F456573

General Info

Members Datasets Scaffolds Average Seq Length
506 328 473 279

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0144357|Ga0495625_0144357_244_1125
Length 293
Sequence MTPSRDISRLLEIMAALRTPVTGCPWDLEQDFATIAPYTIEEAYEVVDAITRGDLDDLREELGDLLLQVVFHARMAEEQSIFAFGDVVEAITRKMIRRHPHVFVDSDGQLTPGHVKENWDRIKAEEKAERAARRPPEPAGPKSLLSSVKAGQPALTRAMELQRKASTVGFDWNDPRAVLHKIREEADEIEAALDKGDAEELASETGDLLFALVNLARHVGADPEAALRGTNAKFERRFAYIERALAAKGRSLDDASLTEMDALWNEAKGAERLPLSSRPSEARAGTHTAESRD

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
7 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
8 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
9 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
10 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
14 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
15 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
16 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
17 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
18 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
19 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
20 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
21 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
22 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
304 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
305 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
306 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
307 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
311 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
312 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
313 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
314 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
315 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
316 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
317 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
318 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
319 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
320 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
321 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
322 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
323 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
324 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
325 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
326 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
327 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
328 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 0.2
Isolates 5.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 5.34
Rhizoplane 6.52
Rhizosphere 67.19
Stem 0
Stem Tuber 0
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000004 3300003203 Bacteria 149772
2 JGI25406J46586_10008390 3300003203 Bacteria 4681
3 JGI25153J46596_10000456 3300003215 Bacteria 26118
4 rootH2_10118023 3300003320 Bacteria 1267
5 Ga0070658_10000865 3300005327 Bacteria 25891
6 Ga0070658_10388924 3300005327 Bacteria 1197
7 Ga0070670_100162435 3300005331 Bacteria 1936
8 Ga0070670_100254588 3300005331 Bacteria 1530
9 Ga0068869_100002065 3300005334 Bacteria 12072
10 Ga0068869_100194396 3300005334 Bacteria 1597
11 Ga0070680_100001697 3300005336 Bacteria 16156
12 Ga0070680_100268953 3300005336 Bacteria 1443
13 Ga0070682_100145576 3300005337 Bacteria 1620
14 Ga0068868_100036827 3300005338 Bacteria 3790
15 Ga0068868_100237932 3300005338 Bacteria 1529
16 Ga0068868_100349107 3300005338 Bacteria 1267
17 Ga0070660_100147482 3300005339 Bacteria 1890
18 Ga0070661_100094072 3300005344 Bacteria 2221
19 Ga0070668_100056674 3300005347 Bacteria 3027
20 Ga0070668_100095976 3300005347 Bacteria 2343
21 Ga0070668_100199468 3300005347 Bacteria 1642
22 Ga0070668_100238494 3300005347 Bacteria 1505
23 Ga0070675_100168768 3300005354 Bacteria 1886
24 Ga0070675_100383325 3300005354 Bacteria 1252
25 Ga0070671_100243837 3300005355 Bacteria 1526
26 Ga0070671_100279346 3300005355 Bacteria 1420
27 Ga0070667_100140346 3300005367 Bacteria 2116
28 Ga0070667_100758572 3300005367 Bacteria 900
29 Ga0070709_10001494 3300005434 Bacteria 12636
30 Ga0070714_100045796 3300005435 Bacteria 3708
31 Ga0070714_100096393 3300005435 Bacteria 2599
32 Ga0070714_100621081 3300005435 Bacteria 1039
33 Ga0070713_100026202 3300005436 Bacteria 4573
34 Ga0070713_100073511 3300005436 Bacteria 2894
35 Ga0070713_100074349 3300005436 Bacteria 2879
36 Ga0070710_10004580 3300005437 Bacteria 6532
37 Ga0070711_100002728 3300005439 Bacteria 10127
38 Ga0070700_100097806 3300005441 Bacteria 1928
39 Ga0070708_100094520 3300005445 Bacteria 2727
40 Ga0070663_100015998 3300005455 Bacteria 4857
41 Ga0070663_100072623 3300005455 Bacteria 2507
42 Ga0070663_100077648 3300005455 Bacteria 2431
43 Ga0070663_100131673 3300005455 Bacteria 1900
44 Ga0070678_100100320 3300005456 Bacteria 2242
45 Ga0070678_100130509 3300005456 Bacteria 1996
46 Ga0070681_10010423 3300005458 Bacteria 9181
47 Ga0070681_10102749 3300005458 Bacteria 2803
48 Ga0070685_10137362 3300005466 Bacteria 1535
49 Ga0070706_100428540 3300005467 Bacteria 1231
50 Ga0070707_100185051 3300005468 Bacteria 2031
51 Ga0070698_100080639 3300005471 Bacteria 3249
52 Ga0070679_100029107 3300005530 Bacteria 5448
53 Ga0070679_100061142 3300005530 Bacteria 3754
54 Ga0070684_100024649 3300005535 Bacteria 5048
55 Ga0070697_100193268 3300005536 Bacteria 1728
56 Ga0070697_100342773 3300005536 Bacteria 1290
57 Ga0068853_100016363 3300005539 Bacteria 6102
58 Ga0068853_100114548 3300005539 Bacteria 2398
59 Ga0068853_100400422 3300005539 Bacteria 1285
60 Ga0070672_100081933 3300005543 Bacteria 2588
61 Ga0070695_100047192 3300005545 Bacteria 2750
62 Ga0070696_100125377 3300005546 Bacteria 1863
63 Ga0070693_100088521 3300005547 Bacteria 1862
64 Ga0070693_100470437 3300005547 Bacteria 886
65 Ga0070665_100004313 3300005548 Bacteria 14949
66 Ga0070665_100124907 3300005548 Bacteria 2575
67 Ga0070665_100252628 3300005548 Bacteria 1764
68 Ga0068855_100014843 3300005563 Bacteria 9380
69 Ga0068855_100035260 3300005563 Bacteria 5959
70 Ga0070664_100523494 3300005564 Bacteria 1095
71 Ga0068857_100023817 3300005577 Bacteria 5389
72 Ga0068856_100362435 3300005614 Bacteria 1468
73 Ga0068852_100011447 3300005616 Bacteria 6679
74 Ga0068859_100079403 3300005617 Bacteria 3321
75 Ga0068864_100013874 3300005618 Bacteria 6679
76 Ga0068861_100046486 3300005719 Bacteria 3272
77 Ga0068861_100191059 3300005719 Bacteria 1712
78 Ga0068851_10028108 3300005834 Bacteria 2776
79 Ga0068851_10032947 3300005834 Bacteria 2580
80 Ga0068858_100097300 3300005842 Bacteria 2744
81 Ga0068858_100297711 3300005842 Bacteria 1539
82 Ga0068860_100001218 3300005843 Bacteria 28032
83 Ga0068862_100234642 3300005844 Bacteria 1665
84 Ga0081455_10005203 3300005937 Bacteria 14313
85 Ga0081455_10030942 3300005937 Bacteria 4852
86 Ga0081455_10080828 3300005937 Bacteria 2664
87 Ga0081538_10039451 3300005981 Bacteria 3029
88 Ga0081540_1003549 3300005983 Bacteria 12287
89 Ga0081540_1007097 3300005983 Bacteria 8048
90 Ga0081540_1009779 3300005983 Bacteria 6565
91 Ga0081540_1026986 3300005983 Bacteria 3265
92 Ga0081540_1060702 3300005983 Bacteria 1807
93 Ga0081539_10000080 3300005985 Bacteria 222745
94 Ga0081539_10000152 3300005985 Bacteria 160005
95 Ga0070717_10036472 3300006028 Bacteria 3987
96 Ga0070717_10154036 3300006028 Bacteria 1990
97 Ga0075368_10062245 3300006042 Bacteria 1495
98 Ga0075363_100001412 3300006048 Bacteria 9091
99 Ga0075363_100019080 3300006048 Bacteria 3424
100 Ga0070716_100023154 3300006173 Bacteria 3290
101 Ga0070712_100038403 3300006175 Bacteria 3271
102 Ga0070712_100071732 3300006175 Bacteria 2479
103 Ga0075362_10007055 3300006177 Bacteria 4224
104 Ga0075367_10088592 3300006178 Bacteria 1881
105 Ga0075367_10131859 3300006178 Bacteria 1545
106 Ga0075366_10004404 3300006195 Bacteria 7559
107 Ga0097621_100255795 3300006237 Bacteria 1535
108 Ga0075428_100020956 3300006844 Bacteria 7240
109 Ga0075434_100008357 3300006871 Bacteria 9621
110 Ga0075429_100147942 3300006880 Bacteria 2056
111 Ga0097620_100079394 3300006931 Bacteria 3321
112 Ga0099822_1000949 3300006943 Bacteria 31391
113 Ga0099794_10037379 3300007265 Bacteria 2298
114 Ga0099795_10020558 3300007788 Bacteria 2153
115 Ga0099795_10044484 3300007788 Bacteria 1593
116 Ga0105250_10025085 3300009092 Bacteria 2403
117 Ga0105240_10038548 3300009093 Bacteria 6129
118 Ga0105240_10481338 3300009093 Bacteria 1384
119 Ga0105240_10636707 3300009093 Bacteria 1170
