F456573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 328 | 473 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0144357|Ga0495625_0144357_244_1125 |
| Length | 293 |
| Sequence | MTPSRDISRLLEIMAALRTPVTGCPWDLEQDFATIAPYTIEEAYEVVDAITRGDLDDLREELGDLLLQVVFHARMAEEQSIFAFGDVVEAITRKMIRRHPHVFVDSDGQLTPGHVKENWDRIKAEEKAERAARRPPEPAGPKSLLSSVKAGQPALTRAMELQRKASTVGFDWNDPRAVLHKIREEADEIEAALDKGDAEELASETGDLLFALVNLARHVGADPEAALRGTNAKFERRFAYIERALAAKGRSLDDASLTEMDALWNEAKGAERLPLSSRPSEARAGTHTAESRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 5 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 6 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 7 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 8 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 9 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 10 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 11 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 12 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 13 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 14 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 15 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 16 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 17 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 18 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 19 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 20 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 21 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 22 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 187 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 188 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 300 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 307 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 308 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 311 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 313 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 314 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 315 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 318 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 320 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 321 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 322 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 323 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 324 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 325 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 326 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 327 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 328 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.02 |
| Metatranscriptomes | 0.2 |
| Isolates | 5.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.88 |
| Nodule | 5.34 |
| Rhizoplane | 6.52 |
| Rhizosphere | 67.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000004 | 3300003203 | Bacteria | 149772 |
| 2 | JGI25406J46586_10008390 | 3300003203 | Bacteria | 4681 |
| 3 | JGI25153J46596_10000456 | 3300003215 | Bacteria | 26118 |
| 4 | rootH2_10118023 | 3300003320 | Bacteria | 1267 |
| 5 | Ga0070658_10000865 | 3300005327 | Bacteria | 25891 |
| 6 | Ga0070658_10388924 | 3300005327 | Bacteria | 1197 |
| 7 | Ga0070670_100162435 | 3300005331 | Bacteria | 1936 |
| 8 | Ga0070670_100254588 | 3300005331 | Bacteria | 1530 |
| 9 | Ga0068869_100002065 | 3300005334 | Bacteria | 12072 |
| 10 | Ga0068869_100194396 | 3300005334 | Bacteria | 1597 |
| 11 | Ga0070680_100001697 | 3300005336 | Bacteria | 16156 |
| 12 | Ga0070680_100268953 | 3300005336 | Bacteria | 1443 |
| 13 | Ga0070682_100145576 | 3300005337 | Bacteria | 1620 |
| 14 | Ga0068868_100036827 | 3300005338 | Bacteria | 3790 |
| 15 | Ga0068868_100237932 | 3300005338 | Bacteria | 1529 |
| 16 | Ga0068868_100349107 | 3300005338 | Bacteria | 1267 |
| 17 | Ga0070660_100147482 | 3300005339 | Bacteria | 1890 |
| 18 | Ga0070661_100094072 | 3300005344 | Bacteria | 2221 |
| 19 | Ga0070668_100056674 | 3300005347 | Bacteria | 3027 |
| 20 | Ga0070668_100095976 | 3300005347 | Bacteria | 2343 |
| 21 | Ga0070668_100199468 | 3300005347 | Bacteria | 1642 |
| 22 | Ga0070668_100238494 | 3300005347 | Bacteria | 1505 |
| 23 | Ga0070675_100168768 | 3300005354 | Bacteria | 1886 |
| 24 | Ga0070675_100383325 | 3300005354 | Bacteria | 1252 |
| 25 | Ga0070671_100243837 | 3300005355 | Bacteria | 1526 |
| 26 | Ga0070671_100279346 | 3300005355 | Bacteria | 1420 |
| 27 | Ga0070667_100140346 | 3300005367 | Bacteria | 2116 |
| 28 | Ga0070667_100758572 | 3300005367 | Bacteria | 900 |
| 29 | Ga0070709_10001494 | 3300005434 | Bacteria | 12636 |
| 30 | Ga0070714_100045796 | 3300005435 | Bacteria | 3708 |
| 31 | Ga0070714_100096393 | 3300005435 | Bacteria | 2599 |
| 32 | Ga0070714_100621081 | 3300005435 | Bacteria | 1039 |
| 33 | Ga0070713_100026202 | 3300005436 | Bacteria | 4573 |
| 34 | Ga0070713_100073511 | 3300005436 | Bacteria | 2894 |
| 35 | Ga0070713_100074349 | 3300005436 | Bacteria | 2879 |
| 36 | Ga0070710_10004580 | 3300005437 | Bacteria | 6532 |
| 37 | Ga0070711_100002728 | 3300005439 | Bacteria | 10127 |
| 38 | Ga0070700_100097806 | 3300005441 | Bacteria | 1928 |
| 39 | Ga0070708_100094520 | 3300005445 | Bacteria | 2727 |
| 40 | Ga0070663_100015998 | 3300005455 | Bacteria | 4857 |
| 41 | Ga0070663_100072623 | 3300005455 | Bacteria | 2507 |
| 42 | Ga0070663_100077648 | 3300005455 | Bacteria | 2431 |
| 43 | Ga0070663_100131673 | 3300005455 | Bacteria | 1900 |
| 44 | Ga0070678_100100320 | 3300005456 | Bacteria | 2242 |
| 45 | Ga0070678_100130509 | 3300005456 | Bacteria | 1996 |
| 46 | Ga0070681_10010423 | 3300005458 | Bacteria | 9181 |
| 47 | Ga0070681_10102749 | 3300005458 | Bacteria | 2803 |
| 48 | Ga0070685_10137362 | 3300005466 | Bacteria | 1535 |
| 49 | Ga0070706_100428540 | 3300005467 | Bacteria | 1231 |
| 50 | Ga0070707_100185051 | 3300005468 | Bacteria | 2031 |
| 51 | Ga0070698_100080639 | 3300005471 | Bacteria | 3249 |
| 52 | Ga0070679_100029107 | 3300005530 | Bacteria | 5448 |
| 53 | Ga0070679_100061142 | 3300005530 | Bacteria | 3754 |
| 54 | Ga0070684_100024649 | 3300005535 | Bacteria | 5048 |
| 55 | Ga0070697_100193268 | 3300005536 | Bacteria | 1728 |
| 56 | Ga0070697_100342773 | 3300005536 | Bacteria | 1290 |
| 57 | Ga0068853_100016363 | 3300005539 | Bacteria | 6102 |
| 58 | Ga0068853_100114548 | 3300005539 | Bacteria | 2398 |
| 59 | Ga0068853_100400422 | 3300005539 | Bacteria | 1285 |
| 60 | Ga0070672_100081933 | 3300005543 | Bacteria | 2588 |
| 61 | Ga0070695_100047192 | 3300005545 | Bacteria | 2750 |
| 62 | Ga0070696_100125377 | 3300005546 | Bacteria | 1863 |
| 63 | Ga0070693_100088521 | 3300005547 | Bacteria | 1862 |
| 64 | Ga0070693_100470437 | 3300005547 | Bacteria | 886 |
| 65 | Ga0070665_100004313 | 3300005548 | Bacteria | 14949 |
| 66 | Ga0070665_100124907 | 3300005548 | Bacteria | 2575 |
| 67 | Ga0070665_100252628 | 3300005548 | Bacteria | 1764 |
| 68 | Ga0068855_100014843 | 3300005563 | Bacteria | 9380 |
| 69 | Ga0068855_100035260 | 3300005563 | Bacteria | 5959 |
| 70 | Ga0070664_100523494 | 3300005564 | Bacteria | 1095 |
| 71 | Ga0068857_100023817 | 3300005577 | Bacteria | 5389 |
| 72 | Ga0068856_100362435 | 3300005614 | Bacteria | 1468 |
| 73 | Ga0068852_100011447 | 3300005616 | Bacteria | 6679 |
| 74 | Ga0068859_100079403 | 3300005617 | Bacteria | 3321 |
| 75 | Ga0068864_100013874 | 3300005618 | Bacteria | 6679 |
| 76 | Ga0068861_100046486 | 3300005719 | Bacteria | 3272 |
| 77 | Ga0068861_100191059 | 3300005719 | Bacteria | 1712 |
| 78 | Ga0068851_10028108 | 3300005834 | Bacteria | 2776 |
| 79 | Ga0068851_10032947 | 3300005834 | Bacteria | 2580 |
| 80 | Ga0068858_100097300 | 3300005842 | Bacteria | 2744 |
| 81 | Ga0068858_100297711 | 3300005842 | Bacteria | 1539 |
| 82 | Ga0068860_100001218 | 3300005843 | Bacteria | 28032 |
| 83 | Ga0068862_100234642 | 3300005844 | Bacteria | 1665 |
| 84 | Ga0081455_10005203 | 3300005937 | Bacteria | 14313 |
| 85 | Ga0081455_10030942 | 3300005937 | Bacteria | 4852 |
| 86 | Ga0081455_10080828 | 3300005937 | Bacteria | 2664 |
| 87 | Ga0081538_10039451 | 3300005981 | Bacteria | 3029 |
| 88 | Ga0081540_1003549 | 3300005983 | Bacteria | 12287 |
| 89 | Ga0081540_1007097 | 3300005983 | Bacteria | 8048 |
| 90 | Ga0081540_1009779 | 3300005983 | Bacteria | 6565 |
| 91 | Ga0081540_1026986 | 3300005983 | Bacteria | 3265 |
| 92 | Ga0081540_1060702 | 3300005983 | Bacteria | 1807 |
| 93 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 94 | Ga0081539_10000152 | 3300005985 | Bacteria | 160005 |
| 95 | Ga0070717_10036472 | 3300006028 | Bacteria | 3987 |
| 96 | Ga0070717_10154036 | 3300006028 | Bacteria | 1990 |
| 97 | Ga0075368_10062245 | 3300006042 | Bacteria | 1495 |
| 98 | Ga0075363_100001412 | 3300006048 | Bacteria | 9091 |
