga0081540_1000601
591 Ga0081539_10000385
592 Ga0081539_10011227
593 Ga0081539_10030734
594 Ga0081539_10065488
595 Ga0070717_10046520
596 Ga0070717_10264508
597 Ga0070717_10286699
598 Ga0070715_10063959
599 Ga0070712_100112892
600 Ga0070712_100124557
601 Ga0097621_100248347
602 Ga0068871_100226493
603 Ga0075428_100281982
604 Ga0075434_100187217
605 Ga0075434_100485797
606 Ga0075434_100647504
607 Ga0075436_100292278
608 Ga0097620_100173110
609 Ga0075435_100737728
610 Ga0099795_10016701
611 Ga0105251_10024815
612 Ga0105244_10059068
613 Ga0105250_10127630
614 Ga0105247_10062315
615 Ga0105247_10081848
616 Ga0114129_10631387
617 Ga0105241_10620851
618 Ga0105241_11105680
619 Ga0105248_10561455
620 Ga0105249_11178886
621 Ga0105246_10040123
622 Ga0157328_1003163
623 Ga0157320_1002518
624 Ga0157329_1003879
625 Ga0157369_10009540
626 Ga0157369_10577448
627 Ga0163162_10095477
628 Ga0163163_10003315
629 Ga0163163_10140929
630 Ga0163163_10602645
631 Ga0157377_10008988
632 Ga0157379_10699519
633 Ga0157376_10775741
634 Ga0206353_11233563
635 Ga0206353_11700370
636 Ga0213875_10055940
637 Ga0213875_10171734
638 Ga0209148_1002288
639 Ga0207655_1047826
640 Ga0207653_10009411
641 Ga0207692_10124400
642 Ga0207692_10228947
643 Ga0207688_10023836
644 Ga0207647_10035013
645 Ga0207699_10097350
646 Ga0207699_10177419
647 Ga0207699_10571715
648 Ga0207643_10023667
649 Ga0207705_10337669
650 Ga0207684_10036510
651 Ga0207684_10164735
652 Ga0207707_10000159
653 Ga0207693_10059274
654 Ga0207663_10040359
655 Ga0207663_10488096
656 Ga0207660_10000767
657 Ga0207662_10000783
658 Ga0207657_10004292
659 Ga0207649_10117871
660 Ga0207649_10383492
661 Ga0207652_10000106
662 Ga0207652_10303825
663 Ga0207646_10021116
664 Ga0207694_10058375
665 Ga0207650_10390393
666 Ga0207700_10037130
667 Ga0207664_10147035
668 Ga0207664_10312730
669 Ga0207644_10044547
670 Ga0207706_10365095
671 Ga0207669_10326332
672 Ga0207704_10202143
673 Ga0207691_10215970
674 Ga0207711_10014674
675 Ga0207689_10006984
676 Ga0207689_10581020
677 Ga0207661_10239740
678 Ga0207712_10435437
679 Ga0207668_10012335
680 Ga0207668_10016140
681 Ga0207668_10353730
682 Ga0207658_10027877
683 Ga0207703_10162876
684 Ga0207703_10344172
685 Ga0207678_10001032
686 Ga0207708_10047027
687 Ga0207702_10384539
688 Ga0207702_10799120
689 Ga0207641_10076276
690 Ga0207648_10050646
691 Ga0207676_10273157
692 Ga0207676_10534936
693 Ga0207674_10004665
694 Ga0207674_10019554
695 Ga0207675_100173448
696 Ga0207683_10001927
697 Ga0207698_10023457
698 Ga0268265_10056578
699 Ga0268265_10291793
700 Ga0268265_10314507
701 Ga0268264_10089520
702 Ga0307517_10045700
703 Ga0307515_10014818
704 Ga0307515_10035175
705 Ga0307515_10127395
706 Ga0307512_10005296
707 Ga0307512_10084078
708 Ga0265325_10034503
709 Ga0265340_10004678
710 Ga0265340_10025072
711 Ga0265339_10053608
712 Ga0307513_10006692
713 Ga0307513_10063118
714 Ga0307513_10169838
715 Ga0307509_10039438
716 Ga0307509_10196127
717 Ga0307408_100002461
718 Ga0307408_100878921
719 Ga0307508_10001138
720 Ga0307508_10006929
721 Ga0307508_10030360
722 Ga0307508_10128239
723 Ga0307516_10045302
724 Ga0307516_10082654
725 Ga0307405_10008771
726 Ga0307405_10549151
727 Ga0307413_10013304
728 Ga0307413_10026654
729 Ga0307518_10000874
730 Ga0307410_10104474
731 Ga0307406_10036507
732 Ga0307406_10144845
733 Ga0307407_10029110
734 Ga0307407_10190598
735 Ga0307412_10000783
736 Ga0307409_100039031
737 Ga0307409_100861442
738 Ga0307416_100028774
739 Ga0307416_100122152
740 Ga0307414_10014016