120 Ga0105245_10286520 3300009098 Bacteria 1612
121 Ga0105247_10009126 3300009101 Bacteria 6036
122 Ga0105242_10255886 3300009176 Bacteria 1580
123 Ga0105248_10056519 3300009177 Bacteria 4403
124 Ga0105248_10524493 3300009177 Bacteria 1336
125 Ga0105237_10071162 3300009545 Bacteria 3473
126 Ga0105237_10165195 3300009545 Bacteria 2212
127 Ga0105237_10203945 3300009545 Bacteria 1978
128 Ga0105238_10017869 3300009551 Bacteria 7210
129 Ga0105238_10193143 3300009551 Bacteria 2011
130 Ga0105249_10073335 3300009553 Bacteria 3167
131 Ga0105249_10223691 3300009553 Bacteria 1853
132 Ga0105239_10019764 3300010375 Bacteria 7434
133 Ga0105239_10187365 3300010375 Bacteria 2316
134 Ga0105239_10298329 3300010375 Bacteria 1815
135 Ga0105239_10469549 3300010375 Bacteria 1429
136 Ga0105246_10021001 3300011119 Bacteria 4195
137 Ga0105246_10076971 3300011119 Bacteria 2365
138 Ga0157370_10016953 3300013104 Bacteria 7364
139 Ga0157369_10056151 3300013105 Bacteria 4249
140 Ga0157374_10058735 3300013296 Bacteria 3595
141 Ga0157374_10747895 3300013296 Bacteria 992
142 Ga0157378_10004686 3300013297 Bacteria 12000
143 Ga0157378_10116133 3300013297 Bacteria 2460
144 Ga0163162_10040728 3300013306 Bacteria 4647
145 Ga0157375_10001930 3300013308 Bacteria 17844
146 Ga0163163_10006561 3300014325 Bacteria 10191
147 Ga0163163_10197113 3300014325 Bacteria 2062
148 Ga0163163_10856046 3300014325 Bacteria 972
149 Ga0157380_10300135 3300014326 Bacteria 1479
150 Ga0157376_10034440 3300014969 Bacteria 4089
151 Ga0163161_10198250 3300017792 Bacteria 1546
152 Ga0213876_10065897 3300021384 Bacteria 1912
153 Ga0213876_10198330 3300021384 Bacteria 1067
154 Ga0209233_1008324 3300025261 Bacteria 3218
155 Ga0209758_1005378 3300025297 Bacteria 9910
156 Ga0209758_1006141 3300025297 Bacteria 8801
157 Ga0207697_10093962 3300025315 Bacteria 1273
158 Ga0207656_10021355 3300025321 Bacteria 2586
159 Ga0207692_10011257 3300025898 Bacteria 3799
160 Ga0207710_10007229 3300025900 Bacteria 4707
161 Ga0207688_10035768 3300025901 Bacteria 2751
162 Ga0207688_10082310 3300025901 Bacteria 1839
163 Ga0207647_10179385 3300025904 Bacteria 1231
164 Ga0207685_10054345 3300025905 Bacteria 1559
165 Ga0207699_10000906 3300025906 Bacteria 14182
166 Ga0207643_10199792 3300025908 Bacteria 1217
167 Ga0207705_10009046 3300025909 Bacteria 7258
168 Ga0207707_10011429 3300025912 Bacteria 7734
169 Ga0207707_10020556 3300025912 Bacteria 5765
170 Ga0207695_10285736 3300025913 Bacteria 1543
171 Ga0207671_10023239 3300025914 Bacteria 4677
172 Ga0207671_10037370 3300025914 Bacteria 3601
173 Ga0207693_10018775 3300025915 Bacteria 5503
174 Ga0207693_10084372 3300025915 Bacteria 2489
175 Ga0207693_10089093 3300025915 Bacteria 2418
176 Ga0207663_10001422 3300025916 Bacteria 11119
177 Ga0207660_10004673 3300025917 Bacteria 8916
178 Ga0207660_10074991 3300025917 Bacteria 2470
179 Ga0207657_10002034 3300025919 Bacteria 21867
180 Ga0207649_10133343 3300025920 Bacteria 1690
181 Ga0207652_10006633 3300025921 Bacteria 9324
182 Ga0207652_10029677 3300025921 Bacteria 4575
183 Ga0207646_10043563 3300025922 Bacteria 4029
184 Ga0207650_10259000 3300025925 Bacteria 1410
185 Ga0207659_10261007 3300025926 Bacteria 1409
186 Ga0207687_10082133 3300025927 Bacteria 2331
187 Ga0207700_10030154 3300025928 Bacteria 3837
188 Ga0207700_10482885 3300025928 Bacteria 1095
189 Ga0207664_10401548 3300025929 Bacteria 1219
190 Ga0207644_10094289 3300025931 Bacteria 2236
191 Ga0207644_10246418 3300025931 Bacteria 1424
192 Ga0207690_10316048 3300025932 Bacteria 1226
193 Ga0207706_10274625 3300025933 Bacteria 1470
194 Ga0207691_10141558 3300025940 Bacteria 2119
195 Ga0207711_10195490 3300025941 Bacteria 1844
196 Ga0207689_10003079 3300025942 Bacteria 15347
197 Ga0207689_10062579 3300025942 Bacteria 3060
198 Ga0207689_10116314 3300025942 Bacteria 2198
199 Ga0207679_10087024 3300025945 Bacteria 2405
200 Ga0207667_10053925 3300025949 Bacteria 4230
201 Ga0207667_10054038 3300025949 Bacteria 4225
202 Ga0207667_10219625 3300025949 Bacteria 1947
203 Ga0207712_10292450 3300025961 Bacteria 1334
204 Ga0207668_10019444 3300025972 Bacteria 4294
205 Ga0207668_10038403 3300025972 Bacteria 3213
206 Ga0207668_10136577 3300025972 Bacteria 1879
207 Ga0207677_10020900 3300026023 Bacteria 3988
208 Ga0207677_10122180 3300026023 Bacteria 1961
209 Ga0207703_10020295 3300026035 Bacteria 5196
210 Ga0207639_10053795 3300026041 Bacteria 3073
211 Ga0207639_10100797 3300026041 Bacteria 2333
212 Ga0207639_10152382 3300026041 Bacteria 1938
213 Ga0207678_10053901 3300026067 Bacteria 3464
214 Ga0207678_10082789 3300026067 Bacteria 2745
215 Ga0207678_10130471 3300026067 Bacteria 2144
216 Ga0207702_10241420 3300026078 Bacteria 1693
217 Ga0207641_10322560 3300026088 Bacteria 1465
218 Ga0207674_10035459 3300026116 Bacteria 5206
219 Ga0207674_10390367 3300026116 Bacteria 1345
220 Ga0207675_100108022 3300026118 Bacteria 2624
221 Ga0207683_10107605 3300026121 Bacteria 2494
222 Ga0207683_10216984 3300026121 Bacteria 1742
223 Ga0207683_10351507 3300026121 Bacteria 1353
224 Ga0207698_10372364 3300026142 Bacteria 1356
225 Ga0209589_1000003 3300027357 Bacteria 629130
226 Ga0209489_100003 3300027361 Bacteria 663105
227 Ga0209700_100003 3300027363 Bacteria 663105
228 Ga0268266_10068671 3300028379 Bacteria 3069
229 Ga0268265_10023170 3300028380 Bacteria 4373
230 Ga0268265_10138872 3300028380 Bacteria 2031
231 Ga0268265_10434822 3300028380 Bacteria 1222
232 Ga0268264_10000043 3300028381 Bacteria 371761
233 Ga0307517_10000053 3300028786 Bacteria 155723
234 Ga0307517_10167604 3300028786 Bacteria 1454
235 Ga0307517_10179636 3300028786 Bacteria 1369
236 Ga0307515_10040676 3300028794 Bacteria 7342
237 Ga0307515_10116683 3300028794 Bacteria 3063
238 Ga0265760_10029820 3300031090 Bacteria 1605
239 Ga0265330_10009220 3300031235 Bacteria 4699
240 Ga0265325_10011639 3300031241 Bacteria 5053
241 Ga0265340_10003262 3300031247 Bacteria 9202
242 Ga0265339_10013815 3300031249 Bacteria 4886
243 Ga0265339_10016659 3300031249 Bacteria 4374
244 Ga0265331_10028279 3300031250 Bacteria 2805
245 Ga0265331_10049041 3300031250 Bacteria 2029
246 Ga0307509_10018344 3300031507 Bacteria 8023
247 Ga0307509_10047750 3300031507 Bacteria 4603
248 Ga0307509_10279788 3300031507 Bacteria 1430
249 Ga0265314_10028730 3300031711 Bacteria 4142
250 Ga0265342_10021476 3300031712 Bacteria 4120
251 Ga0307516_10065794 3300031730 Bacteria 3499
252 Ga0307516_10173583 3300031730 Bacteria 1894
253 Ga0307405_10250459 3300031731 Bacteria 1318
254 Ga0307406_10009560 3300031901 Bacteria 5444
255 Ga0307412_10070989 3300031911 Bacteria 2376
256 Ga0307409_100224376 3300031995 Bacteria 1698
257 Ga0307411_10465837 3300032005 Bacteria 1061
258 Ga0307415_100045721 3300032126 Bacteria 2937
259 Ga0307415_100205726 3300032126 Bacteria 1566
260 Ga0307415_100222487 3300032126 Bacteria 1514
261 Ga0307415_100476956 3300032126 Bacteria 1085
262 Ga0307507_10011020 3300033179 Bacteria 11505
263 Ga0307510_10035900 3300033180 Bacteria 5526
264 Ga0307510_10137815 3300033180 Bacteria 2093
265 Ga0315911_1000001 3300033442 Bacteria 1088602
266 Ga0373926_0096913 3300035083 Bacteria 1100
267 Ga0373923_0006867 3300035111 Bacteria 3963
268 Ga0373945_0016702 3300035116 Bacteria 2479
269 Ga0373953_0000126 3300035117 Bacteria 18697
270 Ga0373954_0001515 3300035118 Bacteria 9450
271 Ga0373956_0000764 3300035119 Bacteria 13305
272 Ga0373957_0000307 3300035120 Bacteria 12288
273 Ga0373946_0153536 3300035171 Bacteria 1076
274 Ga0373955_0001379 3300035172 Bacteria 10317
275 Ga0373924_0000464 3300035410 Bacteria 12448
276 Ga0373931_0011628 3300035691 Bacteria 4252
277 Ga0373935_0020505 3300035692 Bacteria 4040
278 Ga0373927_0019507 3300035695 Bacteria 4445
279 Ga0373927_0036007 3300035695 Bacteria 3219
280 Ga0373933_0000600 3300035724 Bacteria 22552
281 Ga0373933_0018828 3300035724 Bacteria 3889
282 Ga0373937_0005936 3300036401 Bacteria 10510
283 Ga0373925_0076375 3300037068 Bacteria 2540
284 Ga0373925_0335032 3300037068 Bacteria 1226
285 Ga0373925_0345544 3300037068 Bacteria 1207
286 Ga0395899_0009512 3300037312 Bacteria 7459
287 Ga0395900_0017087 3300037418 Bacteria 7406
288 Ga0395900_0694512 3300037418 Bacteria 951
289 Ga0395898_0008831 3300037466 Bacteria 10619
290 Ga0395905_0130231 3300037471 Bacteria 2366
291 Ga0395901_0012156 3300038443 Bacteria 8732
292 Ga0395901_0119536 3300038443 Bacteria 2769
293 Ga0395901_0133406 3300038443 Bacteria 2610
294 Ga0436365_0099590 3300039437 Bacteria 1813
295 Ga0436365_1392334 3300039437 Bacteria 3166