| 99 | Ga0075363_100019080 | 3300006048 | Bacteria | 3424 |
| 100 | Ga0070716_100023154 | 3300006173 | Bacteria | 3290 |
| 101 | Ga0070712_100038403 | 3300006175 | Bacteria | 3271 |
| 102 | Ga0070712_100071732 | 3300006175 | Bacteria | 2479 |
| 103 | Ga0075362_10007055 | 3300006177 | Bacteria | 4224 |
| 104 | Ga0075367_10088592 | 3300006178 | Bacteria | 1881 |
| 105 | Ga0075367_10131859 | 3300006178 | Bacteria | 1545 |
| 106 | Ga0075366_10004404 | 3300006195 | Bacteria | 7559 |
| 107 | Ga0097621_100255795 | 3300006237 | Bacteria | 1535 |
| 108 | Ga0075428_100020956 | 3300006844 | Bacteria | 7240 |
| 109 | Ga0075434_100008357 | 3300006871 | Bacteria | 9621 |
| 110 | Ga0075429_100147942 | 3300006880 | Bacteria | 2056 |
| 111 | Ga0097620_100079394 | 3300006931 | Bacteria | 3321 |
| 112 | Ga0099822_1000949 | 3300006943 | Bacteria | 31391 |
| 113 | Ga0099794_10037379 | 3300007265 | Bacteria | 2298 |
| 114 | Ga0099795_10020558 | 3300007788 | Bacteria | 2153 |
| 115 | Ga0099795_10044484 | 3300007788 | Bacteria | 1593 |
| 116 | Ga0105250_10025085 | 3300009092 | Bacteria | 2403 |
| 117 | Ga0105240_10038548 | 3300009093 | Bacteria | 6129 |
| 118 | Ga0105240_10481338 | 3300009093 | Bacteria | 1384 |
| 119 | Ga0105240_10636707 | 3300009093 | Bacteria | 1170 |
| 120 | Ga0105245_10286520 | 3300009098 | Bacteria | 1612 |
| 121 | Ga0105247_10009126 | 3300009101 | Bacteria | 6036 |
| 122 | Ga0105242_10255886 | 3300009176 | Bacteria | 1580 |
| 123 | Ga0105248_10056519 | 3300009177 | Bacteria | 4403 |
| 124 | Ga0105248_10524493 | 3300009177 | Bacteria | 1336 |
| 125 | Ga0105237_10071162 | 3300009545 | Bacteria | 3473 |
| 126 | Ga0105237_10165195 | 3300009545 | Bacteria | 2212 |
| 127 | Ga0105237_10203945 | 3300009545 | Bacteria | 1978 |
| 128 | Ga0105238_10017869 | 3300009551 | Bacteria | 7210 |
| 129 | Ga0105238_10193143 | 3300009551 | Bacteria | 2011 |
| 130 | Ga0105249_10073335 | 3300009553 | Bacteria | 3167 |
| 131 | Ga0105249_10223691 | 3300009553 | Bacteria | 1853 |
| 132 | Ga0105239_10019764 | 3300010375 | Bacteria | 7434 |
| 133 | Ga0105239_10187365 | 3300010375 | Bacteria | 2316 |
| 134 | Ga0105239_10298329 | 3300010375 | Bacteria | 1815 |
| 135 | Ga0105239_10469549 | 3300010375 | Bacteria | 1429 |
| 136 | Ga0105246_10021001 | 3300011119 | Bacteria | 4195 |
| 137 | Ga0105246_10076971 | 3300011119 | Bacteria | 2365 |
| 138 | Ga0157370_10016953 | 3300013104 | Bacteria | 7364 |
| 139 | Ga0157369_10056151 | 3300013105 | Bacteria | 4249 |
| 140 | Ga0157374_10058735 | 3300013296 | Bacteria | 3595 |
| 141 | Ga0157374_10747895 | 3300013296 | Bacteria | 992 |
| 142 | Ga0157378_10004686 | 3300013297 | Bacteria | 12000 |
| 143 | Ga0157378_10116133 | 3300013297 | Bacteria | 2460 |
| 144 | Ga0163162_10040728 | 3300013306 | Bacteria | 4647 |
| 145 | Ga0157375_10001930 | 3300013308 | Bacteria | 17844 |
| 146 | Ga0163163_10006561 | 3300014325 | Bacteria | 10191 |
| 147 | Ga0163163_10197113 | 3300014325 | Bacteria | 2062 |
| 148 | Ga0163163_10856046 | 3300014325 | Bacteria | 972 |
| 149 | Ga0157380_10300135 | 3300014326 | Bacteria | 1479 |
| 150 | Ga0157376_10034440 | 3300014969 | Bacteria | 4089 |
| 151 | Ga0163161_10198250 | 3300017792 | Bacteria | 1546 |
| 152 | Ga0213876_10065897 | 3300021384 | Bacteria | 1912 |
| 153 | Ga0213876_10198330 | 3300021384 | Bacteria | 1067 |
| 154 | Ga0209233_1008324 | 3300025261 | Bacteria | 3218 |
| 155 | Ga0209758_1005378 | 3300025297 | Bacteria | 9910 |
| 156 | Ga0209758_1006141 | 3300025297 | Bacteria | 8801 |
| 157 | Ga0207697_10093962 | 3300025315 | Bacteria | 1273 |
| 158 | Ga0207656_10021355 | 3300025321 | Bacteria | 2586 |
| 159 | Ga0207692_10011257 | 3300025898 | Bacteria | 3799 |
| 160 | Ga0207710_10007229 | 3300025900 | Bacteria | 4707 |
| 161 | Ga0207688_10035768 | 3300025901 | Bacteria | 2751 |
| 162 | Ga0207688_10082310 | 3300025901 | Bacteria | 1839 |
| 163 | Ga0207647_10179385 | 3300025904 | Bacteria | 1231 |
| 164 | Ga0207685_10054345 | 3300025905 | Bacteria | 1559 |
| 165 | Ga0207699_10000906 | 3300025906 | Bacteria | 14182 |
| 166 | Ga0207643_10199792 | 3300025908 | Bacteria | 1217 |
| 167 | Ga0207705_10009046 | 3300025909 | Bacteria | 7258 |
| 168 | Ga0207707_10011429 | 3300025912 | Bacteria | 7734 |
| 169 | Ga0207707_10020556 | 3300025912 | Bacteria | 5765 |
| 170 | Ga0207695_10285736 | 3300025913 | Bacteria | 1543 |
| 171 | Ga0207671_10023239 | 3300025914 | Bacteria | 4677 |
| 172 | Ga0207671_10037370 | 3300025914 | Bacteria | 3601 |
| 173 | Ga0207693_10018775 | 3300025915 | Bacteria | 5503 |
| 174 | Ga0207693_10084372 | 3300025915 | Bacteria | 2489 |
| 175 | Ga0207693_10089093 | 3300025915 | Bacteria | 2418 |
| 176 | Ga0207663_10001422 | 3300025916 | Bacteria | 11119 |
| 177 | Ga0207660_10004673 | 3300025917 | Bacteria | 8916 |
| 178 | Ga0207660_10074991 | 3300025917 | Bacteria | 2470 |
| 179 | Ga0207657_10002034 | 3300025919 | Bacteria | 21867 |
| 180 | Ga0207649_10133343 | 3300025920 | Bacteria | 1690 |
| 181 | Ga0207652_10006633 | 3300025921 | Bacteria | 9324 |
| 182 | Ga0207652_10029677 | 3300025921 | Bacteria | 4575 |
| 183 | Ga0207646_10043563 | 3300025922 | Bacteria | 4029 |
| 184 | Ga0207650_10259000 | 3300025925 | Bacteria | 1410 |
| 185 | Ga0207659_10261007 | 3300025926 | Bacteria | 1409 |
| 186 | Ga0207687_10082133 | 3300025927 | Bacteria | 2331 |
| 187 | Ga0207700_10030154 | 3300025928 | Bacteria | 3837 |
| 188 | Ga0207700_10482885 | 3300025928 | Bacteria | 1095 |
| 189 | Ga0207664_10401548 | 3300025929 | Bacteria | 1219 |
| 190 | Ga0207644_10094289 | 3300025931 | Bacteria | 2236 |
| 191 | Ga0207644_10246418 | 3300025931 | Bacteria | 1424 |
| 192 | Ga0207690_10316048 | 3300025932 | Bacteria | 1226 |
| 193 | Ga0207706_10274625 | 3300025933 | Bacteria | 1470 |
| 194 | Ga0207691_10141558 | 3300025940 | Bacteria | 2119 |
| 195 | Ga0207711_10195490 | 3300025941 | Bacteria | 1844 |
| 196 | Ga0207689_10003079 | 3300025942 | Bacteria | 15347 |
| 197 | Ga0207689_10062579 | 3300025942 | Bacteria | 3060 |
| 198 | Ga0207689_10116314 | 3300025942 | Bacteria | 2198 |
| 199 | Ga0207679_10087024 | 3300025945 | Bacteria | 2405 |
| 200 | Ga0207667_10053925 | 3300025949 | Bacteria | 4230 |
| 201 | Ga0207667_10054038 | 3300025949 | Bacteria | 4225 |
| 202 | Ga0207667_10219625 | 3300025949 | Bacteria | 1947 |
| 203 | Ga0207712_10292450 | 3300025961 | Bacteria | 1334 |
| 204 | Ga0207668_10019444 | 3300025972 | Bacteria | 4294 |
| 205 | Ga0207668_10038403 | 3300025972 | Bacteria | 3213 |
| 206 | Ga0207668_10136577 | 3300025972 | Bacteria | 1879 |
| 207 | Ga0207677_10020900 | 3300026023 | Bacteria | 3988 |
| 208 | Ga0207677_10122180 | 3300026023 | Bacteria | 1961 |
| 209 | Ga0207703_10020295 | 3300026035 | Bacteria | 5196 |
| 210 | Ga0207639_10053795 | 3300026041 | Bacteria | 3073 |
| 211 | Ga0207639_10100797 | 3300026041 | Bacteria | 2333 |
| 212 | Ga0207639_10152382 | 3300026041 | Bacteria | 1938 |
| 213 | Ga0207678_10053901 | 3300026067 | Bacteria | 3464 |
| 214 | Ga0207678_10082789 | 3300026067 | Bacteria | 2745 |
| 215 | Ga0207678_10130471 | 3300026067 | Bacteria | 2144 |
| 216 | Ga0207702_10241420 | 3300026078 | Bacteria | 1693 |
| 217 | Ga0207641_10322560 | 3300026088 | Bacteria | 1465 |
| 218 | Ga0207674_10035459 | 3300026116 | Bacteria | 5206 |
| 219 | Ga0207674_10390367 | 3300026116 | Bacteria | 1345 |
| 220 | Ga0207675_100108022 | 3300026118 | Bacteria | 2624 |
| 221 | Ga0207683_10107605 | 3300026121 | Bacteria | 2494 |
| 222 | Ga0207683_10216984 | 3300026121 | Bacteria | 1742 |
| 223 | Ga0207683_10351507 | 3300026121 | Bacteria | 1353 |
| 224 | Ga0207698_10372364 | 3300026142 | Bacteria | 1356 |
| 225 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 226 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 227 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 228 | Ga0268266_10068671 | 3300028379 | Bacteria | 3069 |
| 229 | Ga0268265_10023170 | 3300028380 | Bacteria | 4373 |
| 230 | Ga0268265_10138872 | 3300028380 | Bacteria | 2031 |
| 231 | Ga0268265_10434822 | 3300028380 | Bacteria | 1222 |
| 232 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 233 | Ga0307517_10000053 | 3300028786 | Bacteria | 155723 |
| 234 | Ga0307517_10167604 | 3300028786 | Bacteria | 1454 |
| 235 | Ga0307517_10179636 | 3300028786 | Bacteria | 1369 |
| 236 | Ga0307515_10040676 | 3300028794 | Bacteria | 7342 |
| 237 | Ga0307515_10116683 | 3300028794 | Bacteria | 3063 |
| 238 | Ga0265760_10029820 | 3300031090 | Bacteria | 1605 |
| 239 | Ga0265330_10009220 | 3300031235 | Bacteria | 4699 |
| 240 | Ga0265325_10011639 | 3300031241 | Bacteria | 5053 |
| 241 | Ga0265340_10003262 | 3300031247 | Bacteria | 9202 |
| 242 | Ga0265339_10013815 | 3300031249 | Bacteria | 4886 |