741 Ga0307411_10010342
742 Ga0307411_10165003
743 Ga0307415_100199357
744 Ga0307415_101013019
745 Ga0307507_10117118
746 Ga0307507_10211938
747 Ga0307510_10140914
748 Ga0373930_0016850
749 Ga0373948_0009737
750 Ga0373938_0003646
751 Ga0373934_0001456
752 Ga0373944_0022665
753 Ga0373923_0032320
754 Ga0373932_0005689
755 Ga0373936_0001294
756 Ga0373941_0010285
757 Ga0373941_0010449
758 Ga0373953_0001163
759 Ga0373953_0049218
760 Ga0373960_0013006
761 Ga0373943_0014033
762 Ga0373946_0007573
763 Ga0373955_0052909
764 Ga0373955_0446229
765 Ga0373942_0000022
766 Ga0373961_0026281
767 Ga0373962_0009708
768 Ga0373924_0001826
769 Ga0373924_0011769
770 Ga0373935_0038127
771 Ga0373927_0004335
772 Ga0373933_0034397
773 Ga0373933_0069432
774 Ga0373947_0026846
775 Ga0373937_0042918
776 Ga0373937_0055014
777 Ga0373937_0065436
778 Ga0373937_0080642
779 Ga0373937_0400894
780 Ga0373925_0003097
781 Ga0373925_0424816
782 Ga0395899_0012577
783 Ga0395899_0292813
784 Ga0395900_0012950
785 Ga0395905_0256296
786 Ga0436364_0497227
787 Ga0436364_0965738
788 Ga0395901_0027419
789 Ga0436363_1408076
790 Ga0439439_0056998
791 Ga0466972_0001687
792 Ga0466961_0259045
793 Ga0466964_0046978
794 Ga0466958_0723707
795 Ga0466967_0001019
796 Ga0466967_0225966
797 Ga0466967_0245895
798 Ga0466967_0605765
799 Ga0466967_0743796
800 Ga0495592_0010177
801 Ga0495603_0002334
802 Ga0495629_0010979
803 Ga0495629_0095926
804 Ga0495638_0089967
805 Ga0495641_0020161
806 Ga0495651_0032681
807 Ga0495651_0267185
808 Ga0495653_0094694
809 Ga0495653_0260019
810 Ga0495650_0030313
811 Ga0495580_0046283
812 Ga0495582_0000170
813 Ga0495582_0047721
814 Ga0495639_0003769
815 Ga0495662_0000486
816 Ga0495664_0009621
817 Ga0495664_0144822
818 Ga0495664_0191542
819 Ga0495594_0011171
820 Ga0495608_0033823
821 Ga0495618_0112466
822 Ga0495618_0178801
823 Ga0495628_0062155
824 Ga0495628_0105726
825 Ga0495630_0011867
826 Ga0495630_0170534
827 Ga0495631_0025240
828 Ga0495632_0192643
829 Ga0495632_0240343
830 Ga0495666_0001945
831 Ga0495652_0141221
832 Ga0495652_0160964
833 Ga0495652_0182189
834 Ga0495665_0062767
835 Ga0495640_0064418
836 Ga0495640_0076303
837 Ga0495586_0029831
838 Ga0495586_0186335
839 Ga0495587_0002361
840 Ga0495587_0040849
841 Ga0495645_0088444
842 Ga0495622_0049415
843 Ga0495667_0036011
844 Ga0495667_0103197
845 Ga0495667_0136947
846 Ga0495634_0023875
847 Ga0495635_0062774
848 Ga0495635_0293072
849 Ga0495635_0300420
850 Ga0495588_0051653
851 Ga0495588_0116436
852 Ga0495657_0036758
853 Ga0495657_0050816
854 Ga0495599_0159109
855 Ga0495599_0163445
856 Ga0495599_0209873
857 Ga0495623_0046616
858 Ga0495623_0070505
859 Ga0495623_0135026
860 Ga0495646_0013397
861 Ga0495647_0018182
862 Ga0495658_0001523
863 Ga0495613_0079377
864 Ga0495624_0015020
865 Ga0495670_0037057
866 Ga0495600_0004555
867 Ga0495600_0030638
868 Ga0495600_0399635
869 Ga0495581_0011234
870 Ga0495581_0062752
871 Ga0495581_0200572
872 Ga0495604_0336288
873 Ga0495674_0006999
874 Ga0495674_0113637
875 Ga0495676_0029649
876 Ga0495680_0038168
877 Ga0495680_0057473
878 Ga0495680_0117464
879 Ga0495675_0009175
880 Ga0495675_0485067
881 Ga0495684_0061789
882 Ga0495684_0122290
883 Ga0495684_0340862
884 Ga0495593_0000136
885 Ga0495602_0047590
886 Ga0495602_0062609
887 Ga0495602_0475679
888 Ga0496100_0047761
889 Ga0496101_0058842
890 Ga0496102_0091915
891 Ga0496102_0125827
892 Ga0496103_0054279
893 Ga0496104_0045969
894 Ga0496105_0082496
895 Ga0496105_0317554
896 Ga0496106_0057571
897 Ga0496106_0059487
898 Ga0496107_0036359
899 Ga0496107_0055193