296 Ga0436365_1781966 3300039437 Bacteria 2693
297 Ga0436360_1372477 3300039438 Bacteria 1099
298 Ga0436363_0992782 3300039450 Bacteria 3750
299 Ga0436363_1275846 3300039450 Bacteria 2596
300 Ga0466961_0099042 3300044693 Bacteria 1838
301 Ga0466959_0117710 3300045049 Bacteria 1891
302 Ga0466959_0129267 3300045049 Bacteria 1791
303 Ga0466967_0047007 3300045976 Bacteria 3761
304 Ga0495592_0000570 3300046454 Bacteria 26078
305 Ga0495603_0035963 3300046455 Bacteria 2973
306 Ga0495603_0066275 3300046455 Bacteria 2126
307 Ga0495603_0105574 3300046455 Bacteria 1644
308 Ga0495603_0153388 3300046455 Bacteria 1337
309 Ga0495629_0010704 3300046459 Bacteria 6669
310 Ga0495629_0143163 3300046459 Bacteria 1663
311 Ga0495629_0165865 3300046459 Bacteria 1534
312 Ga0495638_0107779 3300046460 Bacteria 1658
313 Ga0495651_0007469 3300046462 Bacteria 8359
314 Ga0495651_0033637 3300046462 Bacteria 3998
315 Ga0495651_0113781 3300046462 Bacteria 1997
316 Ga0495653_0002759 3300046463 Bacteria 14010
317 Ga0495650_0128060 3300046471 Bacteria 929
318 Ga0495582_0029543 3300046473 Bacteria 3009
319 Ga0495639_0021892 3300046475 Bacteria 2801
320 Ga0495662_0112256 3300046476 Bacteria 1336
321 Ga0495584_0090144 3300046491 Bacteria 1546
322 Ga0495585_0123647 3300046492 Bacteria 1367
323 Ga0495594_0059608 3300046499 Bacteria 2111
324 Ga0495606_0002525 3300046507 Bacteria 21061
325 Ga0495608_0003962 3300046511 Bacteria 10635
326 Ga0495610_0032499 3300046512 Bacteria 2709
327 Ga0495628_0009664 3300046516 Bacteria 8230
328 Ga0495652_0003587 3300046529 Bacteria 15224
329 Ga0495665_0008224 3300046531 Bacteria 5657
330 Ga0495640_0007192 3300046533 Bacteria 8763
331 Ga0495640_0092984 3300046533 Bacteria 1988
332 Ga0495587_0002145 3300046536 Bacteria 13193
333 Ga0495645_0007470 3300046543 Bacteria 7608
334 Ga0495667_0000747 3300046559 Bacteria 20874
335 Ga0495667_0128856 3300046559 Bacteria 1632
336 Ga0495668_0020113 3300046616 Bacteria 3840
337 Ga0495668_0077926 3300046616 Bacteria 1820
338 Ga0495634_0014453 3300046642 Bacteria 5691
339 Ga0495611_0039668 3300046648 Bacteria 2097
340 Ga0495611_0152023 3300046648 Bacteria 1080
341 Ga0495625_0131353 3300046660 Bacteria 1696
342 Ga0495625_0144357 3300046660 Bacteria 1604
343 Ga0495635_0000532 3300046663 Bacteria 24183
344 Ga0495659_0056652 3300046664 Bacteria 1439
345 Ga0495657_0002564 3300046675 Bacteria 15242
346 Ga0495599_0000394 3300046678 Bacteria 24995
347 Ga0495623_0003632 3300046679 Bacteria 10193
348 Ga0495646_0000916 3300046680 Bacteria 16760
349 Ga0495647_0064056 3300046681 Bacteria 1457
350 Ga0495658_0013531 3300046683 Bacteria 4154
351 Ga0495658_0133036 3300046683 Bacteria 1515
352 Ga0495658_0281531 3300046683 Bacteria 1049
353 Ga0495669_0233056 3300046684 Bacteria 883
354 Ga0495613_0237072 3300046689 Bacteria 1276
355 Ga0495624_0059898 3300046690 Bacteria 2388
356 Ga0495600_0002273 3300046809 Bacteria 10948
357 Ga0495581_0099177 3300047315 Bacteria 1692
358 Ga0495604_0002072 3300047317 Bacteria 16184
359 Ga0495674_0519600 3300047319 Bacteria 951
360 Ga0495672_0010348 3300047320 Bacteria 6658
361 Ga0495672_0224030 3300047320 Bacteria 927
362 Ga0495680_0003634 3300047322 Bacteria 15066
363 Ga0495675_0001271 3300047444 Bacteria 15273
364 Ga0495673_0013049 3300047469 Bacteria 4378
365 Ga0495684_0001102 3300047471 Bacteria 21742
366 Ga0495593_0000928 3300047673 Bacteria 17048
367 Ga0495602_0003533 3300048088 Bacteria 16153
368 Ga0496100_0120661 3300048903 Bacteria 1833
369 Ga0496101_0013133 3300048904 Bacteria 5541
370 Ga0496101_0167634 3300048904 Bacteria 1687
371 Ga0496102_0010897 3300048905 Bacteria 7829
372 Ga0496102_0102868 3300048905 Bacteria 2656
373 Ga0496102_0234488 3300048905 Bacteria 1730
374 Ga0496102_0452001 3300048905 Bacteria 1205
375 Ga0496102_0494590 3300048905 Bacteria 1145
376 Ga0496103_0017042 3300048906 Bacteria 4343
377 Ga0496105_0145316 3300048908 Bacteria 1950
378 Ga0496106_0011464 3300048909 Bacteria 6556
379 Ga0496106_0087695 3300048909 Bacteria 2398
380 Ga0496106_0300228 3300048909 Bacteria 1288
381 Ga0496107_0007915 3300048910 Bacteria 7333
382 Ga0496107_0024824 3300048910 Bacteria 4242
383 Ga0496108_0203807 3300048911 Bacteria 1717
384 Ga0496109_0115603 3300048912 Bacteria 2496
385 Ga0496110_0066881 3300048913 Bacteria 3178
386 Ga0496110_0233432 3300048913 Bacteria 1673
387 Ga0496110_0266432 3300048913 Bacteria 1560
388 Ga0496111_0032287 3300048914 Bacteria 3732
389 Ga0496112_0000009 3300048915 Bacteria 299708
390 Ga0496112_0043944 3300048915 Bacteria 4375
391 Ga0496112_0182303 3300048915 Bacteria 2063
392 Ga0496112_0353279 3300048915 Bacteria 1412
393 Ga0496113_0018679 3300048916 Bacteria 4832
394 Ga0496113_0095767 3300048916 Bacteria 2294
395 Ga0496113_0338106 3300048916 Bacteria 1207
396 Ga0496114_0276989 3300048917 Bacteria 1479
397 Ga0496115_0001003 3300048918 Bacteria 20483
398 Ga0496115_0141724 3300048918 Bacteria 1983
399 Ga0496115_0248170 3300048918 Bacteria 1466
400 Ga0496115_0374119 3300048918 Bacteria 1159
401 Ga0496117_0025417 3300048920 Bacteria 4658
402 Ga0496117_0115449 3300048920 Bacteria 1662
403 Ga0496118_0002027 3300048921 Bacteria 28645
404 Ga0496118_0034981 3300048921 Bacteria 4088
405 Ga0496119_0062341 3300048922 Bacteria 2222
406 Ga0496121_0000110 3300048924 Bacteria 186482
407 Ga0496121_0001680 3300048924 Bacteria 36396
408 Ga0496121_0020161 3300048924 Bacteria 6619
409 Ga0496121_0039727 3300048924 Bacteria 4139
410 Ga0496121_0056087 3300048924 Bacteria 3276
411 Ga0496121_0090450 3300048924 Bacteria 2392
412 Ga0496121_0102812 3300048924 Bacteria 2200
413 Ga0496121_0221734 3300048924 Bacteria 1331
414 Ga0496121_0432299 3300048924 Bacteria 853
415 Ga0496124_0000378 3300048927 Bacteria 81220
416 Ga0496124_0065128 3300048927 Bacteria 3040
417 Ga0496126_0006083 3300048929 Bacteria 13538
418 Ga0496126_0011403 3300048929 Bacteria 9205
419 Ga0496126_0076452 3300048929 Bacteria 2970
420 Ga0496126_0150791 3300048929 Bacteria 1993
421 Ga0496126_0151724 3300048929 Bacteria 1985
422 Ga0496126_0166117 3300048929 Bacteria 1883
423 Ga0496126_0249943 3300048929 Bacteria 1478
424 Ga0496126_0318816 3300048929 Bacteria 1278
425 Ga0501069_0123716 3300049585 Bacteria 1478
426 nmdc:mga03n38_404_c1 3300050490 Bacteria 10692
427 nmdc:mga0yw44_235943_c1 3300050492 Bacteria 1215
428 nmdc:mga0yw44_28610_c1 3300050492 Bacteria 3208
429 nmdc:mga0yw44_2914_c1 3300050492 Bacteria 7443
430 nmdc:mga06z11_18548_c1 3300050494 Bacteria 3180
431 nmdc:mga06z11_67227_c1 3300050494 Bacteria 1886
432 nmdc:mga07m45_14532_c1 3300050496 Bacteria 2758
433 nmdc:mga05p37_42792_c1 3300050507 Bacteria 5567
434 nmdc:mga0qj67_22287_c1 3300050509 Unclassified 4865
435 nmdc:mga06r32_28441_c1 3300050510 Bacteria 5230
436 nmdc:mga0sz30_49731_c1 3300050516 Bacteria 1777
437 Ga0495612_0014656 3300053078 Bacteria 3150
438 Ga0495612_0064198 3300053078 Bacteria 1524
439 Ga0500635_0004771 3300053080 Bacteria 3510
440 Ga0495595_0000293 3300053084 Bacteria 19495
441 Ga0495595_0014681 3300053084 Bacteria 3327
442 Ga0495619_0001314 3300053085 Bacteria 16317
443 Ga0495619_0058817 3300053085 Bacteria 2553
444 Ga0500643_053318 3300053087 Bacteria 1150
445 Ga0500583_0003359 3300053092 Bacteria 5024
446 Ga0500651_0055899 3300053093 Bacteria 2471
447 Ga0500566_0003149 3300053094 Bacteria 9863
448 Ga0500566_0018579 3300053094 Bacteria 4081
449 Ga0500650_0033657 3300053098 Bacteria 2338
450 Ga0500594_0097751 3300053118 Bacteria 900
451 Ga0500595_000288 3300053119 Bacteria 33340
452 Ga0500595_000564 3300053119 Bacteria 22025
453 Ga0500595_003000 3300053119 Bacteria 8027
454 Ga0500595_013695 3300053119 Bacteria 3101
455 Ga0500595_036354 3300053119 Bacteria 1613
456 Ga0500595_049162 3300053119 Bacteria 1315
457 Ga0500617_046234 3300053124 Bacteria 1946
458 Ga0500655_007870 3300053133 Bacteria 1920
459 Ga0500658_0108129 3300053134 Bacteria 1221
460 Ga0500568_0048354 3300053139 Bacteria 1682
461 Ga0500573_0015494 3300053140 Bacteria 4322
462 Ga0500577_0021511 3300053142 Bacteria 2126
463 Ga0500589_076429 3300053147 Bacteria 1503
464 Ga0500590_055846 3300053148 Bacteria 1997
465 Ga0500622_0165086 3300053156 Bacteria 1035
466 Ga0500627_0065903 3300053158 Bacteria 1599
467 Ga0500638_001439 3300053162 Bacteria 7470
468 Ga0500639_112272 3300053163 Bacteria 1324
469 Ga0500636_0050848 3300053177 Bacteria 2437
470 Ga0500636_0171472 3300053177 Bacteria 1173
471 Ga0500609_006761 3300053731 Bacteria 1559
472 Ga0500596_001687 3300053735 Bacteria 4474
473 Ga0500661_000491 3300055283 Bacteria 7332