| 243 | Ga0265339_10016659 | 3300031249 | Bacteria | 4374 |
| 244 | Ga0265331_10028279 | 3300031250 | Bacteria | 2805 |
| 245 | Ga0265331_10049041 | 3300031250 | Bacteria | 2029 |
| 246 | Ga0307509_10018344 | 3300031507 | Bacteria | 8023 |
| 247 | Ga0307509_10047750 | 3300031507 | Bacteria | 4603 |
| 248 | Ga0307509_10279788 | 3300031507 | Bacteria | 1430 |
| 249 | Ga0265314_10028730 | 3300031711 | Bacteria | 4142 |
| 250 | Ga0265342_10021476 | 3300031712 | Bacteria | 4120 |
| 251 | Ga0307516_10065794 | 3300031730 | Bacteria | 3499 |
| 252 | Ga0307516_10173583 | 3300031730 | Bacteria | 1894 |
| 253 | Ga0307405_10250459 | 3300031731 | Bacteria | 1318 |
| 254 | Ga0307406_10009560 | 3300031901 | Bacteria | 5444 |
| 255 | Ga0307412_10070989 | 3300031911 | Bacteria | 2376 |
| 256 | Ga0307409_100224376 | 3300031995 | Bacteria | 1698 |
| 257 | Ga0307411_10465837 | 3300032005 | Bacteria | 1061 |
| 258 | Ga0307415_100045721 | 3300032126 | Bacteria | 2937 |
| 259 | Ga0307415_100205726 | 3300032126 | Bacteria | 1566 |
| 260 | Ga0307415_100222487 | 3300032126 | Bacteria | 1514 |
| 261 | Ga0307415_100476956 | 3300032126 | Bacteria | 1085 |
| 262 | Ga0307507_10011020 | 3300033179 | Bacteria | 11505 |
| 263 | Ga0307510_10035900 | 3300033180 | Bacteria | 5526 |
| 264 | Ga0307510_10137815 | 3300033180 | Bacteria | 2093 |
| 265 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 266 | Ga0373926_0096913 | 3300035083 | Bacteria | 1100 |
| 267 | Ga0373923_0006867 | 3300035111 | Bacteria | 3963 |
| 268 | Ga0373945_0016702 | 3300035116 | Bacteria | 2479 |
| 269 | Ga0373953_0000126 | 3300035117 | Bacteria | 18697 |
| 270 | Ga0373954_0001515 | 3300035118 | Bacteria | 9450 |
| 271 | Ga0373956_0000764 | 3300035119 | Bacteria | 13305 |
| 272 | Ga0373957_0000307 | 3300035120 | Bacteria | 12288 |
| 273 | Ga0373946_0153536 | 3300035171 | Bacteria | 1076 |
| 274 | Ga0373955_0001379 | 3300035172 | Bacteria | 10317 |
| 275 | Ga0373924_0000464 | 3300035410 | Bacteria | 12448 |
| 276 | Ga0373931_0011628 | 3300035691 | Bacteria | 4252 |
| 277 | Ga0373935_0020505 | 3300035692 | Bacteria | 4040 |
| 278 | Ga0373927_0019507 | 3300035695 | Bacteria | 4445 |
| 279 | Ga0373927_0036007 | 3300035695 | Bacteria | 3219 |
| 280 | Ga0373933_0000600 | 3300035724 | Bacteria | 22552 |
| 281 | Ga0373933_0018828 | 3300035724 | Bacteria | 3889 |
| 282 | Ga0373937_0005936 | 3300036401 | Bacteria | 10510 |
| 283 | Ga0373925_0076375 | 3300037068 | Bacteria | 2540 |
| 284 | Ga0373925_0335032 | 3300037068 | Bacteria | 1226 |
| 285 | Ga0373925_0345544 | 3300037068 | Bacteria | 1207 |
| 286 | Ga0395899_0009512 | 3300037312 | Bacteria | 7459 |
| 287 | Ga0395900_0017087 | 3300037418 | Bacteria | 7406 |
| 288 | Ga0395900_0694512 | 3300037418 | Bacteria | 951 |
| 289 | Ga0395898_0008831 | 3300037466 | Bacteria | 10619 |
| 290 | Ga0395905_0130231 | 3300037471 | Bacteria | 2366 |
| 291 | Ga0395901_0012156 | 3300038443 | Bacteria | 8732 |
| 292 | Ga0395901_0119536 | 3300038443 | Bacteria | 2769 |
| 293 | Ga0395901_0133406 | 3300038443 | Bacteria | 2610 |
| 294 | Ga0436365_0099590 | 3300039437 | Bacteria | 1813 |
| 295 | Ga0436365_1392334 | 3300039437 | Bacteria | 3166 |
| 296 | Ga0436365_1781966 | 3300039437 | Bacteria | 2693 |
| 297 | Ga0436360_1372477 | 3300039438 | Bacteria | 1099 |
| 298 | Ga0436363_0992782 | 3300039450 | Bacteria | 3750 |
| 299 | Ga0436363_1275846 | 3300039450 | Bacteria | 2596 |
| 300 | Ga0466961_0099042 | 3300044693 | Bacteria | 1838 |
| 301 | Ga0466959_0117710 | 3300045049 | Bacteria | 1891 |
| 302 | Ga0466959_0129267 | 3300045049 | Bacteria | 1791 |
| 303 | Ga0466967_0047007 | 3300045976 | Bacteria | 3761 |
| 304 | Ga0495592_0000570 | 3300046454 | Bacteria | 26078 |
| 305 | Ga0495603_0035963 | 3300046455 | Bacteria | 2973 |
| 306 | Ga0495603_0066275 | 3300046455 | Bacteria | 2126 |
| 307 | Ga0495603_0105574 | 3300046455 | Bacteria | 1644 |
| 308 | Ga0495603_0153388 | 3300046455 | Bacteria | 1337 |
| 309 | Ga0495629_0010704 | 3300046459 | Bacteria | 6669 |
| 310 | Ga0495629_0143163 | 3300046459 | Bacteria | 1663 |
| 311 | Ga0495629_0165865 | 3300046459 | Bacteria | 1534 |
| 312 | Ga0495638_0107779 | 3300046460 | Bacteria | 1658 |
| 313 | Ga0495651_0007469 | 3300046462 | Bacteria | 8359 |
| 314 | Ga0495651_0033637 | 3300046462 | Bacteria | 3998 |
| 315 | Ga0495651_0113781 | 3300046462 | Bacteria | 1997 |
| 316 | Ga0495653_0002759 | 3300046463 | Bacteria | 14010 |
| 317 | Ga0495650_0128060 | 3300046471 | Bacteria | 929 |
| 318 | Ga0495582_0029543 | 3300046473 | Bacteria | 3009 |
| 319 | Ga0495639_0021892 | 3300046475 | Bacteria | 2801 |
| 320 | Ga0495662_0112256 | 3300046476 | Bacteria | 1336 |
| 321 | Ga0495584_0090144 | 3300046491 | Bacteria | 1546 |
| 322 | Ga0495585_0123647 | 3300046492 | Bacteria | 1367 |
| 323 | Ga0495594_0059608 | 3300046499 | Bacteria | 2111 |
| 324 | Ga0495606_0002525 | 3300046507 | Bacteria | 21061 |
| 325 | Ga0495608_0003962 | 3300046511 | Bacteria | 10635 |
| 326 | Ga0495610_0032499 | 3300046512 | Bacteria | 2709 |
| 327 | Ga0495628_0009664 | 3300046516 | Bacteria | 8230 |
| 328 | Ga0495652_0003587 | 3300046529 | Bacteria | 15224 |
| 329 | Ga0495665_0008224 | 3300046531 | Bacteria | 5657 |
| 330 | Ga0495640_0007192 | 3300046533 | Bacteria | 8763 |
| 331 | Ga0495640_0092984 | 3300046533 | Bacteria | 1988 |
| 332 | Ga0495587_0002145 | 3300046536 | Bacteria | 13193 |
| 333 | Ga0495645_0007470 | 3300046543 | Bacteria | 7608 |
| 334 | Ga0495667_0000747 | 3300046559 | Bacteria | 20874 |
| 335 | Ga0495667_0128856 | 3300046559 | Bacteria | 1632 |
| 336 | Ga0495668_0020113 | 3300046616 | Bacteria | 3840 |
| 337 | Ga0495668_0077926 | 3300046616 | Bacteria | 1820 |
| 338 | Ga0495634_0014453 | 3300046642 | Bacteria | 5691 |
| 339 | Ga0495611_0039668 | 3300046648 | Bacteria | 2097 |
| 340 | Ga0495611_0152023 | 3300046648 | Bacteria | 1080 |
| 341 | Ga0495625_0131353 | 3300046660 | Bacteria | 1696 |
| 342 | Ga0495625_0144357 | 3300046660 | Bacteria | 1604 |
| 343 | Ga0495635_0000532 | 3300046663 | Bacteria | 24183 |
| 344 | Ga0495659_0056652 | 3300046664 | Bacteria | 1439 |
| 345 | Ga0495657_0002564 | 3300046675 | Bacteria | 15242 |
| 346 | Ga0495599_0000394 | 3300046678 | Bacteria | 24995 |
| 347 | Ga0495623_0003632 | 3300046679 | Bacteria | 10193 |
| 348 | Ga0495646_0000916 | 3300046680 | Bacteria | 16760 |
| 349 | Ga0495647_0064056 | 3300046681 | Bacteria | 1457 |
| 350 | Ga0495658_0013531 | 3300046683 | Bacteria | 4154 |
| 351 | Ga0495658_0133036 | 3300046683 | Bacteria | 1515 |
| 352 | Ga0495658_0281531 | 3300046683 | Bacteria | 1049 |
| 353 | Ga0495669_0233056 | 3300046684 | Bacteria | 883 |
| 354 | Ga0495613_0237072 | 3300046689 | Bacteria | 1276 |
| 355 | Ga0495624_0059898 | 3300046690 | Bacteria | 2388 |
| 356 | Ga0495600_0002273 | 3300046809 | Bacteria | 10948 |
| 357 | Ga0495581_0099177 | 3300047315 | Bacteria | 1692 |
| 358 | Ga0495604_0002072 | 3300047317 | Bacteria | 16184 |
| 359 | Ga0495674_0519600 | 3300047319 | Bacteria | 951 |
| 360 | Ga0495672_0010348 | 3300047320 | Bacteria | 6658 |
| 361 | Ga0495672_0224030 | 3300047320 | Bacteria | 927 |
| 362 | Ga0495680_0003634 | 3300047322 | Bacteria | 15066 |
| 363 | Ga0495675_0001271 | 3300047444 | Bacteria | 15273 |
| 364 | Ga0495673_0013049 | 3300047469 | Bacteria | 4378 |
| 365 | Ga0495684_0001102 | 3300047471 | Bacteria | 21742 |
| 366 | Ga0495593_0000928 | 3300047673 | Bacteria | 17048 |
| 367 | Ga0495602_0003533 | 3300048088 | Bacteria | 16153 |
| 368 | Ga0496100_0120661 | 3300048903 | Bacteria | 1833 |
| 369 | Ga0496101_0013133 | 3300048904 | Bacteria | 5541 |
| 370 | Ga0496101_0167634 | 3300048904 | Bacteria | 1687 |
| 371 | Ga0496102_0010897 | 3300048905 | Bacteria | 7829 |
| 372 | Ga0496102_0102868 | 3300048905 | Bacteria | 2656 |
| 373 | Ga0496102_0234488 | 3300048905 | Bacteria | 1730 |
| 374 | Ga0496102_0452001 | 3300048905 | Bacteria | 1205 |
| 375 | Ga0496102_0494590 | 3300048905 | Bacteria | 1145 |
| 376 | Ga0496103_0017042 | 3300048906 | Bacteria | 4343 |
| 377 | Ga0496105_0145316 | 3300048908 | Bacteria | 1950 |
| 378 | Ga0496106_0011464 | 3300048909 | Bacteria | 6556 |
| 379 | Ga0496106_0087695 | 3300048909 | Bacteria | 2398 |
| 380 | Ga0496106_0300228 | 3300048909 | Bacteria | 1288 |
| 381 | Ga0496107_0007915 | 3300048910 | Bacteria | 7333 |
| 382 | Ga0496107_0024824 | 3300048910 | Bacteria | 4242 |
| 383 | Ga0496108_0203807 | 3300048911 | Bacteria | 1717 |
| 384 | Ga0496109_0115603 | 3300048912 | Bacteria | 2496 |
| 385 | Ga0496110_0066881 | 3300048913 | Bacteria | 3178 |
| 386 | Ga0496110_0233432 | 3300048913 | Bacteria | 1673 |
| 387 | Ga0496110_0266432 | 3300048913 | Bacteria | 1560 |
| 388 | Ga0496111_0032287 | 3300048914 | Bacteria | 3732 |
| 389 | Ga0496112_0000009 | 3300048915 | Bacteria | 299708 |