900 Ga0496108_0089744
901 Ga0496108_0228830
902 Ga0496109_0009973
903 Ga0496109_0362376
904 Ga0496109_0527313
905 Ga0496110_0002495
906 Ga0496110_0037585
907 Ga0496110_0166268
908 Ga0496110_0385248
909 Ga0496111_0040802
910 Ga0496112_0145734
911 Ga0496112_0515158
912 Ga0496113_0653835
913 Ga0496114_0245664
914 Ga0501031_0248631
915 Ga0501032_0020813
916 Ga0501032_0135859
917 Ga0501032_0138735
918 Ga0501034_0467235
919 Ga0501036_0143615
920 Ga0501038_0114055
921 Ga0501039_0078054
922 Ga0501069_0021844
923 Ga0501070_0001777
924 Ga0501070_0008340
925 Ga0501070_0013675
926 Ga0501070_0175270
927 Ga0501073_0073261
928 Ga0501073_0154606
929 Ga0501074_0051899
930 Ga0501080_0000253
931 Ga0501080_0354149
932 Ga0501044_0000983
933 nmdc:mga05p37_960111_c1
934 nmdc:mga0n895_443116_c1
935 nmdc:mga0n895_758791_c1
936 Ga0495601_0135313
937 Ga0495601_0148312
938 Ga0495612_0019635
939 Ga0495612_0140165
940 Ga0495595_0085928
941 Ga0495619_0016819
942 Ga0495619_0127514
943 Ga0500646_0010728
944 Ga0500651_0066781
945 Ga0500641_0149175
946 Ga0500650_0075355
947 Ga0500594_0006742
948 Ga0500652_009761
949 Ga0500577_0115948
950 Ga0500633_0101012
951 Ga0530510_0138788
952 2501944230
953 2515495151
954 2515719151
955 2515754894
956 2516083358
957 2516088537
958 2548694635
959 2586059620
960 2623590804
961 2676483568
962 2691513575
963 2744957586
964 2753268295
965 2772644219
966 2776377013
967 2791913438
968 2795795964
969 2808890761
970 2809591613
971 2831936275
972 2832010498
973 2855676451
974 2855678627
975 2855684710
976 2856864468
977 2857294587
978 2857481525
979 2857634977
980 2858888711
981 2858888965
982 2858897441
983 2858905740
984 2863071275
985 2866066467
986 2866552494
987 2867511788
988 2869050190
989 2869062122
990 2869074203
991 2870802284
992 2870804366
993 2880489697
994 2880496005
995 2891330938
996 2902583451
997 2915772910
998 2919051631
999 2919718751
1000 2929224679
1001 2929232380
1002 2996227586
1003 649814004
1004 8003323752
1005 8003832488
1006 8003863739
1007 8003876596
1008 8004026324
1009 8054707786
1010 8054732770
1011 8054737956
1012 8055416240
1013 8056212239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

186

274

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9117 28 221
3cpg-assembly1.cif.gz_A crystal structure of an unknown protein from bifidobacterium adolescentis 0.8891 39 217
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.8821 26 221
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.8315 17 219
3sy1-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or70 0.8311 12 219
ID Description Score Start End Superfamily
af_Q1ZXI6_1_255_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9014 30 222 3.20.20.10
af_P52057_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8859 30 222 3.20.20.10
af_Q8I2V6_2_242_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8803 30 219 3.20.20.10
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8794 30 222 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8725 26 219 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A176S074-F1-model_v4 Alanine racemase domain-containing protein 0.9651 27 100 GO:0030170
AF-A0A3C2BQ71-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9578 53 223 GO:0030170
AF-A0A382Z042-F1-model_v4 Uncharacterized protein 0.9569 34 108 GO:0030170
AF-A0A382VPN0-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.956 29 163 GO:0030170
AF-A0A847CM54-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9553 28 221 GO:0030170

Map