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100205726 Ga0307415_1002057262 221
2 3300003320 rootH2_10118023 rootH2_101180232 232
3 3300032126 Ga0307415_100045721 Ga0307415_1000457213 244
4 3300038443 Ga0395901_0119536 Ga0395901_0119536_972_1802 245
5 3300046516 Ga0495628_0009664 Ga0495628_0009664_902_1765 248
6 3300046543 Ga0495645_0007470 Ga0495645_0007470_4297_5160 248
7 3300021384 Ga0213876_10065897 Ga0213876_100658971 251
8 3300037418 Ga0395900_0694512 Ga0395900_0694512_108_938 251
9 3300039437 Ga0436365_1781966 Ga0436365_1781966_882_1718 251
10 3300039450 Ga0436363_1275846 Ga0436363_1275846_947_1783 251
11 3300046459 Ga0495629_0165865 Ga0495629_0165865_467_1282 252
12 3300025297 Ga0209758_1006141 Ga0209758_10061416 255
13 3300048929 Ga0496126_0166117 Ga0496126_0166117_630_1454 255
14 3300021384 Ga0213876_10198330 Ga0213876_101983302 256
15 3300039437 Ga0436365_1392334 Ga0436365_1392334_1591_2433 256
16 3300053177 Ga0500636_0171472 Ga0500636_0171472_13_792 256
17 3300005435 Ga0070714_100096393 Ga0070714_1000963932 258
18 3300005436 Ga0070713_100026202 Ga0070713_1000262022 258
19 3300028794 Ga0307515_10040676 Ga0307515_100406764 258
20 3300031249 Ga0265339_10016659 Ga0265339_100166593 258
21 3300031250 Ga0265331_10028279 Ga0265331_100282794 258
22 3300031711 Ga0265314_10028730 Ga0265314_100287306 258
23 3300031712 Ga0265342_10021476 Ga0265342_100214764 258
24 3300032005 Ga0307411_10465837 Ga0307411_104658371 258
25 3300045976 Ga0466967_0047007 Ga0466967_0047007_2521_3351 258
26 3300048924 Ga0496121_0090450 Ga0496121_0090450_762_1619 259
27 3300033180 Ga0307510_10137815 Ga0307510_101378152 261
28 3300006880 Ga0075429_100147942 Ga0075429_1001479422 262
29 3300028794 Ga0307515_10116683 Ga0307515_101166833 262
30 3300035695 Ga0373927_0019507 Ga0373927_0019507_3632_4420 262
31 3300050509 nmdc:mga0qj67_22287_c1 nmdc:mga0qj67_22287_c1_136_972 262
32 3300050510 nmdc:mga06r32_28441_c1 nmdc:mga06r32_28441_c1_826_1662 262
33 3300005327 Ga0070658_10000865 Ga0070658_1000086517 263
34 3300005336 Ga0070680_100001697 Ga0070680_1000016979 263
35 3300005458 Ga0070681_10010423 Ga0070681_100104232 263
36 3300005530 Ga0070679_100029107 Ga0070679_1000291076 263
37 3300005563 Ga0068855_100014843 Ga0068855_1000148439 263
38 3300009093 Ga0105240_10038548 Ga0105240_100385483 263
39 3300009545 Ga0105237_10071162 Ga0105237_100711624 263
40 3300009551 Ga0105238_10193143 Ga0105238_101931432 263
41 3300025909 Ga0207705_10009046 Ga0207705_100090467 263
42 3300025912 Ga0207707_10011429 Ga0207707_100114293 263
43 3300025913 Ga0207695_10285736 Ga0207695_102857362 263
44 3300025914 Ga0207671_10023239 Ga0207671_100232393 263
45 3300025917 Ga0207660_10004673 Ga0207660_100046739 263
46 3300025921 Ga0207652_10006633 Ga0207652_100066339 263
47 3300025949 Ga0207667_10053925 Ga0207667_100539252 263
48 3300031090 Ga0265760_10029820 Ga0265760_100298202 263
49 3300031901 Ga0307406_10009560 Ga0307406_100095604 263
50 3300035083 Ga0373926_0096913 Ga0373926_0096913_77_910 263
51 3300035724 Ga0373933_0018828 Ga0373933_0018828_2635_3468 263
52 3300046471 Ga0495650_0128060 Ga0495650_0128060_24_842 263
53 3300046476 Ga0495662_0112256 Ga0495662_0112256_76_909 263
54 3300046681 Ga0495647_0064056 Ga0495647_0064056_421_1254 263
55 3300046684 Ga0495669_0233056 Ga0495669_0233056_38_856 263
56 3300048905 Ga0496102_0494590 Ga0496102_0494590_149_967 263
57 3300048915 Ga0496112_0353279 Ga0496112_0353279_36_857 263
58 3300048924 Ga0496121_0432299 Ga0496121_0432299_20_841 263
59 3300003215 JGI25153J46596_10000456 JGI25153J46596_1000045621 264
60 3300005842 Ga0068858_100297711 Ga0068858_1002977111 264
61 3300005843 Ga0068860_100001218 Ga0068860_10000121829 264
62 3300005937 Ga0081455_10080828 Ga0081455_100808282 264
63 3300006175 Ga0070712_100071732 Ga0070712_1000717322 264
64 3300009101 Ga0105247_10009126 Ga0105247_100091263 264
65 3300025297 Ga0209758_1005378 Ga0209758_10053786 264
66 3300025900 Ga0207710_10007229 Ga0207710_100072293 264
67 3300025915 Ga0207693_10089093 Ga0207693_100890932 264
68 3300028381 Ga0268264_10000043 Ga0268264_10000043310 264
69 3300046616 Ga0495668_0077926 Ga0495668_0077926_297_1157 264
70 3300048924 Ga0496121_0056087 Ga0496121_0056087_221_1039 264
71 3300049585 Ga0501069_0123716 Ga0501069_0123716_63_878 264
72 3300031249 Ga0265339_10013815 Ga0265339_100138154 265
73 3300044693 Ga0466961_0099042 Ga0466961_0099042_626_1432 265
74 3300045049 Ga0466959_0117710 Ga0466959_0117710_166_972 265
75 3300046455 Ga0495603_0105574 Ga0495603_0105574_585_1439 265
76 3300005435 Ga0070714_100621081 Ga0070714_1006210811 267
77 3300037068 Ga0373925_0345544 Ga0373925_0345544_116_979 267
78 iso_pu_bacteria 2524023228 2524541063 267
79 iso_pu_bacteria 2922425934 2922429866 267
80 iso_pu_bacteria 8006933436 8006940916 267
81 iso_pu_bacteria 8006973647 8006980891 267
82 iso_pu_bacteria 8019555841 8019557225 267
83 iso_pu_bacteria 8056673599 8056674179 267
84 3300003203 JGI25406J46586_10008390 JGI25406J46586_100083903 268
85 3300005983 Ga0081540_1009779 Ga0081540_10097793 268
86 3300005985 Ga0081539_10000152 Ga0081539_10000152163 268
87 3300006871 Ga0075434_100008357 Ga0075434_1000083575 269
88 3300009545 Ga0105237_10203945 Ga0105237_102039452 269
89 3300010375 Ga0105239_10187365 Ga0105239_101873652 269
90 3300031507 Ga0307509_10018344 Ga0307509_100183442 269
91 3300031507 Ga0307509_10279788 Ga0307509_102797882 269
92 3300033179 Ga0307507_10011020 Ga0307507_1001102013 269
93 3300035692 Ga0373935_0020505 Ga0373935_0020505_2489_3307 269
94 3300035695 Ga0373927_0036007 Ga0373927_0036007_641_1459 269
95 3300037068 Ga0373925_0335032 Ga0373925_0335032_196_1014 269
96 3300037312 Ga0395899_0009512 Ga0395899_0009512_2852_3670 269
97 3300037418 Ga0395900_0017087 Ga0395900_0017087_1839_2657 269
98 3300037466 Ga0395898_0008831 Ga0395898_0008831_4073_4891 269
99 3300038443 Ga0395901_0012156 Ga0395901_0012156_2826_3644 269
100 3300046683 Ga0495658_0133036 Ga0495658_0133036_588_1406 269
101 3300047319 Ga0495674_0519600 Ga0495674_0519600_80_898 269
102 3300048920 Ga0496117_0025417 Ga0496117_0025417_1231_2049 269
103 3300048921 Ga0496118_0002027 Ga0496118_0002027_14900_15718 269
104 3300048924 Ga0496121_0000110 Ga0496121_0000110_28392_29210 269
105 3300048927 Ga0496124_0000378 Ga0496124_0000378_12683_13501 269
106 3300048929 Ga0496126_0006083 Ga0496126_0006083_8664_9482 269
107 3300053080 Ga0500635_0004771 Ga0500635_0004771_511_1329 269
108 3300053094 Ga0500566_0018579 Ga0500566_0018579_452_1270 269