| 390 | Ga0496112_0043944 | 3300048915 | Bacteria | 4375 |
| 391 | Ga0496112_0182303 | 3300048915 | Bacteria | 2063 |
| 392 | Ga0496112_0353279 | 3300048915 | Bacteria | 1412 |
| 393 | Ga0496113_0018679 | 3300048916 | Bacteria | 4832 |
| 394 | Ga0496113_0095767 | 3300048916 | Bacteria | 2294 |
| 395 | Ga0496113_0338106 | 3300048916 | Bacteria | 1207 |
| 396 | Ga0496114_0276989 | 3300048917 | Bacteria | 1479 |
| 397 | Ga0496115_0001003 | 3300048918 | Bacteria | 20483 |
| 398 | Ga0496115_0141724 | 3300048918 | Bacteria | 1983 |
| 399 | Ga0496115_0248170 | 3300048918 | Bacteria | 1466 |
| 400 | Ga0496115_0374119 | 3300048918 | Bacteria | 1159 |
| 401 | Ga0496117_0025417 | 3300048920 | Bacteria | 4658 |
| 402 | Ga0496117_0115449 | 3300048920 | Bacteria | 1662 |
| 403 | Ga0496118_0002027 | 3300048921 | Bacteria | 28645 |
| 404 | Ga0496118_0034981 | 3300048921 | Bacteria | 4088 |
| 405 | Ga0496119_0062341 | 3300048922 | Bacteria | 2222 |
| 406 | Ga0496121_0000110 | 3300048924 | Bacteria | 186482 |
| 407 | Ga0496121_0001680 | 3300048924 | Bacteria | 36396 |
| 408 | Ga0496121_0020161 | 3300048924 | Bacteria | 6619 |
| 409 | Ga0496121_0039727 | 3300048924 | Bacteria | 4139 |
| 410 | Ga0496121_0056087 | 3300048924 | Bacteria | 3276 |
| 411 | Ga0496121_0090450 | 3300048924 | Bacteria | 2392 |
| 412 | Ga0496121_0102812 | 3300048924 | Bacteria | 2200 |
| 413 | Ga0496121_0221734 | 3300048924 | Bacteria | 1331 |
| 414 | Ga0496121_0432299 | 3300048924 | Bacteria | 853 |
| 415 | Ga0496124_0000378 | 3300048927 | Bacteria | 81220 |
| 416 | Ga0496124_0065128 | 3300048927 | Bacteria | 3040 |
| 417 | Ga0496126_0006083 | 3300048929 | Bacteria | 13538 |
| 418 | Ga0496126_0011403 | 3300048929 | Bacteria | 9205 |
| 419 | Ga0496126_0076452 | 3300048929 | Bacteria | 2970 |
| 420 | Ga0496126_0150791 | 3300048929 | Bacteria | 1993 |
| 421 | Ga0496126_0151724 | 3300048929 | Bacteria | 1985 |
| 422 | Ga0496126_0166117 | 3300048929 | Bacteria | 1883 |
| 423 | Ga0496126_0249943 | 3300048929 | Bacteria | 1478 |
| 424 | Ga0496126_0318816 | 3300048929 | Bacteria | 1278 |
| 425 | Ga0501069_0123716 | 3300049585 | Bacteria | 1478 |
| 426 | nmdc:mga03n38_404_c1 | 3300050490 | Bacteria | 10692 |
| 427 | nmdc:mga0yw44_235943_c1 | 3300050492 | Bacteria | 1215 |
| 428 | nmdc:mga0yw44_28610_c1 | 3300050492 | Bacteria | 3208 |
| 429 | nmdc:mga0yw44_2914_c1 | 3300050492 | Bacteria | 7443 |
| 430 | nmdc:mga06z11_18548_c1 | 3300050494 | Bacteria | 3180 |
| 431 | nmdc:mga06z11_67227_c1 | 3300050494 | Bacteria | 1886 |
| 432 | nmdc:mga07m45_14532_c1 | 3300050496 | Bacteria | 2758 |
| 433 | nmdc:mga05p37_42792_c1 | 3300050507 | Bacteria | 5567 |
| 434 | nmdc:mga0qj67_22287_c1 | 3300050509 | Unclassified | 4865 |
| 435 | nmdc:mga06r32_28441_c1 | 3300050510 | Bacteria | 5230 |
| 436 | nmdc:mga0sz30_49731_c1 | 3300050516 | Bacteria | 1777 |
| 437 | Ga0495612_0014656 | 3300053078 | Bacteria | 3150 |
| 438 | Ga0495612_0064198 | 3300053078 | Bacteria | 1524 |
| 439 | Ga0500635_0004771 | 3300053080 | Bacteria | 3510 |
| 440 | Ga0495595_0000293 | 3300053084 | Bacteria | 19495 |
| 441 | Ga0495595_0014681 | 3300053084 | Bacteria | 3327 |
| 442 | Ga0495619_0001314 | 3300053085 | Bacteria | 16317 |
| 443 | Ga0495619_0058817 | 3300053085 | Bacteria | 2553 |
| 444 | Ga0500643_053318 | 3300053087 | Bacteria | 1150 |
| 445 | Ga0500583_0003359 | 3300053092 | Bacteria | 5024 |
| 446 | Ga0500651_0055899 | 3300053093 | Bacteria | 2471 |
| 447 | Ga0500566_0003149 | 3300053094 | Bacteria | 9863 |
| 448 | Ga0500566_0018579 | 3300053094 | Bacteria | 4081 |
| 449 | Ga0500650_0033657 | 3300053098 | Bacteria | 2338 |
| 450 | Ga0500594_0097751 | 3300053118 | Bacteria | 900 |
| 451 | Ga0500595_000288 | 3300053119 | Bacteria | 33340 |
| 452 | Ga0500595_000564 | 3300053119 | Bacteria | 22025 |
| 453 | Ga0500595_003000 | 3300053119 | Bacteria | 8027 |
| 454 | Ga0500595_013695 | 3300053119 | Bacteria | 3101 |
| 455 | Ga0500595_036354 | 3300053119 | Bacteria | 1613 |
| 456 | Ga0500595_049162 | 3300053119 | Bacteria | 1315 |
| 457 | Ga0500617_046234 | 3300053124 | Bacteria | 1946 |
| 458 | Ga0500655_007870 | 3300053133 | Bacteria | 1920 |
| 459 | Ga0500658_0108129 | 3300053134 | Bacteria | 1221 |
| 460 | Ga0500568_0048354 | 3300053139 | Bacteria | 1682 |
| 461 | Ga0500573_0015494 | 3300053140 | Bacteria | 4322 |
| 462 | Ga0500577_0021511 | 3300053142 | Bacteria | 2126 |
| 463 | Ga0500589_076429 | 3300053147 | Bacteria | 1503 |
| 464 | Ga0500590_055846 | 3300053148 | Bacteria | 1997 |
| 465 | Ga0500622_0165086 | 3300053156 | Bacteria | 1035 |
| 466 | Ga0500627_0065903 | 3300053158 | Bacteria | 1599 |
| 467 | Ga0500638_001439 | 3300053162 | Bacteria | 7470 |
| 468 | Ga0500639_112272 | 3300053163 | Bacteria | 1324 |
| 469 | Ga0500636_0050848 | 3300053177 | Bacteria | 2437 |
| 470 | Ga0500636_0171472 | 3300053177 | Bacteria | 1173 |
| 471 | Ga0500609_006761 | 3300053731 | Bacteria | 1559 |
| 472 | Ga0500596_001687 | 3300053735 | Bacteria | 4474 |
| 473 | Ga0500661_000491 | 3300055283 | Bacteria | 7332 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032126 | Ga0307415_100205726 | Ga0307415_1002057262 | 221 |
| 2 | 3300003320 | rootH2_10118023 | rootH2_101180232 | 232 |
| 3 | 3300032126 | Ga0307415_100045721 | Ga0307415_1000457213 | 244 |
| 4 | 3300038443 | Ga0395901_0119536 | Ga0395901_0119536_972_1802 | 245 |
| 5 | 3300046516 | Ga0495628_0009664 | Ga0495628_0009664_902_1765 | 248 |
| 6 | 3300046543 | Ga0495645_0007470 | Ga0495645_0007470_4297_5160 | 248 |
| 7 | 3300021384 | Ga0213876_10065897 | Ga0213876_100658971 | 251 |
| 8 | 3300037418 | Ga0395900_0694512 | Ga0395900_0694512_108_938 | 251 |
| 9 | 3300039437 | Ga0436365_1781966 | Ga0436365_1781966_882_1718 | 251 |
| 10 | 3300039450 | Ga0436363_1275846 | Ga0436363_1275846_947_1783 | 251 |
| 11 | 3300046459 | Ga0495629_0165865 | Ga0495629_0165865_467_1282 | 252 |
| 12 | 3300025297 | Ga0209758_1006141 | Ga0209758_10061416 | 255 |
| 13 | 3300048929 | Ga0496126_0166117 | Ga0496126_0166117_630_1454 | 255 |
| 14 | 3300021384 | Ga0213876_10198330 | Ga0213876_101983302 | 256 |
| 15 | 3300039437 | Ga0436365_1392334 | Ga0436365_1392334_1591_2433 | 256 |
| 16 | 3300053177 | Ga0500636_0171472 | Ga0500636_0171472_13_792 | 256 |
| 17 | 3300005435 | Ga0070714_100096393 | Ga0070714_1000963932 | 258 |
| 18 | 3300005436 | Ga0070713_100026202 | Ga0070713_1000262022 | 258 |
| 19 | 3300028794 | Ga0307515_10040676 | Ga0307515_100406764 | 258 |
| 20 | 3300031249 | Ga0265339_10016659 | Ga0265339_100166593 | 258 |
| 21 | 3300031250 | Ga0265331_10028279 | Ga0265331_100282794 | 258 |
| 22 | 3300031711 | Ga0265314_10028730 | Ga0265314_100287306 | 258 |
| 23 | 3300031712 | Ga0265342_10021476 | Ga0265342_100214764 | 258 |
| 24 | 3300032005 | Ga0307411_10465837 | Ga0307411_104658371 | 258 |
| 25 | 3300045976 | Ga0466967_0047007 | Ga0466967_0047007_2521_3351 | 258 |
| 26 | 3300048924 | Ga0496121_0090450 | Ga0496121_0090450_762_1619 | 259 |
| 27 | 3300033180 | Ga0307510_10137815 | Ga0307510_101378152 | 261 |
| 28 | 3300006880 | Ga0075429_100147942 | Ga0075429_1001479422 | 262 |
| 29 | 3300028794 | Ga0307515_10116683 | Ga0307515_101166833 | 262 |
| 30 | 3300035695 | Ga0373927_0019507 | Ga0373927_0019507_3632_4420 | 262 |
| 31 | 3300050509 | nmdc:mga0qj67_22287_c1 | nmdc:mga0qj67_22287_c1_136_972 | 262 |
| 32 | 3300050510 | nmdc:mga06r32_28441_c1 | nmdc:mga06r32_28441_c1_826_1662 | 262 |
| 33 | 3300005327 | Ga0070658_10000865 | Ga0070658_1000086517 | 263 |
| 34 | 3300005336 | Ga0070680_100001697 | Ga0070680_1000016979 | 263 |
| 35 | 3300005458 | Ga0070681_10010423 | Ga0070681_100104232 | 263 |
| 36 | 3300005530 | Ga0070679_100029107 | Ga0070679_1000291076 | 263 |
| 37 | 3300005563 | Ga0068855_100014843 | Ga0068855_1000148439 | 263 |
| 38 | 3300009093 | Ga0105240_10038548 | Ga0105240_100385483 | 263 |
| 39 | 3300009545 | Ga0105237_10071162 | Ga0105237_100711624 | 263 |
| 40 | 3300009551 | Ga0105238_10193143 | Ga0105238_101931432 | 263 |
| 41 | 3300025909 | Ga0207705_10009046 | Ga0207705_100090467 | 263 |
| 42 | 3300025912 | Ga0207707_10011429 | Ga0207707_100114293 | 263 |
| 43 | 3300025913 | Ga0207695_10285736 | Ga0207695_102857362 | 263 |
| 44 | 3300025914 | Ga0207671_10023239 | Ga0207671_100232393 | 263 |
| 45 | 3300025917 | Ga0207660_10004673 | Ga0207660_100046739 | 263 |
| 46 | 3300025921 | Ga0207652_10006633 | Ga0207652_100066339 | 263 |
| 47 | 3300025949 | Ga0207667_10053925 | Ga0207667_100539252 | 263 |
| 48 | 3300031090 | Ga0265760_10029820 | Ga0265760_100298202 | 263 |
| 49 | 3300031901 | Ga0307406_10009560 | Ga0307406_100095604 | 263 |
| 50 | 3300035083 | Ga0373926_0096913 | Ga0373926_0096913_77_910 | 263 |
| 51 | 3300035724 | Ga0373933_0018828 | Ga0373933_0018828_2635_3468 | 263 |