109 3300053140 Ga0500573_0015494 Ga0500573_0015494_1336_2154 269
110 3300053163 Ga0500639_112272 Ga0500639_112272_41_859 269
111 3300053735 Ga0500596_001687 Ga0500596_001687_3046_3864 269
112 iso_pu_bacteria 2513237137 2513863729 269
113 iso_pu_bacteria 2517572143 2517892819 269
114 iso_pu_bacteria 2904699407 2904702948 269
115 iso_pu_bacteria 2906610324 2906618192 269
116 iso_pu_bacteria 2906635258 2906642500 269
117 iso_pu_bacteria 2906660503 2906664268 269
118 iso_pu_bacteria 2908739725 2908743212 269
119 iso_pu_bacteria 3005474847 3005479786 269
120 3300005436 Ga0070713_100074349 Ga0070713_1000743494 270
121 3300006028 Ga0070717_10154036 Ga0070717_101540362 270
122 3300025928 Ga0207700_10030154 Ga0207700_100301546 270
123 3300048905 Ga0496102_0234488 Ga0496102_0234488_721_1593 270
124 3300005539 Ga0068853_100400422 Ga0068853_1004004221 271
125 3300006028 Ga0070717_10036472 Ga0070717_100364723 271
126 3300006177 Ga0075362_10007055 Ga0075362_100070552 271
127 3300006195 Ga0075366_10004404 Ga0075366_100044045 271
128 3300006844 Ga0075428_100020956 Ga0075428_1000209566 271
129 3300006943 Ga0099822_1000949 Ga0099822_100094918 271
130 3300007788 Ga0099795_10044484 Ga0099795_100444842 271
131 3300009093 Ga0105240_10636707 Ga0105240_106367072 271
132 3300025261 Ga0209233_1008324 Ga0209233_10083243 271
133 3300025928 Ga0207700_10482885 Ga0207700_104828851 271
134 3300027357 Ga0209589_1000003 Ga0209589_1000003332 271
135 3300027361 Ga0209489_100003 Ga0209489_100003383 271
136 3300027363 Ga0209700_100003 Ga0209700_100003383 271
137 3300028786 Ga0307517_10167604 Ga0307517_101676041 271
138 3300031235 Ga0265330_10009220 Ga0265330_100092205 271
139 3300031247 Ga0265340_10003262 Ga0265340_100032629 271
140 3300035171 Ga0373946_0153536 Ga0373946_0153536_194_1009 271
141 3300037068 Ga0373925_0076375 Ga0373925_0076375_521_1336 271
142 3300037471 Ga0395905_0130231 Ga0395905_0130231_1128_1943 271
143 3300038443 Ga0395901_0133406 Ga0395901_0133406_934_1749 271
144 3300045049 Ga0466959_0129267 Ga0466959_0129267_691_1506 271
145 3300046455 Ga0495603_0035963 Ga0495603_0035963_1411_2226 271
146 3300047320 Ga0495672_0010348 Ga0495672_0010348_223_1038 271
147 3300047320 Ga0495672_0224030 Ga0495672_0224030_62_877 271
148 3300048911 Ga0496108_0203807 Ga0496108_0203807_144_959 271
149 3300048913 Ga0496110_0266432 Ga0496110_0266432_136_951 271
150 3300048916 Ga0496113_0338106 Ga0496113_0338106_56_871 271
151 3300048917 Ga0496114_0276989 Ga0496114_0276989_448_1263 271
152 3300048918 Ga0496115_0248170 Ga0496115_0248170_266_1096 271
153 3300048918 Ga0496115_0374119 Ga0496115_0374119_283_1098 271
154 3300048924 Ga0496121_0001680 Ga0496121_0001680_21250_22065 271
155 3300050492 nmdc:mga0yw44_2914_c1 nmdc:mga0yw44_2914_c1_6533_7390 271
156 3300050507 nmdc:mga05p37_42792_c1 nmdc:mga05p37_42792_c1_1104_1961 271
157 3300050516 nmdc:mga0sz30_49731_c1 nmdc:mga0sz30_49731_c1_57_914 271
158 3300053119 Ga0500595_013695 Ga0500595_013695_1701_2573 271
159 iso_pu_bacteria 2791355199 2793083398 271
160 iso_pu_bacteria 2889033259 2889040160 271
161 iso_pu_bacteria 8006994254 8007000118 271
162 3300005539 Ga0068853_100016363 Ga0068853_1000163635 272
163 3300005547 Ga0070693_100470437 Ga0070693_1004704371 272
164 3300010375 Ga0105239_10469549 Ga0105239_104695492 272
165 3300025315 Ga0207697_10093962 Ga0207697_100939622 272
166 3300025932 Ga0207690_10316048 Ga0207690_103160482 272
167 3300026041 Ga0207639_10053795 Ga0207639_100537953 272
168 3300039438 Ga0436360_1372477 Ga0436360_1372477_83_904 272
169 3300046462 Ga0495651_0113781 Ga0495651_0113781_773_1594 272
170 3300048920 Ga0496117_0115449 Ga0496117_0115449_803_1624 272
171 3300048921 Ga0496118_0034981 Ga0496118_0034981_3254_4075 272
172 3300048922 Ga0496119_0062341 Ga0496119_0062341_600_1421 272
173 3300048924 Ga0496121_0020161 Ga0496121_0020161_3099_3920 272
174 3300048929 Ga0496126_0249943 Ga0496126_0249943_23_844 272
175 3300053093 Ga0500651_0055899 Ga0500651_0055899_159_980 272
176 3300053118 Ga0500594_0097751 Ga0500594_0097751_43_864 272
177 3300053119 Ga0500595_000564 Ga0500595_000564_16689_17510 272
178 3300053119 Ga0500595_036354 Ga0500595_036354_196_1017 272
179 3300053119 Ga0500595_049162 Ga0500595_049162_136_957 272
180 3300053177 Ga0500636_0050848 Ga0500636_0050848_281_1102 272
181 iso_pu_bacteria 2513237096 2513654332 272
182 iso_pu_bacteria 2513237145 2513915489 272
183 iso_pu_bacteria 2874604998 2874607695 272
184 iso_pu_bacteria 2876808645 2876809198 272
185 iso_pu_bacteria 2879110137 2879111387 272
186 iso_pu_bacteria 2885374607 2885381213 272
187 iso_pu_bacteria 2903748898 2903750514 272
188 iso_pu_bacteria 2904690495 2904696128 272
189 iso_pu_bacteria 2908756301 2908760762 272
190 iso_pu_bacteria 2935630451 2935633517 272
191 iso_pu_bacteria 2941507105 2941510408 272
192 iso_pu_bacteria 2941515067 2941517855 272
193 iso_pu_bacteria 2941523033 2941525871 272
194 iso_pu_bacteria 8006964411 8006969881 272
195 3300005355 Ga0070671_100243837 Ga0070671_1002438372 273
196 3300005445 Ga0070708_100094520 Ga0070708_1000945202 273
197 3300005455 Ga0070663_100015998 Ga0070663_1000159984 273
198 3300005468 Ga0070707_100185051 Ga0070707_1001850511 273
199 3300005471 Ga0070698_100080639 Ga0070698_1000806392 273
200 3300005536 Ga0070697_100193268 Ga0070697_1001932682 273
201 3300005536 Ga0070697_100342773 Ga0070697_1003427732 273
202 3300005548 Ga0070665_100004313 Ga0070665_10000431311 273
203 3300006048 Ga0075363_100001412 Ga0075363_1000014128 273
204 3300009176 Ga0105242_10255886 Ga0105242_102558862 273
205 3300014325 Ga0163163_10856046 Ga0163163_108560461 273
206 3300025904 Ga0207647_10179385 Ga0207647_101793851 273
207 3300025922 Ga0207646_10043563 Ga0207646_100435634 273
208 3300025931 Ga0207644_10094289 Ga0207644_100942893 273
209 3300033442 Ga0315911_1000001 Ga0315911_1000001816 273
210 3300035116 Ga0373945_0016702 Ga0373945_0016702_1186_2019 273
211 3300035691 Ga0373931_0011628 Ga0373931_0011628_2597_3445 273
212 3300039437 Ga0436365_0099590 Ga0436365_0099590_884_1726 273
213 3300046455 Ga0495603_0153388 Ga0495603_0153388_106_939 273
214 3300046531 Ga0495665_0008224 Ga0495665_0008224_4300_5133 273
215 3300046533 Ga0495640_0092984 Ga0495640_0092984_588_1421 273
216 3300046559 Ga0495667_0128856 Ga0495667_0128856_268_1101 273
217 3300046683 Ga0495658_0013531 Ga0495658_0013531_3257_4090 273
218 3300048909 Ga0496106_0087695 Ga0496106_0087695_660_1505 273
219 3300048909 Ga0496106_0300228 Ga0496106_0300228_403_1269 273
220 3300048915 Ga0496112_0043944 Ga0496112_0043944_806_1654 273
221 3300048916 Ga0496113_0018679 Ga0496113_0018679_1211_2059 273
222 3300048918 Ga0496115_0141724 Ga0496115_0141724_770_1651 273
223 3300048929 Ga0496126_0076452 Ga0496126_0076452_1519_2364 273
224 3300050490 nmdc:mga03n38_404_c1 nmdc:mga03n38_404_c1_4566_5447 273
225 3300005339 Ga0070660_100147482 Ga0070660_1001474823 274
226 3300005577 Ga0068857_100023817 Ga0068857_1000238173 274
227 3300005834 Ga0068851_10032947 Ga0068851_100329473 274
228 3300005981 Ga0081538_10039451 Ga0081538_100394512 274
229 3300007265 Ga0099794_10037379 Ga0099794_100373792 274
230 3300007788 Ga0099795_10020558 Ga0099795_100205583 274
231 3300009545 Ga0105237_10165195 Ga0105237_101651952 274
232 3300009551 Ga0105238_10017869 Ga0105238_100178692 274
233 3300013105 Ga0157369_10056151 Ga0157369_100561515 274
234 3300025321 Ga0207656_10021355 Ga0207656_100213551 274
235 3300025912 Ga0207707_10020556 Ga0207707_100205565 274
236 3300025919 Ga0207657_10002034 Ga0207657_1000203412 274
237 3300025926 Ga0207659_10261007 Ga0207659_102610072 274
238 3300026116 Ga0207674_10035459 Ga0207674_100354592 274
239 3300028786 Ga0307517_10179636 Ga0307517_101796362 274
240 3300031731 Ga0307405_10250459 Ga0307405_102504592 274
241 3300031911 Ga0307412_10070989 Ga0307412_100709892 274
242 3300031995 Ga0307409_100224376 Ga0307409_1002243762 274
243 3300035111 Ga0373923_0006867 Ga0373923_0006867_949_1812 274
244 3300035117 Ga0373953_0000126 Ga0373953_0000126_12743_13606 274
245 3300035118 Ga0373954_0001515 Ga0373954_0001515_7646_8509 274
246 3300035119 Ga0373956_0000764 Ga0373956_0000764_8419_9282 274
247 3300035120 Ga0373957_0000307 Ga0373957_0000307_5893_6756 274
248 3300035172 Ga0373955_0001379 Ga0373955_0001379_5070_5933 274
249 3300035410 Ga0373924_0000464 Ga0373924_0000464_3434_4297 274
250 3300035724 Ga0373933_0000600 Ga0373933_0000600_6567_7430 274
251 3300036401 Ga0373937_0005936 Ga0373937_0005936_4513_5376 274
252 3300046454 Ga0495592_0000570 Ga0495592_0000570_13259_14122 274
253 3300046459 Ga0495629_0010704 Ga0495629_0010704_5135_5998 274
254 3300046459 Ga0495629_0143163 Ga0495629_0143163_314_1162 274
255 3300046462 Ga0495651_0007469 Ga0495651_0007469_6567_7430 274
256 3300046463 Ga0495653_0002759 Ga0495653_0002759_9561_10424 274
257 3300046511 Ga0495608_0003962 Ga0495608_0003962_3715_4578 274
258 3300046529 Ga0495652_0003587 Ga0495652_0003587_9227_10090 274
259 3300046533 Ga0495640_0007192 Ga0495640_0007192_547_1410 274
260 3300046536 Ga0495587_0002145 Ga0495587_0002145_7354_8217 274
261 3300046559 Ga0495667_0000747 Ga0495667_0000747_11448_12311 274
262 3300046642 Ga0495634_0014453 Ga0495634_0014453_3523_4386 274
263 3300046648 Ga0495611_0152023 Ga0495611_0152023_109_972 274
264 3300046663 Ga0495635_0000532 Ga0495635_0000532_9171_10034 274
265 3300046675 Ga0495657_0002564 Ga0495657_0002564_9370_10233 274
266 3300046678 Ga0495599_0000394 Ga0495599_0000394_11055_11918 274
267 3300046679 Ga0495623_0003632 Ga0495623_0003632_4818_5681 274
268 3300046680 Ga0495646_0000916 Ga0495646_0000916_698_1561 274
269 3300046689 Ga0495613_0237072 Ga0495613_0237072_247_1110 274
270 3300046809 Ga0495600_0002273 Ga0495600_0002273_5268_6131 274
271 3300047317 Ga0495604_0002072 Ga0495604_0002072_1056_1919 274
272 3300047322 Ga0495680_0003634 Ga0495680_0003634_3714_4577 274
273 3300047444 Ga0495675_0001271 Ga0495675_0001271_9433_10296 274
274 3300047469 Ga0495673_0013049 Ga0495673_0013049_128_991 274
275 3300047471 Ga0495684_0001102 Ga0495684_0001102_9433_10296 274
276 3300047673 Ga0495593_0000928 Ga0495593_0000928_10256_11119 274
277 3300048088 Ga0495602_0003533 Ga0495602_0003533_5135_5998 274
278 3300053078 Ga0495612_0014656 Ga0495612_0014656_1872_2735 274
279 3300053084 Ga0495595_0000293 Ga0495595_0000293_4397_5260 274
280 3300053085 Ga0495619_0001314 Ga0495619_0001314_5894_6757 274
281 3300053119 Ga0500595_003000 Ga0500595_003000_2927_3796 274
282 iso_pu_bacteria 2876761206 2876767274 274
283 3300005344 Ga0070661_100094072 Ga0070661_1000940722 275
284 3300005347 Ga0070668_100199468 Ga0070668_1001994682 275
285 3300005441 Ga0070700_100097806 Ga0070700_1000978062 275
286 3300005455 Ga0070663_100131673 Ga0070663_1001316732 275
287 3300005456 Ga0070678_100130509 Ga0070678_1001305091 275
288 3300005539 Ga0068853_100114548 Ga0068853_1001145482 275
289 3300005547 Ga0070693_100088521 Ga0070693_1000885212 275
290 3300005548 Ga0070665_100124907 Ga0070665_1001249073 275
291 3300005719 Ga0068861_100046486 Ga0068861_1000464861 275
292 3300005844 Ga0068862_100234642 Ga0068862_1002346421 275
293 3300005937 Ga0081455_10005203 Ga0081455_100052036 275
294 3300006048 Ga0075363_100019080 Ga0075363_1000190805 275
295 3300006178 Ga0075367_10088592 Ga0075367_100885922 275
296 3300006178 Ga0075367_10131859 Ga0075367_101318592 275
297 3300011119 Ga0105246_10076971 Ga0105246_100769712 275
298 3300013296 Ga0157374_10747895 Ga0157374_107478951 275
299 3300014326 Ga0157380_10300135 Ga0157380_103001351 275
300 3300017792 Ga0163161_10198250 Ga0163161_101982502 275
301 3300025901 Ga0207688_10082310 Ga0207688_100823102 275
302 3300025920 Ga0207649_10133343 Ga0207649_101333432 275
303 3300025972 Ga0207668_10038403 Ga0207668_100384032 275
304 3300026041 Ga0207639_10152382 Ga0207639_101523822 275
305 3300026067 Ga0207678_10130471 Ga0207678_101304712 275
306 3300026121 Ga0207683_10107605 Ga0207683_101076052 275
307 3300026121 Ga0207683_10216984 Ga0207683_102169842 275
308 3300028380 Ga0268265_10023170 Ga0268265_100231702 275
309 3300028380 Ga0268265_10434822 Ga0268265_104348222 275
310 3300031507 Ga0307509_10047750 Ga0307509_100477502 275
311 3300032126 Ga0307415_100222487 Ga0307415_1002224872 275
312 3300032126 Ga0307415_100476956 Ga0307415_1004769561 275
313 3300033180 Ga0307510_10035900 Ga0307510_100359006 275
314 3300046455 Ga0495603_0066275 Ga0495603_0066275_289_1137 275
315 3300046460 Ga0495638_0107779 Ga0495638_0107779_114_968 275
316 3300046473 Ga0495582_0029543 Ga0495582_0029543_894_1742 275
317 3300046475 Ga0495639_0021892 Ga0495639_0021892_1687_2535 275
318 3300046492 Ga0495585_0123647 Ga0495585_0123647_356_1210 275
319 3300046499 Ga0495594_0059608 Ga0495594_0059608_622_1476 275
320 3300046648 Ga0495611_0039668 Ga0495611_0039668_905_1759 275
321 3300046660 Ga0495625_0131353 Ga0495625_0131353_690_1544 275
322 3300048904 Ga0496101_0167634 Ga0496101_0167634_630_1484 275
323 3300048905 Ga0496102_0452001 Ga0496102_0452001_320_1171 275