| 52 | 3300046471 | Ga0495650_0128060 | Ga0495650_0128060_24_842 | 263 |
| 53 | 3300046476 | Ga0495662_0112256 | Ga0495662_0112256_76_909 | 263 |
| 54 | 3300046681 | Ga0495647_0064056 | Ga0495647_0064056_421_1254 | 263 |
| 55 | 3300046684 | Ga0495669_0233056 | Ga0495669_0233056_38_856 | 263 |
| 56 | 3300048905 | Ga0496102_0494590 | Ga0496102_0494590_149_967 | 263 |
| 57 | 3300048915 | Ga0496112_0353279 | Ga0496112_0353279_36_857 | 263 |
| 58 | 3300048924 | Ga0496121_0432299 | Ga0496121_0432299_20_841 | 263 |
| 59 | 3300003215 | JGI25153J46596_10000456 | JGI25153J46596_1000045621 | 264 |
| 60 | 3300005842 | Ga0068858_100297711 | Ga0068858_1002977111 | 264 |
| 61 | 3300005843 | Ga0068860_100001218 | Ga0068860_10000121829 | 264 |
| 62 | 3300005937 | Ga0081455_10080828 | Ga0081455_100808282 | 264 |
| 63 | 3300006175 | Ga0070712_100071732 | Ga0070712_1000717322 | 264 |
| 64 | 3300009101 | Ga0105247_10009126 | Ga0105247_100091263 | 264 |
| 65 | 3300025297 | Ga0209758_1005378 | Ga0209758_10053786 | 264 |
| 66 | 3300025900 | Ga0207710_10007229 | Ga0207710_100072293 | 264 |
| 67 | 3300025915 | Ga0207693_10089093 | Ga0207693_100890932 | 264 |
| 68 | 3300028381 | Ga0268264_10000043 | Ga0268264_10000043310 | 264 |
| 69 | 3300046616 | Ga0495668_0077926 | Ga0495668_0077926_297_1157 | 264 |
| 70 | 3300048924 | Ga0496121_0056087 | Ga0496121_0056087_221_1039 | 264 |
| 71 | 3300049585 | Ga0501069_0123716 | Ga0501069_0123716_63_878 | 264 |
| 72 | 3300031249 | Ga0265339_10013815 | Ga0265339_100138154 | 265 |
| 73 | 3300044693 | Ga0466961_0099042 | Ga0466961_0099042_626_1432 | 265 |
| 74 | 3300045049 | Ga0466959_0117710 | Ga0466959_0117710_166_972 | 265 |
| 75 | 3300046455 | Ga0495603_0105574 | Ga0495603_0105574_585_1439 | 265 |
| 76 | 3300005435 | Ga0070714_100621081 | Ga0070714_1006210811 | 267 |
| 77 | 3300037068 | Ga0373925_0345544 | Ga0373925_0345544_116_979 | 267 |
| 78 | iso_pu_bacteria | 2524023228 | 2524541063 | 267 |
| 79 | iso_pu_bacteria | 2922425934 | 2922429866 | 267 |
| 80 | iso_pu_bacteria | 8006933436 | 8006940916 | 267 |
| 81 | iso_pu_bacteria | 8006973647 | 8006980891 | 267 |
| 82 | iso_pu_bacteria | 8019555841 | 8019557225 | 267 |
| 83 | iso_pu_bacteria | 8056673599 | 8056674179 | 267 |
| 84 | 3300003203 | JGI25406J46586_10008390 | JGI25406J46586_100083903 | 268 |
| 85 | 3300005983 | Ga0081540_1009779 | Ga0081540_10097793 | 268 |
| 86 | 3300005985 | Ga0081539_10000152 | Ga0081539_10000152163 | 268 |
| 87 | 3300006871 | Ga0075434_100008357 | Ga0075434_1000083575 | 269 |
| 88 | 3300009545 | Ga0105237_10203945 | Ga0105237_102039452 | 269 |
| 89 | 3300010375 | Ga0105239_10187365 | Ga0105239_101873652 | 269 |
| 90 | 3300031507 | Ga0307509_10018344 | Ga0307509_100183442 | 269 |
| 91 | 3300031507 | Ga0307509_10279788 | Ga0307509_102797882 | 269 |
| 92 | 3300033179 | Ga0307507_10011020 | Ga0307507_1001102013 | 269 |
| 93 | 3300035692 | Ga0373935_0020505 | Ga0373935_0020505_2489_3307 | 269 |
| 94 | 3300035695 | Ga0373927_0036007 | Ga0373927_0036007_641_1459 | 269 |
| 95 | 3300037068 | Ga0373925_0335032 | Ga0373925_0335032_196_1014 | 269 |
| 96 | 3300037312 | Ga0395899_0009512 | Ga0395899_0009512_2852_3670 | 269 |
| 97 | 3300037418 | Ga0395900_0017087 | Ga0395900_0017087_1839_2657 | 269 |
| 98 | 3300037466 | Ga0395898_0008831 | Ga0395898_0008831_4073_4891 | 269 |
| 99 | 3300038443 | Ga0395901_0012156 | Ga0395901_0012156_2826_3644 | 269 |
| 100 | 3300046683 | Ga0495658_0133036 | Ga0495658_0133036_588_1406 | 269 |
| 101 | 3300047319 | Ga0495674_0519600 | Ga0495674_0519600_80_898 | 269 |
| 102 | 3300048920 | Ga0496117_0025417 | Ga0496117_0025417_1231_2049 | 269 |
| 103 | 3300048921 | Ga0496118_0002027 | Ga0496118_0002027_14900_15718 | 269 |
| 104 | 3300048924 | Ga0496121_0000110 | Ga0496121_0000110_28392_29210 | 269 |
| 105 | 3300048927 | Ga0496124_0000378 | Ga0496124_0000378_12683_13501 | 269 |
| 106 | 3300048929 | Ga0496126_0006083 | Ga0496126_0006083_8664_9482 | 269 |
| 107 | 3300053080 | Ga0500635_0004771 | Ga0500635_0004771_511_1329 | 269 |
| 108 | 3300053094 | Ga0500566_0018579 | Ga0500566_0018579_452_1270 | 269 |
| 109 | 3300053140 | Ga0500573_0015494 | Ga0500573_0015494_1336_2154 | 269 |
| 110 | 3300053163 | Ga0500639_112272 | Ga0500639_112272_41_859 | 269 |
| 111 | 3300053735 | Ga0500596_001687 | Ga0500596_001687_3046_3864 | 269 |
| 112 | iso_pu_bacteria | 2513237137 | 2513863729 | 269 |
| 113 | iso_pu_bacteria | 2517572143 | 2517892819 | 269 |
| 114 | iso_pu_bacteria | 2904699407 | 2904702948 | 269 |
| 115 | iso_pu_bacteria | 2906610324 | 2906618192 | 269 |
| 116 | iso_pu_bacteria | 2906635258 | 2906642500 | 269 |
| 117 | iso_pu_bacteria | 2906660503 | 2906664268 | 269 |
| 118 | iso_pu_bacteria | 2908739725 | 2908743212 | 269 |
| 119 | iso_pu_bacteria | 3005474847 | 3005479786 | 269 |
| 120 | 3300005436 | Ga0070713_100074349 | Ga0070713_1000743494 | 270 |
| 121 | 3300006028 | Ga0070717_10154036 | Ga0070717_101540362 | 270 |
| 122 | 3300025928 | Ga0207700_10030154 | Ga0207700_100301546 | 270 |
| 123 | 3300048905 | Ga0496102_0234488 | Ga0496102_0234488_721_1593 | 270 |
| 124 | 3300005539 | Ga0068853_100400422 | Ga0068853_1004004221 | 271 |
| 125 | 3300006028 | Ga0070717_10036472 | Ga0070717_100364723 | 271 |
| 126 | 3300006177 | Ga0075362_10007055 | Ga0075362_100070552 | 271 |
| 127 | 3300006195 | Ga0075366_10004404 | Ga0075366_100044045 | 271 |
| 128 | 3300006844 | Ga0075428_100020956 | Ga0075428_1000209566 | 271 |
| 129 | 3300006943 | Ga0099822_1000949 | Ga0099822_100094918 | 271 |
| 130 | 3300007788 | Ga0099795_10044484 | Ga0099795_100444842 | 271 |
| 131 | 3300009093 | Ga0105240_10636707 | Ga0105240_106367072 | 271 |
| 132 | 3300025261 | Ga0209233_1008324 | Ga0209233_10083243 | 271 |
| 133 | 3300025928 | Ga0207700_10482885 | Ga0207700_104828851 | 271 |
| 134 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003332 | 271 |
| 135 | 3300027361 | Ga0209489_100003 | Ga0209489_100003383 | 271 |
| 136 | 3300027363 | Ga0209700_100003 | Ga0209700_100003383 | 271 |
| 137 | 3300028786 | Ga0307517_10167604 | Ga0307517_101676041 | 271 |
| 138 | 3300031235 | Ga0265330_10009220 | Ga0265330_100092205 | 271 |
| 139 | 3300031247 | Ga0265340_10003262 | Ga0265340_100032629 | 271 |
| 140 | 3300035171 | Ga0373946_0153536 | Ga0373946_0153536_194_1009 | 271 |
| 141 | 3300037068 | Ga0373925_0076375 | Ga0373925_0076375_521_1336 | 271 |
| 142 | 3300037471 | Ga0395905_0130231 | Ga0395905_0130231_1128_1943 | 271 |
| 143 | 3300038443 | Ga0395901_0133406 | Ga0395901_0133406_934_1749 | 271 |
| 144 | 3300045049 | Ga0466959_0129267 | Ga0466959_0129267_691_1506 | 271 |
| 145 | 3300046455 | Ga0495603_0035963 | Ga0495603_0035963_1411_2226 | 271 |
| 146 | 3300047320 | Ga0495672_0010348 | Ga0495672_0010348_223_1038 | 271 |
| 147 | 3300047320 | Ga0495672_0224030 | Ga0495672_0224030_62_877 | 271 |
| 148 | 3300048911 | Ga0496108_0203807 | Ga0496108_0203807_144_959 | 271 |
| 149 | 3300048913 | Ga0496110_0266432 | Ga0496110_0266432_136_951 | 271 |
| 150 | 3300048916 | Ga0496113_0338106 | Ga0496113_0338106_56_871 | 271 |
| 151 | 3300048917 | Ga0496114_0276989 | Ga0496114_0276989_448_1263 | 271 |
| 152 | 3300048918 | Ga0496115_0248170 | Ga0496115_0248170_266_1096 | 271 |
| 153 | 3300048918 | Ga0496115_0374119 | Ga0496115_0374119_283_1098 | 271 |
| 154 | 3300048924 | Ga0496121_0001680 | Ga0496121_0001680_21250_22065 | 271 |
| 155 | 3300050492 | nmdc:mga0yw44_2914_c1 | nmdc:mga0yw44_2914_c1_6533_7390 | 271 |
| 156 | 3300050507 | nmdc:mga05p37_42792_c1 | nmdc:mga05p37_42792_c1_1104_1961 | 271 |
| 157 | 3300050516 | nmdc:mga0sz30_49731_c1 | nmdc:mga0sz30_49731_c1_57_914 | 271 |
| 158 | 3300053119 | Ga0500595_013695 | Ga0500595_013695_1701_2573 | 271 |
| 159 | iso_pu_bacteria | 2791355199 | 2793083398 | 271 |
| 160 | iso_pu_bacteria | 2889033259 | 2889040160 | 271 |
| 161 | iso_pu_bacteria | 8006994254 | 8007000118 | 271 |
| 162 | 3300005539 | Ga0068853_100016363 | Ga0068853_1000163635 | 272 |
| 163 | 3300005547 | Ga0070693_100470437 | Ga0070693_1004704371 | 272 |
| 164 | 3300010375 | Ga0105239_10469549 | Ga0105239_104695492 | 272 |
| 165 | 3300025315 | Ga0207697_10093962 | Ga0207697_100939622 | 272 |
| 166 | 3300025932 | Ga0207690_10316048 | Ga0207690_103160482 | 272 |
| 167 | 3300026041 | Ga0207639_10053795 | Ga0207639_100537953 | 272 |
| 168 | 3300039438 | Ga0436360_1372477 | Ga0436360_1372477_83_904 | 272 |
| 169 | 3300046462 | Ga0495651_0113781 | Ga0495651_0113781_773_1594 | 272 |
| 170 | 3300048920 | Ga0496117_0115449 | Ga0496117_0115449_803_1624 | 272 |
| 171 | 3300048921 | Ga0496118_0034981 | Ga0496118_0034981_3254_4075 | 272 |
| 172 | 3300048922 | Ga0496119_0062341 | Ga0496119_0062341_600_1421 | 272 |
| 173 | 3300048924 | Ga0496121_0020161 | Ga0496121_0020161_3099_3920 | 272 |