324 3300050492 nmdc:mga0yw44_28610_c1 nmdc:mga0yw44_28610_c1_1055_1903 275
325 3300050494 nmdc:mga06z11_67227_c1 nmdc:mga06z11_67227_c1_540_1391 275
326 3300050496 nmdc:mga07m45_14532_c1 nmdc:mga07m45_14532_c1_103_954 275
327 3300053087 Ga0500643_053318 Ga0500643_053318_43_897 275
328 3300053092 Ga0500583_0003359 Ga0500583_0003359_3770_4624 275
329 3300053094 Ga0500566_0003149 Ga0500566_0003149_3310_4194 275
330 3300053098 Ga0500650_0033657 Ga0500650_0033657_1033_1887 275
331 3300053119 Ga0500595_000288 Ga0500595_000288_14429_15313 275
332 3300053124 Ga0500617_046234 Ga0500617_046234_924_1778 275
333 3300053134 Ga0500658_0108129 Ga0500658_0108129_247_1101 275
334 3300053142 Ga0500577_0021511 Ga0500577_0021511_923_1777 275
335 3300053147 Ga0500589_076429 Ga0500589_076429_496_1350 275
336 3300053162 Ga0500638_001439 Ga0500638_001439_4380_5264 275
337 3300053731 Ga0500609_006761 Ga0500609_006761_589_1443 275
338 3300055283 Ga0500661_000491 Ga0500661_000491_1582_2466 275
339 iso_pu_bacteria 8006984368 8006993631 275
340 3300005327 Ga0070658_10388924 Ga0070658_103889242 276
341 3300005331 Ga0070670_100162435 Ga0070670_1001624352 276
342 3300005331 Ga0070670_100254588 Ga0070670_1002545882 276
343 3300005334 Ga0068869_100002065 Ga0068869_1000020659 276
344 3300005334 Ga0068869_100194396 Ga0068869_1001943961 276
345 3300005337 Ga0070682_100145576 Ga0070682_1001455761 276
346 3300005338 Ga0068868_100036827 Ga0068868_1000368272 276
347 3300005338 Ga0068868_100237932 Ga0068868_1002379321 276
348 3300005338 Ga0068868_100349107 Ga0068868_1003491072 276
349 3300005347 Ga0070668_100056674 Ga0070668_1000566743 276
350 3300005347 Ga0070668_100095976 Ga0070668_1000959762 276
351 3300005347 Ga0070668_100238494 Ga0070668_1002384941 276
352 3300005354 Ga0070675_100168768 Ga0070675_1001687682 276
353 3300005354 Ga0070675_100383325 Ga0070675_1003833251 276
354 3300005355 Ga0070671_100279346 Ga0070671_1002793461 276
355 3300005367 Ga0070667_100140346 Ga0070667_1001403462 276
356 3300005367 Ga0070667_100758572 Ga0070667_1007585721 276
357 3300005455 Ga0070663_100072623 Ga0070663_1000726232 276
358 3300005455 Ga0070663_100077648 Ga0070663_1000776482 276
359 3300005456 Ga0070678_100100320 Ga0070678_1001003201 276
360 3300005458 Ga0070681_10102749 Ga0070681_101027494 276
361 3300005466 Ga0070685_10137362 Ga0070685_101373622 276
362 3300005467 Ga0070706_100428540 Ga0070706_1004285401 276
363 3300005535 Ga0070684_100024649 Ga0070684_1000246494 276
364 3300005543 Ga0070672_100081933 Ga0070672_1000819332 276
365 3300005545 Ga0070695_100047192 Ga0070695_1000471923 276
366 3300005546 Ga0070696_100125377 Ga0070696_1001253771 276
367 3300005563 Ga0068855_100035260 Ga0068855_1000352604 276
368 3300005564 Ga0070664_100523494 Ga0070664_1005234941 276
369 3300005614 Ga0068856_100362435 Ga0068856_1003624352 276
370 3300005616 Ga0068852_100011447 Ga0068852_1000114477 276
371 3300005617 Ga0068859_100079403 Ga0068859_1000794032 276
372 3300005618 Ga0068864_100013874 Ga0068864_1000138746 276
373 3300005719 Ga0068861_100191059 Ga0068861_1001910591 276
374 3300005834 Ga0068851_10028108 Ga0068851_100281083 276
375 3300005842 Ga0068858_100097300 Ga0068858_1000973003 276
376 3300005937 Ga0081455_10030942 Ga0081455_100309426 276
377 3300005983 Ga0081540_1003549 Ga0081540_100354910 276
378 3300005983 Ga0081540_1007097 Ga0081540_10070976 276
379 3300005983 Ga0081540_1026986 Ga0081540_10269862 276
380 3300005983 Ga0081540_1060702 Ga0081540_10607022 276
381 3300006042 Ga0075368_10062245 Ga0075368_100622452 276
382 3300006175 Ga0070712_100038403 Ga0070712_1000384032 276
383 3300006931 Ga0097620_100079394 Ga0097620_1000793944 276
384 3300009092 Ga0105250_10025085 Ga0105250_100250853 276
385 3300009093 Ga0105240_10481338 Ga0105240_104813381 276
386 3300009098 Ga0105245_10286520 Ga0105245_102865202 276
387 3300009177 Ga0105248_10056519 Ga0105248_100565195 276
388 3300009177 Ga0105248_10524493 Ga0105248_105244932 276
389 3300009553 Ga0105249_10073335 Ga0105249_100733353 276
390 3300009553 Ga0105249_10223691 Ga0105249_102236912 276
391 3300010375 Ga0105239_10019764 Ga0105239_100197647 276
392 3300010375 Ga0105239_10298329 Ga0105239_102983292 276
393 3300011119 Ga0105246_10021001 Ga0105246_100210012 276
394 3300013296 Ga0157374_10058735 Ga0157374_100587354 276
395 3300013297 Ga0157378_10116133 Ga0157378_101161333 276
396 3300013306 Ga0163162_10040728 Ga0163162_100407284 276
397 3300013308 Ga0157375_10001930 Ga0157375_1000193012 276
398 3300014325 Ga0163163_10006561 Ga0163163_100065612 276
399 3300014325 Ga0163163_10197113 Ga0163163_101971131 276
400 3300014969 Ga0157376_10034440 Ga0157376_100344404 276
401 3300025901 Ga0207688_10035768 Ga0207688_100357682 276
402 3300025908 Ga0207643_10199792 Ga0207643_101997922 276
403 3300025914 Ga0207671_10037370 Ga0207671_100373702 276
404 3300025925 Ga0207650_10259000 Ga0207650_102590001 276
405 3300025927 Ga0207687_10082133 Ga0207687_100821333 276
406 3300025931 Ga0207644_10246418 Ga0207644_102464182 276
407 3300025933 Ga0207706_10274625 Ga0207706_102746253 276
408 3300025940 Ga0207691_10141558 Ga0207691_101415582 276
409 3300025941 Ga0207711_10195490 Ga0207711_101954901 276
410 3300025942 Ga0207689_10003079 Ga0207689_100030799 276
411 3300025942 Ga0207689_10062579 Ga0207689_100625791 276
412 3300025942 Ga0207689_10116314 Ga0207689_101163142 276
413 3300025945 Ga0207679_10087024 Ga0207679_100870243 276
414 3300025949 Ga0207667_10054038 Ga0207667_100540384 276
415 3300025961 Ga0207712_10292450 Ga0207712_102924502 276
416 3300025972 Ga0207668_10019444 Ga0207668_100194445 276
417 3300025972 Ga0207668_10136577 Ga0207668_101365772 276
418 3300026023 Ga0207677_10020900 Ga0207677_100209002 276
419 3300026023 Ga0207677_10122180 Ga0207677_101221802 276
420 3300026035 Ga0207703_10020295 Ga0207703_100202952 276
421 3300026041 Ga0207639_10100797 Ga0207639_101007973 276
422 3300026067 Ga0207678_10053901 Ga0207678_100539012 276
423 3300026067 Ga0207678_10082789 Ga0207678_100827893 276
424 3300026078 Ga0207702_10241420 Ga0207702_102414202 276
425 3300026088 Ga0207641_10322560 Ga0207641_103225601 276
426 3300026116 Ga0207674_10390367 Ga0207674_103903671 276
427 3300026118 Ga0207675_100108022 Ga0207675_1001080222 276
428 3300026121 Ga0207683_10351507 Ga0207683_103515072 276
429 3300026142 Ga0207698_10372364 Ga0207698_103723642 276
430 3300028379 Ga0268266_10068671 Ga0268266_100686714 276
431 3300028380 Ga0268265_10138872 Ga0268265_101388721 276
432 3300028786 Ga0307517_10000053 Ga0307517_10000053124 276
433 3300031730 Ga0307516_10065794 Ga0307516_100657944 276
434 3300031730 Ga0307516_10173583 Ga0307516_101735831 276
435 3300046462 Ga0495651_0033637 Ga0495651_0033637_2036_2893 276
436 3300046491 Ga0495584_0090144 Ga0495584_0090144_315_1175 276
437 3300046512 Ga0495610_0032499 Ga0495610_0032499_1111_1968 276
438 3300046616 Ga0495668_0020113 Ga0495668_0020113_2103_2960 276
439 3300046683 Ga0495658_0281531 Ga0495658_0281531_157_1014 276
440 3300046690 Ga0495624_0059898 Ga0495624_0059898_487_1338 276
441 3300047315 Ga0495581_0099177 Ga0495581_0099177_140_997 276
442 3300048903 Ga0496100_0120661 Ga0496100_0120661_587_1447 276
443 3300048904 Ga0496101_0013133 Ga0496101_0013133_3370_4230 276
444 3300048905 Ga0496102_0010897 Ga0496102_0010897_4307_5167 276
445 3300048905 Ga0496102_0102868 Ga0496102_0102868_1450_2310 276
446 3300048906 Ga0496103_0017042 Ga0496103_0017042_2086_2946 276
447 3300048908 Ga0496105_0145316 Ga0496105_0145316_973_1833 276
448 3300048909 Ga0496106_0011464 Ga0496106_0011464_3034_3894 276
449 3300048910 Ga0496107_0007915 Ga0496107_0007915_5509_6369 276
450 3300048910 Ga0496107_0024824 Ga0496107_0024824_3360_4217 276
451 3300048912 Ga0496109_0115603 Ga0496109_0115603_700_1560 276
452 3300048913 Ga0496110_0066881 Ga0496110_0066881_869_1729 276
453 3300048913 Ga0496110_0233432 Ga0496110_0233432_181_1038 276
454 3300048914 Ga0496111_0032287 Ga0496111_0032287_587_1447 276
455 3300048915 Ga0496112_0182303 Ga0496112_0182303_126_986 276
456 3300048916 Ga0496113_0095767 Ga0496113_0095767_942_1802 276
457 3300048918 Ga0496115_0001003 Ga0496115_0001003_9069_9929 276
458 3300048924 Ga0496121_0039727 Ga0496121_0039727_916_1773 276
459 3300048924 Ga0496121_0221734 Ga0496121_0221734_270_1127 276
460 3300048927 Ga0496124_0065128 Ga0496124_0065128_1151_2008 276
461 3300048929 Ga0496126_0011403 Ga0496126_0011403_6617_7474 276
462 3300048929 Ga0496126_0151724 Ga0496126_0151724_208_1065 276
463 3300048929 Ga0496126_0318816 Ga0496126_0318816_239_1096 276
464 3300050492 nmdc:mga0yw44_235943_c1 nmdc:mga0yw44_235943_c1_113_973 276
465 3300050494 nmdc:mga06z11_18548_c1 nmdc:mga06z11_18548_c1_1343_2200 276
466 3300053078 Ga0495612_0064198 Ga0495612_0064198_64_915 276
467 3300053084 Ga0495595_0014681 Ga0495595_0014681_2171_3031 276
468 3300053085 Ga0495619_0058817 Ga0495619_0058817_286_1146 276
469 3300053133 Ga0500655_007870 Ga0500655_007870_164_1021 276
470 3300053139 Ga0500568_0048354 Ga0500568_0048354_257_1114 276
471 3300053148 Ga0500590_055846 Ga0500590_055846_934_1791 276
472 3300053156 Ga0500622_0165086 Ga0500622_0165086_58_915 276
473 3300053158 Ga0500627_0065903 Ga0500627_0065903_95_952 276
474 3300039450 Ga0436363_0992782 Ga0436363_0992782_1648_2520 277
475 3300031241 Ga0265325_10011639 Ga0265325_100116391 278
476 3300031250 Ga0265331_10049041 Ga0265331_100490411 278
477 3300048915 Ga0496112_0000009 Ga0496112_0000009_278728_279570 278
478 3300048929 Ga0496126_0150791 Ga0496126_0150791_590_1447 278
479 3300005336 Ga0070680_100268953 Ga0070680_1002689531 279
480 3300005434 Ga0070709_10001494 Ga0070709_100014945 279
481 3300005435 Ga0070714_100045796 Ga0070714_1000457962 279
482 3300005436 Ga0070713_100073511 Ga0070713_1000735112 279
483 3300005437 Ga0070710_10004580 Ga0070710_100045805 279
484 3300005439 Ga0070711_100002728 Ga0070711_1000027289 279
485 3300005530 Ga0070679_100061142 Ga0070679_1000611422 279
486 3300005548 Ga0070665_100252628 Ga0070665_1002526282 279
487 3300006173 Ga0070716_100023154 Ga0070716_1000231543 279
488 3300006237 Ga0097621_100255795 Ga0097621_1002557952 279
489 3300013104 Ga0157370_10016953 Ga0157370_100169536 279
490 3300013297 Ga0157378_10004686 Ga0157378_100046862 279
491 3300025898 Ga0207692_10011257 Ga0207692_100112574 279
492 3300025905 Ga0207685_10054345 Ga0207685_100543452 279
493 3300025906 Ga0207699_10000906 Ga0207699_1000090610 279
494 3300025915 Ga0207693_10018775 Ga0207693_100187754 279
495 3300025915 Ga0207693_10084372 Ga0207693_100843722 279
496 3300025916 Ga0207663_10001422 Ga0207663_100014227 279
497 3300025917 Ga0207660_10074991 Ga0207660_100749912 279
498 3300025921 Ga0207652_10029677 Ga0207652_100296772 279
499 3300025929 Ga0207664_10401548 Ga0207664_104015482 279
500 3300025949 Ga0207667_10219625 Ga0207667_102196252 279
501 3300046507 Ga0495606_0002525 Ga0495606_0002525_1555_2400 279
502 3300046660 Ga0495625_0144357 Ga0495625_0144357_244_1125 279
503 3300046664 Ga0495659_0056652 Ga0495659_0056652_61_936 279
504 3300048924 Ga0496121_0102812 Ga0496121_0102812_51_905 279
505 3300003203 JGI25406J46586_10000004 JGI25406J46586_1000000461 282
506 3300005985 Ga0081539_10000080 Ga0081539_1000008066 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

30

103

0.98

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

173

240

0.95

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

153

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b6x-assembly2.cif.gz_B crystal structure of in planta processed avrrps4 0.9573 175 217
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8567 155 232
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.853 155 232
7mu5-assembly1.cif.gz_G human dctpp1 bound to triptolide 0.8487 152 237
7yh5-assembly1.cif.gz_A mazg(mycobacterium tuberculosis) 0.8467 1 95
ID Description Score Start End Superfamily
1z0jB00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9788 175 220 4.10.860.20
3craB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9578 7 95 1.10.287.1080
4b6xB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9573 175 217 1.20.58.90
3crcA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9524 7 100 1.10.287.1080
3crcB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9469 7 97 1.10.287.1080
ID Description Score Start End GO Terms
AF-X1T1G4-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9924 158 270 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A1L6TAN5-F1-model_v4 Phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9887 143 270 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A351HUZ9-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9874 153 269 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A6L8FBM2-F1-model_v4 deleted 0.9828 143 271
AF-A0A382TZF4-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9824 159 271 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429

Feature Viewer

pLDDT pTM Quality
87.58 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map