| 174 | 3300048929 | Ga0496126_0249943 | Ga0496126_0249943_23_844 | 272 |
| 175 | 3300053093 | Ga0500651_0055899 | Ga0500651_0055899_159_980 | 272 |
| 176 | 3300053118 | Ga0500594_0097751 | Ga0500594_0097751_43_864 | 272 |
| 177 | 3300053119 | Ga0500595_000564 | Ga0500595_000564_16689_17510 | 272 |
| 178 | 3300053119 | Ga0500595_036354 | Ga0500595_036354_196_1017 | 272 |
| 179 | 3300053119 | Ga0500595_049162 | Ga0500595_049162_136_957 | 272 |
| 180 | 3300053177 | Ga0500636_0050848 | Ga0500636_0050848_281_1102 | 272 |
| 181 | iso_pu_bacteria | 2513237096 | 2513654332 | 272 |
| 182 | iso_pu_bacteria | 2513237145 | 2513915489 | 272 |
| 183 | iso_pu_bacteria | 2874604998 | 2874607695 | 272 |
| 184 | iso_pu_bacteria | 2876808645 | 2876809198 | 272 |
| 185 | iso_pu_bacteria | 2879110137 | 2879111387 | 272 |
| 186 | iso_pu_bacteria | 2885374607 | 2885381213 | 272 |
| 187 | iso_pu_bacteria | 2903748898 | 2903750514 | 272 |
| 188 | iso_pu_bacteria | 2904690495 | 2904696128 | 272 |
| 189 | iso_pu_bacteria | 2908756301 | 2908760762 | 272 |
| 190 | iso_pu_bacteria | 2935630451 | 2935633517 | 272 |
| 191 | iso_pu_bacteria | 2941507105 | 2941510408 | 272 |
| 192 | iso_pu_bacteria | 2941515067 | 2941517855 | 272 |
| 193 | iso_pu_bacteria | 2941523033 | 2941525871 | 272 |
| 194 | iso_pu_bacteria | 8006964411 | 8006969881 | 272 |
| 195 | 3300005355 | Ga0070671_100243837 | Ga0070671_1002438372 | 273 |
| 196 | 3300005445 | Ga0070708_100094520 | Ga0070708_1000945202 | 273 |
| 197 | 3300005455 | Ga0070663_100015998 | Ga0070663_1000159984 | 273 |
| 198 | 3300005468 | Ga0070707_100185051 | Ga0070707_1001850511 | 273 |
| 199 | 3300005471 | Ga0070698_100080639 | Ga0070698_1000806392 | 273 |
| 200 | 3300005536 | Ga0070697_100193268 | Ga0070697_1001932682 | 273 |
| 201 | 3300005536 | Ga0070697_100342773 | Ga0070697_1003427732 | 273 |
| 202 | 3300005548 | Ga0070665_100004313 | Ga0070665_10000431311 | 273 |
| 203 | 3300006048 | Ga0075363_100001412 | Ga0075363_1000014128 | 273 |
| 204 | 3300009176 | Ga0105242_10255886 | Ga0105242_102558862 | 273 |
| 205 | 3300014325 | Ga0163163_10856046 | Ga0163163_108560461 | 273 |
| 206 | 3300025904 | Ga0207647_10179385 | Ga0207647_101793851 | 273 |
| 207 | 3300025922 | Ga0207646_10043563 | Ga0207646_100435634 | 273 |
| 208 | 3300025931 | Ga0207644_10094289 | Ga0207644_100942893 | 273 |
| 209 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001816 | 273 |
| 210 | 3300035116 | Ga0373945_0016702 | Ga0373945_0016702_1186_2019 | 273 |
| 211 | 3300035691 | Ga0373931_0011628 | Ga0373931_0011628_2597_3445 | 273 |
| 212 | 3300039437 | Ga0436365_0099590 | Ga0436365_0099590_884_1726 | 273 |
| 213 | 3300046455 | Ga0495603_0153388 | Ga0495603_0153388_106_939 | 273 |
| 214 | 3300046531 | Ga0495665_0008224 | Ga0495665_0008224_4300_5133 | 273 |
| 215 | 3300046533 | Ga0495640_0092984 | Ga0495640_0092984_588_1421 | 273 |
| 216 | 3300046559 | Ga0495667_0128856 | Ga0495667_0128856_268_1101 | 273 |
| 217 | 3300046683 | Ga0495658_0013531 | Ga0495658_0013531_3257_4090 | 273 |
| 218 | 3300048909 | Ga0496106_0087695 | Ga0496106_0087695_660_1505 | 273 |
| 219 | 3300048909 | Ga0496106_0300228 | Ga0496106_0300228_403_1269 | 273 |
| 220 | 3300048915 | Ga0496112_0043944 | Ga0496112_0043944_806_1654 | 273 |
| 221 | 3300048916 | Ga0496113_0018679 | Ga0496113_0018679_1211_2059 | 273 |
| 222 | 3300048918 | Ga0496115_0141724 | Ga0496115_0141724_770_1651 | 273 |
| 223 | 3300048929 | Ga0496126_0076452 | Ga0496126_0076452_1519_2364 | 273 |
| 224 | 3300050490 | nmdc:mga03n38_404_c1 | nmdc:mga03n38_404_c1_4566_5447 | 273 |
| 225 | 3300005339 | Ga0070660_100147482 | Ga0070660_1001474823 | 274 |
| 226 | 3300005577 | Ga0068857_100023817 | Ga0068857_1000238173 | 274 |
| 227 | 3300005834 | Ga0068851_10032947 | Ga0068851_100329473 | 274 |
| 228 | 3300005981 | Ga0081538_10039451 | Ga0081538_100394512 | 274 |
| 229 | 3300007265 | Ga0099794_10037379 | Ga0099794_100373792 | 274 |
| 230 | 3300007788 | Ga0099795_10020558 | Ga0099795_100205583 | 274 |
| 231 | 3300009545 | Ga0105237_10165195 | Ga0105237_101651952 | 274 |
| 232 | 3300009551 | Ga0105238_10017869 | Ga0105238_100178692 | 274 |
| 233 | 3300013105 | Ga0157369_10056151 | Ga0157369_100561515 | 274 |
| 234 | 3300025321 | Ga0207656_10021355 | Ga0207656_100213551 | 274 |
| 235 | 3300025912 | Ga0207707_10020556 | Ga0207707_100205565 | 274 |
| 236 | 3300025919 | Ga0207657_10002034 | Ga0207657_1000203412 | 274 |
| 237 | 3300025926 | Ga0207659_10261007 | Ga0207659_102610072 | 274 |
| 238 | 3300026116 | Ga0207674_10035459 | Ga0207674_100354592 | 274 |
| 239 | 3300028786 | Ga0307517_10179636 | Ga0307517_101796362 | 274 |
| 240 | 3300031731 | Ga0307405_10250459 | Ga0307405_102504592 | 274 |
| 241 | 3300031911 | Ga0307412_10070989 | Ga0307412_100709892 | 274 |
| 242 | 3300031995 | Ga0307409_100224376 | Ga0307409_1002243762 | 274 |
| 243 | 3300035111 | Ga0373923_0006867 | Ga0373923_0006867_949_1812 | 274 |
| 244 | 3300035117 | Ga0373953_0000126 | Ga0373953_0000126_12743_13606 | 274 |
| 245 | 3300035118 | Ga0373954_0001515 | Ga0373954_0001515_7646_8509 | 274 |
| 246 | 3300035119 | Ga0373956_0000764 | Ga0373956_0000764_8419_9282 | 274 |
| 247 | 3300035120 | Ga0373957_0000307 | Ga0373957_0000307_5893_6756 | 274 |
| 248 | 3300035172 | Ga0373955_0001379 | Ga0373955_0001379_5070_5933 | 274 |
| 249 | 3300035410 | Ga0373924_0000464 | Ga0373924_0000464_3434_4297 | 274 |
| 250 | 3300035724 | Ga0373933_0000600 | Ga0373933_0000600_6567_7430 | 274 |
| 251 | 3300036401 | Ga0373937_0005936 | Ga0373937_0005936_4513_5376 | 274 |
| 252 | 3300046454 | Ga0495592_0000570 | Ga0495592_0000570_13259_14122 | 274 |
| 253 | 3300046459 | Ga0495629_0010704 | Ga0495629_0010704_5135_5998 | 274 |
| 254 | 3300046459 | Ga0495629_0143163 | Ga0495629_0143163_314_1162 | 274 |
| 255 | 3300046462 | Ga0495651_0007469 | Ga0495651_0007469_6567_7430 | 274 |
| 256 | 3300046463 | Ga0495653_0002759 | Ga0495653_0002759_9561_10424 | 274 |
| 257 | 3300046511 | Ga0495608_0003962 | Ga0495608_0003962_3715_4578 | 274 |
| 258 | 3300046529 | Ga0495652_0003587 | Ga0495652_0003587_9227_10090 | 274 |
| 259 | 3300046533 | Ga0495640_0007192 | Ga0495640_0007192_547_1410 | 274 |
| 260 | 3300046536 | Ga0495587_0002145 | Ga0495587_0002145_7354_8217 | 274 |
| 261 | 3300046559 | Ga0495667_0000747 | Ga0495667_0000747_11448_12311 | 274 |
| 262 | 3300046642 | Ga0495634_0014453 | Ga0495634_0014453_3523_4386 | 274 |
| 263 | 3300046648 | Ga0495611_0152023 | Ga0495611_0152023_109_972 | 274 |
| 264 | 3300046663 | Ga0495635_0000532 | Ga0495635_0000532_9171_10034 | 274 |
| 265 | 3300046675 | Ga0495657_0002564 | Ga0495657_0002564_9370_10233 | 274 |
| 266 | 3300046678 | Ga0495599_0000394 | Ga0495599_0000394_11055_11918 | 274 |
| 267 | 3300046679 | Ga0495623_0003632 | Ga0495623_0003632_4818_5681 | 274 |
| 268 | 3300046680 | Ga0495646_0000916 | Ga0495646_0000916_698_1561 | 274 |
| 269 | 3300046689 | Ga0495613_0237072 | Ga0495613_0237072_247_1110 | 274 |
| 270 | 3300046809 | Ga0495600_0002273 | Ga0495600_0002273_5268_6131 | 274 |
| 271 | 3300047317 | Ga0495604_0002072 | Ga0495604_0002072_1056_1919 | 274 |
| 272 | 3300047322 | Ga0495680_0003634 | Ga0495680_0003634_3714_4577 | 274 |
| 273 | 3300047444 | Ga0495675_0001271 | Ga0495675_0001271_9433_10296 | 274 |
| 274 | 3300047469 | Ga0495673_0013049 | Ga0495673_0013049_128_991 | 274 |
| 275 | 3300047471 | Ga0495684_0001102 | Ga0495684_0001102_9433_10296 | 274 |
| 276 | 3300047673 | Ga0495593_0000928 | Ga0495593_0000928_10256_11119 | 274 |
| 277 | 3300048088 | Ga0495602_0003533 | Ga0495602_0003533_5135_5998 | 274 |
| 278 | 3300053078 | Ga0495612_0014656 | Ga0495612_0014656_1872_2735 | 274 |
| 279 | 3300053084 | Ga0495595_0000293 | Ga0495595_0000293_4397_5260 | 274 |
| 280 | 3300053085 | Ga0495619_0001314 | Ga0495619_0001314_5894_6757 | 274 |
| 281 | 3300053119 | Ga0500595_003000 | Ga0500595_003000_2927_3796 | 274 |
| 282 | iso_pu_bacteria | 2876761206 | 2876767274 | 274 |
| 283 | 3300005344 | Ga0070661_100094072 | Ga0070661_1000940722 | 275 |
| 284 | 3300005347 | Ga0070668_100199468 | Ga0070668_1001994682 | 275 |
| 285 | 3300005441 | Ga0070700_100097806 | Ga0070700_1000978062 | 275 |
| 286 | 3300005455 | Ga0070663_100131673 | Ga0070663_1001316732 | 275 |
| 287 | 3300005456 | Ga0070678_100130509 | Ga0070678_1001305091 | 275 |
| 288 | 3300005539 | Ga0068853_100114548 | Ga0068853_1001145482 | 275 |
| 289 | 3300005547 | Ga0070693_100088521 | Ga0070693_1000885212 | 275 |
| 290 | 3300005548 | Ga0070665_100124907 | Ga0070665_1001249073 | 275 |
| 291 | 3300005719 | Ga0068861_100046486 | Ga0068861_1000464861 | 275 |
| 292 | 3300005844 | Ga0068862_100234642 | Ga0068862_1002346421 | 275 |
| 293 | 3300005937 | Ga0081455_10005203 | Ga0081455_100052036 | 275 |
| 294 | 3300006048 | Ga0075363_100019080 | Ga0075363_1000190805 | 275 |
| 295 | 3300006178 | Ga0075367_10088592 | Ga0075367_100885922 | 275 |
| 296 | 3300006178 | Ga0075367_10131859 | Ga0075367_101318592 | 275 |
| 297 | 3300011119 | Ga0105246_10076971 | Ga0105246_100769712 | 275 |
| 298 | 3300013296 | Ga0157374_10747895 | Ga0157374_107478951 | 275 |
| 299 | 3300014326 | Ga0157380_10300135 | Ga0157380_103001351 | 275 |
| 300 | 3300017792 | Ga0163161_10198250 | Ga0163161_101982502 | 275 |
| 301 | 3300025901 | Ga0207688_10082310 | Ga0207688_100823102 | 275 |
| 302 | 3300025920 | Ga0207649_10133343 | Ga0207649_101333432 | 275 |
| 303 | 3300025972 | Ga0207668_10038403 | Ga0207668_100384032 | 275 |
| 304 | 3300026041 | Ga0207639_10152382 | Ga0207639_101523822 | 275 |
| 305 | 3300026067 | Ga0207678_10130471 | Ga0207678_101304712 | 275 |
| 306 | 3300026121 | Ga0207683_10107605 | Ga0207683_101076052 | 275 |
| 307 | 3300026121 | Ga0207683_10216984 | Ga0207683_102169842 | 275 |
| 308 | 3300028380 | Ga0268265_10023170 | Ga0268265_100231702 | 275 |
| 309 | 3300028380 | Ga0268265_10434822 | Ga0268265_104348222 | 275 |
| 310 | 3300031507 | Ga0307509_10047750 | Ga0307509_100477502 | 275 |
| 311 | 3300032126 | Ga0307415_100222487 | Ga0307415_1002224872 | 275 |
| 312 | 3300032126 | Ga0307415_100476956 | Ga0307415_1004769561 | 275 |
| 313 | 3300033180 | Ga0307510_10035900 | Ga0307510_100359006 | 275 |
| 314 | 3300046455 | Ga0495603_0066275 | Ga0495603_0066275_289_1137 | 275 |
| 315 | 3300046460 | Ga0495638_0107779 | Ga0495638_0107779_114_968 | 275 |
| 316 | 3300046473 | Ga0495582_0029543 | Ga0495582_0029543_894_1742 | 275 |
| 317 | 3300046475 | Ga0495639_0021892 | Ga0495639_0021892_1687_2535 | 275 |
| 318 | 3300046492 | Ga0495585_0123647 | Ga0495585_0123647_356_1210 | 275 |
| 319 | 3300046499 | Ga0495594_0059608 | Ga0495594_0059608_622_1476 | 275 |
| 320 | 3300046648 | Ga0495611_0039668 | Ga0495611_0039668_905_1759 | 275 |
| 321 | 3300046660 | Ga0495625_0131353 | Ga0495625_0131353_690_1544 | 275 |
| 322 | 3300048904 | Ga0496101_0167634 | Ga0496101_0167634_630_1484 | 275 |
| 323 | 3300048905 | Ga0496102_0452001 | Ga0496102_0452001_320_1171 | 275 |
| 324 | 3300050492 | nmdc:mga0yw44_28610_c1 | nmdc:mga0yw44_28610_c1_1055_1903 | 275 |
| 325 | 3300050494 | nmdc:mga06z11_67227_c1 | nmdc:mga06z11_67227_c1_540_1391 | 275 |
| 326 | 3300050496 | nmdc:mga07m45_14532_c1 | nmdc:mga07m45_14532_c1_103_954 | 275 |
| 327 | 3300053087 | Ga0500643_053318 | Ga0500643_053318_43_897 | 275 |
| 328 | 3300053092 | Ga0500583_0003359 | Ga0500583_0003359_3770_4624 | 275 |
| 329 | 3300053094 | Ga0500566_0003149 | Ga0500566_0003149_3310_4194 | 275 |
| 330 | 3300053098 | Ga0500650_0033657 | Ga0500650_0033657_1033_1887 | 275 |
| 331 | 3300053119 | Ga0500595_000288 | Ga0500595_000288_14429_15313 | 275 |
| 332 | 3300053124 | Ga0500617_046234 | Ga0500617_046234_924_1778 | 275 |
| 333 | 3300053134 | Ga0500658_0108129 | Ga0500658_0108129_247_1101 | 275 |
| 334 | 3300053142 | Ga0500577_0021511 | Ga0500577_0021511_923_1777 | 275 |
| 335 | 3300053147 | Ga0500589_076429 | Ga0500589_076429_496_1350 | 275 |
| 336 | 3300053162 | Ga0500638_001439 | Ga0500638_001439_4380_5264 | 275 |
| 337 | 3300053731 | Ga0500609_006761 | Ga0500609_006761_589_1443 | 275 |
| 338 | 3300055283 | Ga0500661_000491 | Ga0500661_000491_1582_2466 | 275 |
| 339 | iso_pu_bacteria | 8006984368 | 8006993631 | 275 |
| 340 | 3300005327 | Ga0070658_10388924 | Ga0070658_103889242 | 276 |
| 341 | 3300005331 | Ga0070670_100162435 | Ga0070670_1001624352 | 276 |
| 342 | 3300005331 | Ga0070670_100254588 | Ga0070670_1002545882 | 276 |
| 343 | 3300005334 | Ga0068869_100002065 | Ga0068869_1000020659 | 276 |
| 344 | 3300005334 | Ga0068869_100194396 | Ga0068869_1001943961 | 276 |
| 345 | 3300005337 | Ga0070682_100145576 | Ga0070682_1001455761 | 276 |
| 346 | 3300005338 | Ga0068868_100036827 | Ga0068868_1000368272 | 276 |
| 347 | 3300005338 | Ga0068868_100237932 | Ga0068868_1002379321 | 276 |
| 348 | 3300005338 | Ga0068868_100349107 | Ga0068868_1003491072 | 276 |
| 349 | 3300005347 | Ga0070668_100056674 | Ga0070668_1000566743 | 276 |
| 350 | 3300005347 | Ga0070668_100095976 | Ga0070668_1000959762 | 276 |
| 351 | 3300005347 | Ga0070668_100238494 | Ga0070668_1002384941 | 276 |
| 352 | 3300005354 | Ga0070675_100168768 | Ga0070675_1001687682 | 276 |
| 353 | 3300005354 | Ga0070675_100383325 | Ga0070675_1003833251 | 276 |
| 354 | 3300005355 | Ga0070671_100279346 | Ga0070671_1002793461 | 276 |
| 355 | 3300005367 | Ga0070667_100140346 | Ga0070667_1001403462 | 276 |
| 356 | 3300005367 | Ga0070667_100758572 | Ga0070667_1007585721 | 276 |
| 357 | 3300005455 | Ga0070663_100072623 | Ga0070663_1000726232 | 276 |
| 358 | 3300005455 | Ga0070663_100077648 | Ga0070663_1000776482 | 276 |
| 359 | 3300005456 | Ga0070678_100100320 | Ga0070678_1001003201 | 276 |
| 360 | 3300005458 | Ga0070681_10102749 | Ga0070681_101027494 | 276 |
| 361 | 3300005466 | Ga0070685_10137362 | Ga0070685_101373622 | 276 |
| 362 | 3300005467 | Ga0070706_100428540 | Ga0070706_1004285401 | 276 |
| 363 | 3300005535 | Ga0070684_100024649 | Ga0070684_1000246494 | 276 |
| 364 | 3300005543 | Ga0070672_100081933 | Ga0070672_1000819332 | 276 |
| 365 | 3300005545 | Ga0070695_100047192 | Ga0070695_1000471923 | 276 |
| 366 | 3300005546 | Ga0070696_100125377 | Ga0070696_1001253771 | 276 |
| 367 | 3300005563 | Ga0068855_100035260 | Ga0068855_1000352604 | 276 |
| 368 | 3300005564 | Ga0070664_100523494 | Ga0070664_1005234941 | 276 |
| 369 | 3300005614 | Ga0068856_100362435 | Ga0068856_1003624352 | 276 |
| 370 | 3300005616 | Ga0068852_100011447 | Ga0068852_1000114477 | 276 |
| 371 | 3300005617 | Ga0068859_100079403 | Ga0068859_1000794032 | 276 |
| 372 | 3300005618 | Ga0068864_100013874 | Ga0068864_1000138746 | 276 |
| 373 | 3300005719 | Ga0068861_100191059 | Ga0068861_1001910591 | 276 |
| 374 | 3300005834 | Ga0068851_10028108 | Ga0068851_100281083 | 276 |
| 375 | 3300005842 | Ga0068858_100097300 | Ga0068858_1000973003 | 276 |
| 376 | 3300005937 | Ga0081455_10030942 | Ga0081455_100309426 | 276 |
| 377 | 3300005983 | Ga0081540_1003549 | Ga0081540_100354910 | 276 |
| 378 | 3300005983 | Ga0081540_1007097 | Ga0081540_10070976 | 276 |
| 379 | 3300005983 | Ga0081540_1026986 | Ga0081540_10269862 | 276 |
| 380 | 3300005983 | Ga0081540_1060702 | Ga0081540_10607022 | 276 |
| 381 | 3300006042 | Ga0075368_10062245 | Ga0075368_100622452 | 276 |
| 382 | 3300006175 | Ga0070712_100038403 | Ga0070712_1000384032 | 276 |
| 383 | 3300006931 | Ga0097620_100079394 | Ga0097620_1000793944 | 276 |
| 384 | 3300009092 | Ga0105250_10025085 | Ga0105250_100250853 | 276 |
| 385 | 3300009093 | Ga0105240_10481338 | Ga0105240_104813381 | 276 |
| 386 | 3300009098 | Ga0105245_10286520 | Ga0105245_102865202 | 276 |
| 387 | 3300009177 | Ga0105248_10056519 | Ga0105248_100565195 | 276 |
| 388 | 3300009177 | Ga0105248_10524493 | Ga0105248_105244932 | 276 |
| 389 | 3300009553 | Ga0105249_10073335 | Ga0105249_100733353 | 276 |
| 390 | 3300009553 | Ga0105249_10223691 | Ga0105249_102236912 | 276 |
| 391 | 3300010375 | Ga0105239_10019764 | Ga0105239_100197647 | 276 |
| 392 | 3300010375 | Ga0105239_10298329 | Ga0105239_102983292 | 276 |
| 393 | 3300011119 | Ga0105246_10021001 | Ga0105246_100210012 | 276 |
| 394 | 3300013296 | Ga0157374_10058735 | Ga0157374_100587354 | 276 |
| 395 | 3300013297 | Ga0157378_10116133 | Ga0157378_101161333 | 276 |
| 396 | 3300013306 | Ga0163162_10040728 | Ga0163162_100407284 | 276 |
| 397 | 3300013308 | Ga0157375_10001930 | Ga0157375_1000193012 | 276 |
| 398 | 3300014325 | Ga0163163_10006561 | Ga0163163_100065612 | 276 |
| 399 | 3300014325 | Ga0163163_10197113 | Ga0163163_101971131 | 276 |
| 400 | 3300014969 | Ga0157376_10034440 | Ga0157376_100344404 | 276 |
| 401 | 3300025901 | Ga0207688_10035768 | Ga0207688_100357682 | 276 |
| 402 | 3300025908 | Ga0207643_10199792 | Ga0207643_101997922 | 276 |
| 403 | 3300025914 | Ga0207671_10037370 | Ga0207671_100373702 | 276 |
| 404 | 3300025925 | Ga0207650_10259000 | Ga0207650_102590001 | 276 |
| 405 | 3300025927 | Ga0207687_10082133 | Ga0207687_100821333 | 276 |
| 406 | 3300025931 | Ga0207644_10246418 | Ga0207644_102464182 | 276 |
| 407 | 3300025933 | Ga0207706_10274625 | Ga0207706_102746253 | 276 |
| 408 | 3300025940 | Ga0207691_10141558 | Ga0207691_101415582 | 276 |
| 409 | 3300025941 | Ga0207711_10195490 | Ga0207711_101954901 | 276 |
| 410 | 3300025942 | Ga0207689_10003079 | Ga0207689_100030799 | 276 |
| 411 | 3300025942 | Ga0207689_10062579 | Ga0207689_100625791 | 276 |
| 412 | 3300025942 | Ga0207689_10116314 | Ga0207689_101163142 | 276 |
| 413 | 3300025945 | Ga0207679_10087024 | Ga0207679_100870243 | 276 |
| 414 | 3300025949 | Ga0207667_10054038 | Ga0207667_100540384 | 276 |
| 415 | 3300025961 | Ga0207712_10292450 | Ga0207712_102924502 | 276 |
| 416 | 3300025972 | Ga0207668_10019444 | Ga0207668_100194445 | 276 |
| 417 | 3300025972 | Ga0207668_10136577 | Ga0207668_101365772 | 276 |
| 418 | 3300026023 | Ga0207677_10020900 | Ga0207677_100209002 | 276 |
| 419 | 3300026023 | Ga0207677_10122180 | Ga0207677_101221802 | 276 |
| 420 | 3300026035 | Ga0207703_10020295 | Ga0207703_100202952 | 276 |
| 421 | 3300026041 | Ga0207639_10100797 | Ga0207639_101007973 | 276 |
| 422 | 3300026067 | Ga0207678_10053901 | Ga0207678_100539012 | 276 |
| 423 | 3300026067 | Ga0207678_10082789 | Ga0207678_100827893 | 276 |
| 424 | 3300026078 | Ga0207702_10241420 | Ga0207702_102414202 | 276 |
| 425 | 3300026088 | Ga0207641_10322560 | Ga0207641_103225601 | 276 |
| 426 | 3300026116 | Ga0207674_10390367 | Ga0207674_103903671 | 276 |
| 427 | 3300026118 | Ga0207675_100108022 | Ga0207675_1001080222 | 276 |
| 428 | 3300026121 | Ga0207683_10351507 | Ga0207683_103515072 | 276 |
| 429 | 3300026142 | Ga0207698_10372364 | Ga0207698_103723642 | 276 |
| 430 | 3300028379 | Ga0268266_10068671 | Ga0268266_100686714 | 276 |
| 431 | 3300028380 | Ga0268265_10138872 | Ga0268265_101388721 | 276 |
| 432 | 3300028786 | Ga0307517_10000053 | Ga0307517_10000053124 | 276 |
| 433 | 3300031730 | Ga0307516_10065794 | Ga0307516_100657944 | 276 |
| 434 | 3300031730 | Ga0307516_10173583 | Ga0307516_101735831 | 276 |
| 435 | 3300046462 | Ga0495651_0033637 | Ga0495651_0033637_2036_2893 | 276 |
| 436 | 3300046491 | Ga0495584_0090144 | Ga0495584_0090144_315_1175 | 276 |
| 437 | 3300046512 | Ga0495610_0032499 | Ga0495610_0032499_1111_1968 | 276 |
| 438 | 3300046616 | Ga0495668_0020113 | Ga0495668_0020113_2103_2960 | 276 |
| 439 | 3300046683 | Ga0495658_0281531 | Ga0495658_0281531_157_1014 | 276 |
| 440 | 3300046690 | Ga0495624_0059898 | Ga0495624_0059898_487_1338 | 276 |
| 441 | 3300047315 | Ga0495581_0099177 | Ga0495581_0099177_140_997 | 276 |
| 442 | 3300048903 | Ga0496100_0120661 | Ga0496100_0120661_587_1447 | 276 |
| 443 | 3300048904 | Ga0496101_0013133 | Ga0496101_0013133_3370_4230 | 276 |
| 444 | 3300048905 | Ga0496102_0010897 | Ga0496102_0010897_4307_5167 | 276 |
| 445 | 3300048905 | Ga0496102_0102868 | Ga0496102_0102868_1450_2310 | 276 |
| 446 | 3300048906 | Ga0496103_0017042 | Ga0496103_0017042_2086_2946 | 276 |
| 447 | 3300048908 | Ga0496105_0145316 | Ga0496105_0145316_973_1833 | 276 |
| 448 | 3300048909 | Ga0496106_0011464 | Ga0496106_0011464_3034_3894 | 276 |
| 449 | 3300048910 | Ga0496107_0007915 | Ga0496107_0007915_5509_6369 | 276 |
| 450 | 3300048910 | Ga0496107_0024824 | Ga0496107_0024824_3360_4217 | 276 |
| 451 | 3300048912 | Ga0496109_0115603 | Ga0496109_0115603_700_1560 | 276 |
| 452 | 3300048913 | Ga0496110_0066881 | Ga0496110_0066881_869_1729 | 276 |
| 453 | 3300048913 | Ga0496110_0233432 | Ga0496110_0233432_181_1038 | 276 |
| 454 | 3300048914 | Ga0496111_0032287 | Ga0496111_0032287_587_1447 | 276 |
| 455 | 3300048915 | Ga0496112_0182303 | Ga0496112_0182303_126_986 | 276 |
| 456 | 3300048916 | Ga0496113_0095767 | Ga0496113_0095767_942_1802 | 276 |
| 457 | 3300048918 | Ga0496115_0001003 | Ga0496115_0001003_9069_9929 | 276 |
| 458 | 3300048924 | Ga0496121_0039727 | Ga0496121_0039727_916_1773 | 276 |
| 459 | 3300048924 | Ga0496121_0221734 | Ga0496121_0221734_270_1127 | 276 |
| 460 | 3300048927 | Ga0496124_0065128 | Ga0496124_0065128_1151_2008 | 276 |
| 461 | 3300048929 | Ga0496126_0011403 | Ga0496126_0011403_6617_7474 | 276 |
| 462 | 3300048929 | Ga0496126_0151724 | Ga0496126_0151724_208_1065 | 276 |
| 463 | 3300048929 | Ga0496126_0318816 | Ga0496126_0318816_239_1096 | 276 |
| 464 | 3300050492 | nmdc:mga0yw44_235943_c1 | nmdc:mga0yw44_235943_c1_113_973 | 276 |
| 465 | 3300050494 | nmdc:mga06z11_18548_c1 | nmdc:mga06z11_18548_c1_1343_2200 | 276 |
| 466 | 3300053078 | Ga0495612_0064198 | Ga0495612_0064198_64_915 | 276 |
| 467 | 3300053084 | Ga0495595_0014681 | Ga0495595_0014681_2171_3031 | 276 |
| 468 | 3300053085 | Ga0495619_0058817 | Ga0495619_0058817_286_1146 | 276 |
| 469 | 3300053133 | Ga0500655_007870 | Ga0500655_007870_164_1021 | 276 |
| 470 | 3300053139 | Ga0500568_0048354 | Ga0500568_0048354_257_1114 | 276 |
| 471 | 3300053148 | Ga0500590_055846 | Ga0500590_055846_934_1791 | 276 |
| 472 | 3300053156 | Ga0500622_0165086 | Ga0500622_0165086_58_915 | 276 |
| 473 | 3300053158 | Ga0500627_0065903 | Ga0500627_0065903_95_952 | 276 |
| 474 | 3300039450 | Ga0436363_0992782 | Ga0436363_0992782_1648_2520 | 277 |
| 475 | 3300031241 | Ga0265325_10011639 | Ga0265325_100116391 | 278 |
| 476 | 3300031250 | Ga0265331_10049041 | Ga0265331_100490411 | 278 |
| 477 | 3300048915 | Ga0496112_0000009 | Ga0496112_0000009_278728_279570 | 278 |
| 478 | 3300048929 | Ga0496126_0150791 | Ga0496126_0150791_590_1447 | 278 |
| 479 | 3300005336 | Ga0070680_100268953 | Ga0070680_1002689531 | 279 |
| 480 | 3300005434 | Ga0070709_10001494 | Ga0070709_100014945 | 279 |
| 481 | 3300005435 | Ga0070714_100045796 | Ga0070714_1000457962 | 279 |
| 482 | 3300005436 | Ga0070713_100073511 | Ga0070713_1000735112 | 279 |
| 483 | 3300005437 | Ga0070710_10004580 | Ga0070710_100045805 | 279 |
| 484 | 3300005439 | Ga0070711_100002728 | Ga0070711_1000027289 | 279 |
| 485 | 3300005530 | Ga0070679_100061142 | Ga0070679_1000611422 | 279 |
| 486 | 3300005548 | Ga0070665_100252628 | Ga0070665_1002526282 | 279 |
| 487 | 3300006173 | Ga0070716_100023154 | Ga0070716_1000231543 | 279 |
| 488 | 3300006237 | Ga0097621_100255795 | Ga0097621_1002557952 | 279 |
| 489 | 3300013104 | Ga0157370_10016953 | Ga0157370_100169536 | 279 |
| 490 | 3300013297 | Ga0157378_10004686 | Ga0157378_100046862 | 279 |
| 491 | 3300025898 | Ga0207692_10011257 | Ga0207692_100112574 | 279 |
| 492 | 3300025905 | Ga0207685_10054345 | Ga0207685_100543452 | 279 |
| 493 | 3300025906 | Ga0207699_10000906 | Ga0207699_1000090610 | 279 |
| 494 | 3300025915 | Ga0207693_10018775 | Ga0207693_100187754 | 279 |
| 495 | 3300025915 | Ga0207693_10084372 | Ga0207693_100843722 | 279 |
| 496 | 3300025916 | Ga0207663_10001422 | Ga0207663_100014227 | 279 |
| 497 | 3300025917 | Ga0207660_10074991 | Ga0207660_100749912 | 279 |
| 498 | 3300025921 | Ga0207652_10029677 | Ga0207652_100296772 | 279 |
| 499 | 3300025929 | Ga0207664_10401548 | Ga0207664_104015482 | 279 |
| 500 | 3300025949 | Ga0207667_10219625 | Ga0207667_102196252 | 279 |
| 501 | 3300046507 | Ga0495606_0002525 | Ga0495606_0002525_1555_2400 | 279 |
| 502 | 3300046660 | Ga0495625_0144357 | Ga0495625_0144357_244_1125 | 279 |
| 503 | 3300046664 | Ga0495659_0056652 | Ga0495659_0056652_61_936 | 279 |
| 504 | 3300048924 | Ga0496121_0102812 | Ga0496121_0102812_51_905 | 279 |
| 505 | 3300003203 | JGI25406J46586_10000004 | JGI25406J46586_1000000461 | 282 |
| 506 | 3300005985 | Ga0081539_10000080 | Ga0081539_1000008066 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b6x-assembly2.cif.gz_B | crystal structure of in planta processed avrrps4 | 0.9573 | 175 | 217 |
| 6j22-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.8567 | 155 | 232 |
| 6j2l-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.853 | 155 | 232 |
| 7mu5-assembly1.cif.gz_G | human dctpp1 bound to triptolide | 0.8487 | 152 | 237 |
| 7yh5-assembly1.cif.gz_A | mazg(mycobacterium tuberculosis) | 0.8467 | 1 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z0jB00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9788 | 175 | 220 | 4.10.860.20 |
| 3craB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9578 | 7 | 95 | 1.10.287.1080 |
| 4b6xB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9573 | 175 | 217 | 1.20.58.90 |
| 3crcA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9524 | 7 | 100 | 1.10.287.1080 |
| 3crcB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9469 | 7 | 97 | 1.10.287.1080 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1T1G4-F1-model_v4 | NTP pyrophosphohydrolase MazG-like domain-containing protein | 0.9924 | 158 | 270 |
GO:0006203
GO:0046047 GO:0046052 GO:0046061 GO:0046076 GO:0046081 GO:0047429 |
| AF-A0A1L6TAN5-F1-model_v4 | Phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) | 0.9887 | 143 | 270 |
GO:0006203
GO:0046047 GO:0046052 GO:0046061 GO:0046076 GO:0046081 GO:0047429 |
| AF-A0A351HUZ9-F1-model_v4 | NTP pyrophosphohydrolase MazG-like domain-containing protein | 0.9874 | 153 | 269 |
GO:0006203
GO:0046047 GO:0046052 GO:0046061 GO:0046076 GO:0046081 GO:0047429 |
| AF-A0A6L8FBM2-F1-model_v4 | deleted | 0.9828 | 143 | 271 |
|
| AF-A0A382TZF4-F1-model_v4 | NTP pyrophosphohydrolase MazG-like domain-containing protein | 0.9824 | 159 | 271 |
GO:0006203
GO:0046047 GO:0046052 GO:0046061 GO:0046076 GO:0046081 GO:0047429 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar