F456550

General Info

Members Datasets Scaffolds Average Seq Length
506 289 1012 153

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0483512|Ga0373925_0483512_17_568
Length 183
Sequence MKSTKPNSANDPKPSDARSSDPRLADFLCFAIYSTNLAYGRAYKPILEELGLTYTQYIAIVALWEQDNQTVSSLGEKLFLESNTLTPILKKLEAKGYLRRQRDAADERQVLVSLTDAGRRLREKGLRMNLKAASGLSSDEFPRVQKAVVALRNNLIKAAEEAPADAPSATGPLPATRHQRKRA

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
105 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
109 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
110 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
111 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
112 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
115 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
116 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 2511231007 Pseudomonas sp. GM18 Isolate Nodule
259 2511231008 Pseudomonas sp. GM21 Isolate Nodule
260 2511231010 Pseudomonas sp. GM25 Isolate Nodule
261 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
262 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
263 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
264 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
265 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
266 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
267 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
268 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
269 2773857670 Pseudomonas sp. 478 Isolate Unclassified
270 2784132072 Pseudomonas sp. 460 Isolate Unclassified
271 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
272 2818991452 Burkholderia cepacia 561 Isolate Unclassified
273 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
274 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
275 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
276 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
277 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
278 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
279 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
280 2928163908 Burkholderia sp. 567 Isolate Unclassified
281 2928170801 Burkholderia sp. 572 Isolate Unclassified
282 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
283 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
284 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
285 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
286 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
287 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
288 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
289 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.71
Nodule 1.38
Rhizoplane 6.52
Rhizosphere 72.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0483512 3300037068 Bacteria 1016
2 MRS2a_Contig_6411 2124908027 Bacteria 12161
3 JGI24739J22299_10047179 3300001989 Bacteria 1407
4 JGI24739J22299_10055622 3300001989 Bacteria 1264
5 JGI25155J39150_1000781 3300002704 Bacteria 5161
6 JGI25156J39149_1000171 3300002705 Bacteria 47365
7 JGI25156J39149_1002423 3300002705 Bacteria 6702
8 JGI25156J39149_1008172 3300002705 Bacteria 2663
9 JGI25162J39368_1005749 3300002737 Bacteria 2324
10 JGI25154J39366_1000113 3300002738 Bacteria 69635
11 JGI25154J39366_1000491 3300002738 Bacteria 20263
12 JGI25157J39369_1000286 3300002741 Bacteria 36767
13 JGI25160J50197_1000115 3300003354 Bacteria 73613
14 Ga0055532_1000017 3300003758 Bacteria 306880
15 Ga0055535_1008342 3300003761 Bacteria 1882
16 Ga0055529_1010084 3300003763 Bacteria 1232
17 Ga0055526_1000063 3300003771 Bacteria 103612
18 Ga0065165_1001119 3300005262 Bacteria 31655
19 Ga0065165_1087800 3300005262 Bacteria 797
20 Ga0065714_10000146 3300005288 Bacteria 8810
21 Ga0065714_10002341 3300005288 Bacteria 31600
22 Ga0065714_10027815 3300005288 Bacteria 1076
23 Ga0065714_10067131 3300005288 Bacteria 5852
24 Ga0065714_10070199 3300005288 Bacteria 3937
25 Ga0065714_10082492 3300005288 Bacteria 2304
26 Ga0065704_10115582 3300005289 Bacteria 1869
27 Ga0065715_10335451 3300005293 Bacteria 930
28 Ga0070658_10269379 3300005327 Bacteria 1448
29 Ga0070707_100765673 3300005468 Bacteria 929
30 Ga0068853_100120023 3300005539 Bacteria 2344
31 Ga0070696_101085745 3300005546 Bacteria 672
32 Ga0068857_101139877 3300005577 Bacteria 754
33 Ga0068856_100409852 3300005614 Bacteria 1375
34 Ga0068861_100451388 3300005719 Bacteria 1152
35 Ga0075365_10798566 3300006038 Bacteria 666
36 Ga0075368_10021513 3300006042 Bacteria 2451
37 Ga0075368_10269693 3300006042 Bacteria 730
38 Ga0075432_10003300 3300006058 Bacteria 5452
39 Ga0075362_10266445 3300006177 Bacteria 845
40 Ga0075366_10038274 3300006195 Bacteria 2833
41 Ga0075370_10121989 3300006353 Bacteria 1518
42 Ga0075430_100001497 3300006846 Bacteria 19065
43 Ga0099826_10000008 3300006948 Bacteria 380974
44 Ga0105251_10084947 3300009011 Bacteria 1459
45 Ga0105244_10044167 3300009036 Bacteria 2296
46 Ga0105244_10057939 3300009036 Bacteria 1957
47 Ga0105250_10002992 3300009092 Bacteria 8200
48 Ga0105250_10111311 3300009092 Bacteria 1121
49 Ga0105240_10382242 3300009093 Bacteria 1590
50 Ga0105245_10004229 3300009098 Bacteria 12741
51 Ga0105247_10396253 3300009101 Bacteria 982
52 Ga0105243_11557491 3300009148 Bacteria 686
53 Ga0105242_10254849 3300009176 Bacteria 1583
54 Ga0105242_10546046 3300009176 Bacteria 1110
55 Ga0105248_10587802 3300009177 Bacteria 1256
56 Ga0105238_10354668 3300009551 Bacteria 1456
57 Ga0105239_10078454 3300010375 Bacteria 3634
58 Ga0105246_10011960 3300011119 Bacteria 5402
59 Ga0105246_10117661 3300011119 Bacteria 1964
60 Ga0157373_10018636 3300013100 Bacteria 5051
61 Ga0157371_10000379 3300013102 Bacteria 55919
62 Ga0157370_10017285 3300013104 Bacteria 7279
63 Ga0157370_10035072 3300013104 Bacteria 4880
64 Ga0157370_10143708 3300013104 Bacteria 2222
65 Ga0157370_10242809 3300013104 Bacteria 1666
66 Ga0157369_11089537 3300013105 Bacteria 817
67 Ga0157374_10007675 3300013296 Bacteria 9211
68 Ga0163162_10084013 3300013306 Bacteria 3259
69 Ga0163162_10184424 3300013306 Bacteria 2213
70 Ga0163162_10245835 3300013306 Bacteria 1921
71 Ga0163162_10510388 3300013306 Bacteria 1332
72 Ga0163162_11471852 3300013306 Bacteria 775
73 Ga0157372_11332995 3300013307 Bacteria 828
74 Ga0163163_10055805 3300014325 Bacteria 3904
75 Ga0157379_10157283 3300014968 Bacteria 2051
76 Ga0157376_10009004 3300014969 Bacteria 7230
77 Ga0182006_1020014 3300015261 Bacteria 2809
78 Ga0182006_1021015 3300015261 Bacteria 2727
79 Ga0182006_1026014 3300015261 Bacteria 2400
80 Ga0182007_10242418 3300015262 Bacteria 644
81 Ga0182005_1098906 3300015265 Bacteria 816
82 Ga0183361_10004 3300016635 Bacteria 484183
83 Ga0163161_10000986 3300017792 Bacteria 21775
84 Ga0163161_10107194 3300017792 Bacteria 2086
85 Ga0163161_10204006 3300017792 Bacteria 1525
86 Ga0163161_10266462 3300017792 Bacteria 1339
87 Ga0213872_10029017 3300021361 Bacteria 2537
88 Ga0213872_10135757 3300021361 Bacteria 1081
89 Ga0209435_100015 3300025206 Bacteria 321177
90 Ga0209147_100004 3300025229 Bacteria 1371850
91 Ga0209258_100298 3300025242 Bacteria 81047
92 Ga0209646_1000040 3300025246 Bacteria 347867
93 Ga0209026_1000034 3300025250 Bacteria 306953
94 Ga0209759_1000234 3300025256 Bacteria 83099
95 Ga0209455_1005158 3300025272 Bacteria 4103
96 Ga0209130_1009591 3300025284 Bacteria 2742
97 Ga0209025_1000135 3300025294 Bacteria 194337
98 Ga0209025_1005179 3300025294 Bacteria 10776
99 Ga0209564_1000006 3300025295 Bacteria 1100927
100 Ga0209564_1038022 3300025295 Bacteria 1346
101 Ga0209050_1077832 3300025298 Bacteria 715
102 Ga0207426_1000018 3300025302 Bacteria 566740
103 Ga0209051_1007918 3300025303 Bacteria 5727
104 Ga0207696_1001491 3300025711 Bacteria 12591
105 Ga0207696_1055657 3300025711 Bacteria 1122
106 Ga0207655_1001599 3300025728 Bacteria 20273
107 Ga0207655_1011369 3300025728 Bacteria 5305
108 Ga0207655_1037008 3300025728 Bacteria 2155
109 Ga0207655_1074102 3300025728 Bacteria 1253
110 Ga0207713_1003728 3300025735 Bacteria 10239
111 Ga0207713_1026862 3300025735 Bacteria 2627
112 Ga0207713_1148223 3300025735 Bacteria 760
113 Ga0207647_10003355 3300025904 Bacteria 12012
114 Ga0207685_10504532 3300025905 Bacteria 637
115 Ga0207705_10413951 3300025909 Bacteria 1043
116 Ga0207646_10942243 3300025922 Bacteria 765
117 Ga0207706_10320934 3300025933 Bacteria 1348
118 Ga0207686_10158694 3300025934 Bacteria 1583
119 Ga0207686_10341793 3300025934 Bacteria 1124
120 Ga0207709_10794962 3300025935 Bacteria 763
121 Ga0207639_10073123 3300026041 Bacteria 2687
122 Ga0207702_10391409 3300026078 Bacteria 1338
123 Ga0207674_10362635 3300026116 Bacteria 1401
124 Ga0207675_100106332 3300026118 Bacteria 2646
125 Ga0209813_10143155 3300027866 Bacteria 850
126 Ga0316182_1105419 3300030745 Bacteria 2200
127 Ga0307513_10000015 3300031456 Bacteria 296183
128 Ga0307513_10521115 3300031456 Bacteria 904
129 Ga0307408_101289454 3300031548 Bacteria 684
130 Ga0307516_10330264 3300031730 Bacteria 1194
131 Ga0307405_10384951 3300031731 Bacteria 1093
132 Ga0307406_10184532 3300031901 Bacteria 1522
133 Ga0307407_10173097 3300031903 Bacteria 1424
134 Ga0307416_100465750 3300032002 Bacteria 1320
135 Ga0307414_10836852 3300032004 Bacteria 841
136 Ga0307510_10372579 3300033180 Bacteria 874
137 Ga0373950_0020625 3300034818 Bacteria 1160
138 Ga0395900_0304024 3300037418 Bacteria 1580
139 Ga0395905_0000020 3300037471 Bacteria 337672
140 Ga0395905_0378087 3300037471 Bacteria 1310
141 Ga0436361_0314583 3300039447 Bacteria 7413
142 Ga0436361_0408820 3300039447 Bacteria 4645
143 Ga0439436_0000410 3300041404 Bacteria 10768
144 Ga0439438_006818 3300041405 Bacteria 3982
145 Ga0439438_012956 3300041405 Bacteria 2535
146 Ga0439438_057426 3300041405 Bacteria 978
147 Ga0439447_001122 3300041407 Bacteria 9734
148 Ga0439447_056226 3300041407 Bacteria 931
149 Ga0439466_0026512 3300041411 Bacteria 2014
150 Ga0439466_0050142 3300041411 Bacteria 1369
151 Ga0439465_0055658 3300041413 Bacteria 1303
152 Ga0451841_0894558 3300041498 Bacteria 596
153 Ga0439432_004914 3300042006 Bacteria 4843
154 Ga0439432_006895 3300042006 Bacteria 4045
155 Ga0439432_018447 3300042006 Bacteria 2331
156 Ga0439451_000225 3300042009 Bacteria 10896
157 Ga0439451_012575 3300042009 Bacteria 1707
158 Ga0439451_030377 3300042009 Bacteria 1086
159 Ga0439452_013815 3300042010 Bacteria 2258
160 Ga0439456_015248 3300042013 Bacteria 1604
161 Ga0439463_063596 3300042016 Bacteria 943
162 Ga0450911_039039 3300042115 Bacteria 616
163 Ga0450903_004060 3300042138 Bacteria 2510
164 Ga0450907_000003 3300042146 Bacteria 138102
165 Ga0439446_0019659 3300042156 Bacteria 1899
166 Ga0439446_0045088 3300042156 Bacteria 1306
167 Ga0450909_001224 3300042185 Bacteria 3564
168 Ga0450909_005390 3300042185 Bacteria 1840
169 Ga0439434_0000017 3300042435 Bacteria 43012
170 Ga0439434_0015142 3300042435 Bacteria 2298
171 Ga0439460_0057798 3300042461 Bacteria 1177
172 Ga0439440_0000286 3300042993 Bacteria 8210
173 Ga0466966_0950807 3300044684 Bacteria 518
174 Ga0466961_0248263 3300044693 Bacteria 1093
175 Ga0495617_000139 3300046452 Bacteria 47951
176 Ga0495617_001917 3300046452 Bacteria 8732
177 Ga0495617_034361 3300046452 Bacteria 1702
178 Ga0495603_0015176 3300046455 Bacteria 4660
179 Ga0495603_0044745 3300046455 Bacteria 2641
180 Ga0495603_0059197 3300046455 Bacteria 2264
181 Ga0495591_000032 3300046458 Bacteria 176337
182 Ga0495591_005871 3300046458 Bacteria 5570
183 Ga0495591_023694 3300046458 Bacteria 1961
184 Ga0495591_078981 3300046458 Bacteria 841
185 Ga0495629_0162558 3300046459 Bacteria 1551
186 Ga0495638_0000105 3300046460 Bacteria 134384
187 Ga0495638_0043291 3300046460 Bacteria 2841
188 Ga0495651_0622227 3300046462 Bacteria 679
189 Ga0495650_0001507 3300046471 Bacteria 22164
190 Ga0495650_0002094 3300046471 Bacteria 17165
191 Ga0495650_0002690 3300046471 Bacteria 13801
192 Ga0495650_0047208 3300046471 Bacteria 1802
193 Ga0495650_0117329 3300046471 Bacteria 982
194 Ga0495580_0011343 3300046472 Bacteria 6897
195 Ga0495580_0030245 3300046472 Bacteria 3922
196 Ga0495605_0002188 3300046474 Bacteria 12215
197 Ga0495605_0011476 3300046474 Bacteria 4935
198 Ga0495605_0015845 3300046474 Bacteria 4092
199 Ga0495605_0015853 3300046474 Bacteria 4091
200 Ga0495639_0011531 3300046475 Bacteria 3812
201 Ga0495584_0008224 3300046491 Bacteria 5408
202 Ga0495584_0013690 3300046491 Bacteria 4136
203 Ga0495584_0018908 3300046491 Bacteria 3500
204 Ga0495584_0156390 3300046491 Bacteria 1158
205 Ga0495585_0000418 3300046492 Bacteria 40978
206 Ga0495594_0017277 3300046499 Bacteria 3809
207 Ga0495596_0011976 3300046500 Bacteria 3722
208 Ga0495596_0024986 3300046500 Bacteria 2417
209 Ga0495607_0001351 3300046501 Bacteria 21878
210 Ga0495607_0011682 3300046501 Bacteria 5830
211 Ga0495607_0128088 3300046501 Bacteria 1324
212 Ga0495583_0000112 3300046506 Bacteria 138078
213 Ga0495583_0000740 3300046506 Bacteria 41499
214 Ga0495583_0100170 3300046506 Bacteria 1237
215 Ga0495606_0000783 3300046507 Bacteria 48693
216 Ga0495606_0001207 3300046507 Bacteria 36311
217 Ga0495606_0004435 3300046507 Bacteria 14036
218 Ga0495606_0029928 3300046507 Bacteria 3814
219 Ga0495610_0021622 3300046512 Bacteria 3532
220 Ga0495610_0059295 3300046512 Bacteria 1827
221 Ga0495610_0265102 3300046512 Bacteria 675
222 Ga0495616_0003078 3300046513 Bacteria 10806
223 Ga0495616_0071238 3300046513 Bacteria 1681
224 Ga0495616_0156745 3300046513 Bacteria 1026
225 Ga0495616_0287265 3300046513 Bacteria 698
226 Ga0495620_0000127 3300046515 Bacteria 62010
227 Ga0495630_0021027 3300046517 Bacteria 4817
228 Ga0495631_0005565 3300046518 Bacteria 6585
229 Ga0495631_0017728 3300046518 Bacteria 3361
230 Ga0495631_0020958 3300046518 Bacteria 3047
231 Ga0495632_0000058 3300046519 Bacteria 122648
232 Ga0495632_0023186 3300046519 Bacteria 3317
233 Ga0495637_0002240 3300046520 Bacteria 10759
234 Ga0495637_0015153 3300046520 Bacteria 3620
235 Ga0495643_0000212 3300046522 Bacteria 89287
236 Ga0495643_0013251 3300046522 Bacteria 4941
237 Ga0495643_0051241 3300046522 Bacteria 2221
238 Ga0495643_0060186 3300046522 Bacteria 2016
239 Ga0495644_0190483 3300046523 Bacteria 789
240 Ga0495644_0320019 3300046523 Bacteria 608
241 Ga0495648_0000008 3300046524 Bacteria 336584
242 Ga0495648_0001507 3300046524 Bacteria 22797
243 Ga0495648_0002586 3300046524 Bacteria 16576
244 Ga0495666_0004034 3300046526 Bacteria 7421
245 Ga0495666_0006761 3300046526 Bacteria 5765
246 Ga0495666_0210704 3300046526 Bacteria 891
247 Ga0495642_0000003 3300046528 Bacteria 185425
248 Ga0495642_0026217 3300046528 Bacteria 2314
249 Ga0495642_0280917 3300046528 Bacteria 729
250 Ga0495652_0806585 3300046529 Bacteria 625
251 Ga0495654_0005381 3300046530 Bacteria 7446
252 Ga0495654_0058080 3300046530 Bacteria 1867
253 Ga0495654_0225274 3300046530 Bacteria 791
254 Ga0495654_0275455 3300046530 Bacteria 693
255 Ga0495587_0000989 3300046536 Bacteria 18668
256 Ga0495609_0000879 3300046538 Bacteria 21988
257 Ga0495609_0004469 3300046538 Bacteria 7640
258 Ga0495609_0008851 3300046538 Bacteria 4899
259 Ga0495609_0016148 3300046538 Bacteria 3481
260 Ga0495609_0063609 3300046538 Bacteria 1628
261 Ga0495597_0000027 3300046542 Bacteria 139281
262 Ga0495597_0050755 3300046542 Bacteria 1830
263 Ga0495645_0446194 3300046543 Bacteria 817
264 Ga0495622_0000280 3300046557 Bacteria 38774
265 Ga0495622_0000397 3300046557 Bacteria 29448
266 Ga0495622_0009252 3300046557 Bacteria 4560
267 Ga0495622_0119766 3300046557 Bacteria 1202
268 Ga0495622_0318944 3300046557 Bacteria 675
269 Ga0495633_0000238 3300046558 Bacteria 66595
270 Ga0495633_0042276 3300046558 Bacteria 2165
271 Ga0495656_0059024 3300046615 Bacteria 1667
272 Ga0495668_0007939 3300046616 Bacteria 6694
273 Ga0495668_0030087 3300046616 Bacteria 3067
274 Ga0495668_0177128 3300046616 Bacteria 1168
275 Ga0495668_0232232 3300046616 Bacteria 1010
276 Ga0495634_0000572 3300046642 Bacteria 35710
277 Ga0495611_0316529 3300046648 Bacteria 718
278 Ga0495625_0000293 3300046660 Bacteria 77329
279 Ga0495625_0000954 3300046660 Bacteria 38641
280 Ga0495625_0008685 3300046660 Bacteria 8631
281 Ga0495625_0028552 3300046660 Bacteria 4183
282 Ga0495625_0157996 3300046660 Bacteria 1520
283 Ga0495625_0226449 3300046660 Bacteria 1223
284 Ga0495625_0362499 3300046660 Bacteria 913
285 Ga0495635_0000115 3300046663 Bacteria 47781
286 Ga0495659_0000002 3300046664 Bacteria 176698
287 Ga0495659_0004481 3300046664 Bacteria 4399
288 Ga0495661_0015960 3300046665 Bacteria 4995
289 Ga0495661_0025656 3300046665 Bacteria 3804
290 Ga0495588_0016450 3300046674 Bacteria 3574
291 Ga0495588_0102625 3300046674 Bacteria 1503
292 Ga0495588_0299998 3300046674 Bacteria 846
293 Ga0495599_0330890 3300046678 Bacteria 915
294 Ga0495623_0002573 3300046679 Bacteria 11989
295 Ga0495623_0004300 3300046679 Bacteria 9372
296 Ga0495646_0007178 3300046680 Bacteria 7075
297 Ga0495669_0098033 3300046684 Bacteria 1359
298 Ga0495613_0011859 3300046689 Bacteria 6476
299 Ga0495670_0038319 3300046691 Bacteria 2390
300 Ga0495670_0064782 3300046691 Bacteria 1841
301 Ga0495671_0002664 3300046692 Bacteria 11201
302 Ga0495671_0063936 3300046692 Bacteria 1812
303 Ga0495671_0155173 3300046692 Bacteria 1114
304 Ga0495671_0269099 3300046692 Bacteria 821
305 Ga0495671_0303844 3300046692 Bacteria 767
306 Ga0495649_0012783 3300046694 Bacteria 4868
307 Ga0495649_0021345 3300046694 Bacteria 3628
308 Ga0495649_0170144 3300046694 Bacteria 1140
309 Ga0495649_0185228 3300046694 Bacteria 1085
310 Ga0495649_0189079 3300046694 Bacteria 1072
311 Ga0495589_0002253 3300046794 Bacteria 10836
312 Ga0495589_0002333 3300046794 Bacteria 10666
313 Ga0495589_0027824 3300046794 Bacteria 2857
314 Ga0495589_0030658 3300046794 Bacteria 2708
315 Ga0495660_0009758 3300046810 Bacteria 5594
316 Ga0495660_0012366 3300046810 Bacteria 4953
317 Ga0495660_0012681 3300046810 Bacteria 4891
318 Ga0495660_0015356 3300046810 Bacteria 4425
319 Ga0495660_0050800 3300046810 Bacteria 2257
320 Ga0495660_0091401 3300046810 Bacteria 1581
321 Ga0495660_0131813 3300046810 Bacteria 1253
322 Ga0495604_0001399 3300047317 Bacteria 19762
323 Ga0495636_0069925 3300047318 Bacteria 1496
324 Ga0495636_0238686 3300047318 Bacteria 838
325 Ga0495674_0005618 3300047319 Bacteria 12021
326 Ga0495674_0046730 3300047319 Bacteria 3842
327 Ga0495674_0084444 3300047319 Bacteria 2721
328 Ga0495674_0234915 3300047319 Bacteria 1512
329 Ga0495672_0014546 3300047320 Bacteria 5383
330 Ga0495672_0019928 3300047320 Bacteria 4410
331 Ga0495672_0060743 3300047320 Bacteria 2181
332 Ga0495672_0122838 3300047320 Bacteria 1377
333 Ga0495676_0109557 3300047321 Bacteria 2029
334 Ga0495676_0160787 3300047321 Bacteria 1589
335 Ga0495680_0019504 3300047322 Bacteria 5720
336 Ga0495680_0111271 3300047322 Bacteria 2029
337 Ga0495680_0198065 3300047322 Bacteria 1442
338 Ga0495683_0002806 3300047323 Bacteria 10334
339 Ga0495683_0012020 3300047323 Bacteria 4550
340 Ga0495683_0112757 3300047323 Bacteria 1296
341 Ga0495683_0118300 3300047323 Bacteria 1259
342 Ga0495687_000343 3300047443 Bacteria 59599
343 Ga0495687_000358 3300047443 Bacteria 57250
344 Ga0495687_000412 3300047443 Bacteria 52902
345 Ga0495687_010176 3300047443 Bacteria 5175
346 Ga0495677_0000247 3300047445 Bacteria 23769
347 Ga0495677_0035349 3300047445 Bacteria 1823
348 Ga0495679_066047 3300047446 Bacteria 1051
349 Ga0495679_074685 3300047446 Bacteria 970
350 Ga0495679_144224 3300047446 Bacteria 641
351 Ga0495685_009831 3300047447 Bacteria 3202
352 Ga0495685_111114 3300047447 Bacteria 902
353 Ga0495673_0000120 3300047469 Bacteria 144972
354 Ga0495673_0000184 3300047469 Bacteria 101002
355 Ga0495673_0012647 3300047469 Bacteria 4464
356 Ga0495673_0013400 3300047469 Bacteria 4308
357 Ga0495673_0022655 3300047469 Bacteria 3074
358 Ga0495681_0002497 3300047470 Bacteria 13117
359 Ga0495681_0003977 3300047470 Bacteria 10172
360 Ga0495681_0025611 3300047470 Bacteria 3083
361 Ga0495686_0102425 3300047472 Bacteria 1725
362 Ga0495593_0017665 3300047673 Bacteria 4016
363 Ga0495593_0024379 3300047673 Bacteria 3353
364 Ga0495602_0083992 3300048088 Bacteria 2665
365 Ga0495602_0123503 3300048088 Bacteria 2078
366 Ga0495614_0042111 3300048089 Bacteria 1958
367 Ga0495615_0119826 3300048090 Bacteria 760
368 Ga0495626_0000031 3300048091 Bacteria 197930
369 Ga0495626_0009930 3300048091 Bacteria 5115
370 Ga0495626_0035537 3300048091 Bacteria 2378
371 Ga0496100_0333052 3300048903 Bacteria 1143
372 Ga0496100_0666800 3300048903 Bacteria 810
373 Ga0496101_0001468 3300048904 Bacteria 14084
374 Ga0496101_0071749 3300048904 Bacteria 2539
375 Ga0496102_0000073 3300048905 Bacteria 149887
376 Ga0496102_0004797 3300048905 Bacteria 11431
377 Ga0496102_0087817 3300048905 Bacteria 2873
378 Ga0496103_0000755 3300048906 Bacteria 23849
379 Ga0496103_0004322 3300048906 Bacteria 8633
380 Ga0496104_0045368 3300048907 Bacteria 4133
381 Ga0496104_0949107 3300048907 Bacteria 764
382 Ga0496105_0022532 3300048908 Bacteria 5102
383 Ga0496105_0120269 3300048908 Bacteria 2166
384 Ga0496105_0632379 3300048908 Bacteria 827
385 Ga0496106_0004486 3300048909 Bacteria 10356
386 Ga0496106_0150274 3300048909 Bacteria 1837
387 Ga0496106_0400922 3300048909 Bacteria 1102
388 Ga0496107_0002304 3300048910 Bacteria 12322
389 Ga0496107_0093585 3300048910 Bacteria 2198
390 Ga0496108_0039081 3300048911 Bacteria 3955
391 Ga0496109_0247189 3300048912 Bacteria 1679
392 Ga0496110_0273633 3300048913 Bacteria 1537
393 Ga0496110_1303365 3300048913 Bacteria 635
394 Ga0496111_0012309 3300048914 Bacteria 5788
395 Ga0496112_0326478 3300048915 Bacteria 1478
396 Ga0496113_0016664 3300048916 Bacteria 5080
397 Ga0496113_0029195 3300048916 Bacteria 3978
398 Ga0496114_1329837 3300048917 Bacteria 606
399 Ga0496115_0027588 3300048918 Bacteria 4444
400 Ga0496115_0038374 3300048918 Bacteria 3801
401 Ga0496116_0000231 3300048919 Bacteria 103493
402 Ga0496116_0031718 3300048919 Bacteria 3777
403 Ga0496116_0206254 3300048919 Bacteria 1023
404 Ga0496117_0014244 3300048920 Bacteria 6863
405 Ga0496117_0034540 3300048920 Bacteria 3808
406 Ga0496117_0067429 3300048920 Bacteria 2421
407 Ga0496117_0090720 3300048920 Bacteria 1968
408 Ga0496117_0150621 3300048920 Bacteria 1377
409 Ga0496118_0000107 3300048921 Bacteria 155470
410 Ga0496118_0003254 3300048921 Bacteria 20709
411 Ga0496118_0074693 3300048921 Bacteria 2421
412 Ga0496119_0032370 3300048922 Bacteria 3486
413 Ga0496119_0275683 3300048922 Bacteria 838
414 Ga0496121_0006111 3300048924 Bacteria 15144
415 Ga0496121_0062032 3300048924 Bacteria 3064
416 Ga0496121_0094953 3300048924 Bacteria 2318
417 Ga0496121_0097408 3300048924 Bacteria 2279
418 Ga0496121_0114105 3300048924 Bacteria 2054
419 Ga0496121_0215323 3300048924 Bacteria 1357
420 Ga0496122_0002004 3300048925 Bacteria 30310
421 Ga0496123_0168824 3300048926 Bacteria 1156
422 Ga0496124_0164596 3300048927 Bacteria 1725
423 Ga0496124_0866510 3300048927 Bacteria 552
424 Ga0496125_0001119 3300048928 Bacteria 40927
425 Ga0496125_0003226 3300048928 Bacteria 20115
426 Ga0496125_0179600 3300048928 Bacteria 1412
427 Ga0496126_0162984 3300048929 Bacteria 1904
428 Ga0496126_0447973 3300048929 Bacteria 1039
429 Ga0495678_006025 3300049459 Bacteria 6534
430 Ga0495678_008180 3300049459 Bacteria 5312
431 Ga0495678_031575 3300049459 Bacteria 2206
432 Ga0495682_0007047 3300049460 Bacteria 4498
433 Ga0495682_0023540 3300049460 Bacteria 2298
434 Ga0495682_0247536 3300049460 Bacteria 630
435 Ga0501032_0146480 3300049569 Bacteria 1554
436 Ga0501033_0042103 3300049570 Bacteria 3405
437 Ga0501034_0016913 3300049571 Bacteria 7476
438 Ga0501034_0078629 3300049571 Bacteria 3302
439 Ga0501036_0940961 3300049572 Bacteria 708
440 Ga0501037_0001149 3300049573 Bacteria 19580
441 Ga0501037_0351382 3300049573 Bacteria 1017
442 Ga0501038_0083458 3300049574 Bacteria 2689
443 Ga0501038_0619784 3300049574 Bacteria 817
444 Ga0501039_0003700 3300049575 Bacteria 11472
445 Ga0501039_0196494 3300049575 Bacteria 1586
446 Ga0501043_0000951 3300049579 Bacteria 25684
447 Ga0501043_0150468 3300049579 Bacteria 1821
448 Ga0501046_0095459 3300049580 Bacteria 2284
449 Ga0501046_0788621 3300049580 Bacteria 666
450 Ga0501047_0203206 3300049581 Bacteria 1841
451 Ga0501067_0172985 3300049583 Bacteria 1203
452 Ga0501068_0148573 3300049584 Bacteria 1472
453 Ga0501070_0000554 3300049586 Bacteria 34088
454 Ga0501071_0194018 3300049587 Bacteria 1524
455 Ga0501073_0118397 3300049589 Bacteria 1835
456 Ga0501258_043690 3300049687 Bacteria 606
457 Ga0501035_0312265 3300049822 Bacteria 1322
458 Ga0501044_0044894 3300049823 Bacteria 4583
459 Ga0501044_0063126 3300049823 Bacteria 3785
460 nmdc:mga03683_177712_c1 3300050489 Bacteria 970
461 nmdc:mga03683_218081_c1 3300050489 Bacteria 879
462 nmdc:mga0k408_420066_c1 3300050493 Bacteria 795
463 nmdc:mga06z11_43180_c1 3300050494 Bacteria 2266
464 nmdc:mga04h51_277043_c1 3300050495 Bacteria 678
465 nmdc:mga07m45_295041_c1 3300050496 Bacteria 943
466 nmdc:mga0qj67_53_c1 3300050509 Bacteria 83612
467 nmdc:mga0sz30_274293_c1 3300050516 Bacteria 751
468 Ga0495655_0131155 3300053083 Bacteria 772
469 Ga0500566_0086934 3300053094 Bacteria 1732
470 Ga0500641_0325645 3300053096 Bacteria 624
471 Ga0500586_041003 3300053145 Bacteria 1570
472 Ga0500622_0002912 3300053156 Bacteria 11921
473 Ga0500645_001838 3300053730 Bacteria 10175
474 Ga0500645_038961 3300053730 Bacteria 1409
475 2511270409 2511231007 Bacteria 6306603
476 2511278209 2511231008 Bacteria 6624100
477 2511291261 2511231010 Bacteria 6373152
478 2514049333 2513237166 Bacteria 10373764
479 2563064751 2562617112 Bacteria 10918404
480 2599746730 2599185240 Bacteria 7968121
481 2600208636 2599185355 Bacteria 7968906
482 2624491160 2623620446 Bacteria 6500345
483 2644189460 2643221633 Bacteria 6733554
484 2676744292 2675903129 Bacteria 7964495
485 2713482261 2711768613 Bacteria 11048459
486 2774118742 2773857670 Bacteria 6407454
487 2784312379 2784132072 Bacteria 6596533
488 2819591951 2818991445 Bacteria 4955017
489 2819630795 2818991452 Bacteria 8442785
490 2870071442 2870068957 Bacteria 8925310
491 2900638759 2900634093 Bacteria 10263517
492 2919068572 2919063839 Bacteria 6302690
493 2919074326 2919073203 Bacteria 6531949
494 2919703013 2919697872 Bacteria 6553725
495 2921649001 2921643360 Bacteria 11448031
496 2928160378 2928157003 Bacteria 7522202
497 2928170624 2928163908 Bacteria 7561269
498 2928172547 2928170801 Bacteria 8785406
499 2931402518 2931396565 Bacteria 7251677
500 642597379 642555112 Bacteria 8676562
501 642615238 642555113 Bacteria 8214658
502 8018846769 8018845410 Bacteria 8933938
503 8019778047 8019775933 Bacteria 6858656
504 8020941444 8020938398 Bacteria 7472757
505 8020949360 8020945358 Bacteria 8467355
506 8020957766 8020953355 Bacteria 7439080
507 Ga0373925_0483512
508 MRS2a_Contig_6411
509 JGI24739J22299_10047179
510 JGI24739J22299_10055622
511 JGI25155J39150_1000781
512 JGI25156J39149_1000171
513 JGI25156J39149_1002423
514 JGI25156J39149_1008172
515 JGI25162J39368_1005749
516 JGI25154J39366_1000113
517 JGI25154J39366_1000491
518 JGI25157J39369_1000286
519 JGI25160J50197_1000115
520 Ga0055532_1000017
521 Ga0055535_1008342
522 Ga0055529_1010084
523 Ga0055526_1000063
524 Ga0065165_1001119
525 Ga0065165_1087800
526 Ga0065714_10000146
527 Ga0065714_10002341
528 Ga0065714_10027815
529 Ga0065714_10067131
530 Ga0065714_10070199
531 Ga0065714_10082492
532 Ga0065704_10115582
533 Ga0065715_10335451
534 Ga0070658_10269379
535 Ga0070707_100765673
536 Ga0068853_100120023
537 Ga0070696_101085745
538 Ga0068857_101139877
539 Ga0068856_100409852
540 Ga0068861_100451388
541 Ga0075365_10798566
542 Ga0075368_10021513
543 Ga0075368_10269693
544 Ga0075432_10003300
545 Ga0075362_10266445
546 Ga0075366_10038274
547 Ga0075370_10121989
548 Ga0075430_100001497
549 Ga0099826_10000008
550 Ga0105251_10084947
551 Ga0105244_10044167
552 Ga0105244_10057939
553 Ga0105250_10002992
554 Ga0105250_10111311
555 Ga0105240_10382242
556 Ga0105245_10004229
557 Ga0105247_10396253
558 Ga0105243_11557491
559 Ga0105242_10254849
560 Ga0105242_10546046
561 Ga0105248_10587802
562 Ga0105238_10354668
563 Ga0105239_10078454
564 Ga0105246_10011960
565 Ga0105246_10117661
566 Ga0157373_10018636
567 Ga0157371_10000379
568 Ga0157370_10017285
569 Ga0157370_10035072
570 Ga0157370_10143708
571 Ga0157370_10242809
572 Ga0157369_11089537
573 Ga0157374_10007675
574 Ga0163162_10084013
575 Ga0163162_10184424
576 Ga0163162_10245835
577 Ga0163162_10510388
578 Ga0163162_11471852
579 Ga0157372_11332995
580 Ga0163163_10055805
581 Ga0157379_10157283
582 Ga0157376_10009004
583 Ga0182006_1020014
584 Ga0182006_1021015
585 Ga0182006_1026014
586 Ga0182007_10242418
587 Ga0182005_1098906
588 Ga0183361_10004
589 Ga0163161_10000986
590 Ga0163161_10107194
591 Ga0163161_10204006
592 Ga0163161_10266462
593 Ga0213872_10029017
594 Ga0213872_10135757
595 Ga0209435_100015
596 Ga0209147_100004
597 Ga0209258_100298
598 Ga0209646_1000040
599 Ga0209026_1000034
600 Ga0209759_1000234
601 Ga0209455_1005158
602 Ga0209130_1009591
603 Ga0209025_1000135
604 Ga0209025_1005179
605 Ga0209564_1000006
606 Ga0209564_1038022
607 Ga0209050_1077832
608 Ga0207426_1000018
609 Ga0209051_1007918
610 Ga0207696_1001491
611 Ga0207696_1055657
612 Ga0207655_1001599
613 Ga0207655_1011369
614 Ga0207655_1037008
615 Ga0207655_1074102
616 Ga0207713_1003728
617 Ga0207713_1026862
618 Ga0207713_1148223
619 Ga0207647_10003355
620 Ga0207685_10504532
621 Ga0207705_10413951
622 Ga0207646_10942243
623 Ga0207706_10320934
624 Ga0207686_10158694
625 Ga0207686_10341793
626 Ga0207709_10794962
627 Ga0207639_10073123
628 Ga0207702_10391409
629 Ga0207674_10362635
630 Ga0207675_100106332
631 Ga0209813_10143155
632 Ga0316182_1105419
633 Ga0307513_10000015
634 Ga0307513_10521115
635 Ga0307408_101289454
636 Ga0307516_10330264
637 Ga0307405_10384951
638 Ga0307406_10184532
639 Ga0307407_10173097
640 Ga0307416_100465750
641 Ga0307414_10836852
642 Ga0307510_10372579
643 Ga0373950_0020625
644 Ga0395900_0304024
645 Ga0395905_0000020
646 Ga0395905_0378087
647 Ga0436361_0314583
648 Ga0436361_0408820
649 Ga0439436_0000410
650 Ga0439438_006818
651 Ga0439438_012956
652 Ga0439438_057426
653 Ga0439447_001122
654 Ga0439447_056226
655 Ga0439466_0026512
656 Ga0439466_0050142
657 Ga0439465_0055658
658 Ga0451841_0894558
659 Ga0439432_004914
660 Ga0439432_006895
661 Ga0439432_018447
662 Ga0439451_000225
663 Ga0439451_012575
664 Ga0439451_030377
665 Ga0439452_013815
666 Ga0439456_015248
667 Ga0439463_063596
668 Ga0450911_039039
669 Ga0450903_004060
670 Ga0450907_000003
671 Ga0439446_0019659
672 Ga0439446_0045088
673 Ga0450909_001224
674 Ga0450909_005390
675 Ga0439434_0000017
676 Ga0439434_0015142
677 Ga0439460_0057798
678 Ga0439440_0000286
679 Ga0466966_0950807
680 Ga0466961_0248263
681 Ga0495617_000139
682 Ga0495617_001917
683 Ga0495617_034361
684 Ga0495603_0015176
685 Ga0495603_0044745
686 Ga0495603_0059197
687 Ga0495591_000032
688 Ga0495591_005871
689 Ga0495591_023694
690 Ga0495591_078981
691 Ga0495629_0162558
692 Ga0495638_0000105
693 Ga0495638_0043291
694 Ga0495651_0622227
695 Ga0495650_0001507
696 Ga0495650_0002094
697 Ga0495650_0002690
698 Ga0495650_0047208
699 Ga0495650_0117329
700 Ga0495580_0011343
701 Ga0495580_0030245
702 Ga0495605_0002188
703 Ga0495605_0011476
704 Ga0495605_0015845
705 Ga0495605_0015853
706 Ga0495639_0011531
707 Ga0495584_0008224
708 Ga0495584_0013690
709 Ga0495584_0018908
710 Ga0495584_0156390
711 Ga0495585_0000418
712 Ga0495594_0017277
713 Ga0495596_0011976
714 Ga0495596_0024986
715 Ga0495607_0001351
716 Ga0495607_0011682
717 Ga0495607_0128088
718 Ga0495583_0000112
719 Ga0495583_0000740
720 Ga0495583_0100170
721 Ga0495606_0000783
722 Ga0495606_0001207
723 Ga0495606_0004435
724 Ga0495606_0029928
725 Ga0495610_0021622
726 Ga0495610_0059295
727 Ga0495610_0265102
728 Ga0495616_0003078
729 Ga0495616_0071238
730 Ga0495616_0156745
731 Ga0495616_0287265
732 Ga0495620_0000127
733 Ga0495630_0021027
734 Ga0495631_0005565
735 Ga0495631_0017728
736 Ga0495631_0020958
737 Ga0495632_0000058
738 Ga0495632_0023186
739 Ga0495637_0002240
740 Ga0495637_0015153
741 Ga0495643_0000212
742 Ga0495643_0013251
743 Ga0495643_0051241
744 Ga0495643_0060186
745 Ga0495644_0190483
746 Ga0495644_0320019
747 Ga0495648_0000008
748 Ga0495648_0001507
749 Ga0495648_0002586
750 Ga0495666_0004034
751 Ga0495666_0006761
752 Ga0495666_0210704
753 Ga0495642_0000003
754 Ga0495642_0026217
755 Ga0495642_0280917
756 Ga0495652_0806585
757 Ga0495654_0005381
758 Ga0495654_0058080
759 Ga0495654_0225274
760 Ga0495654_0275455
761 Ga0495587_0000989
762 Ga0495609_0000879
763 Ga0495609_0004469
764 Ga0495609_0008851
765 Ga0495609_0016148
766 Ga0495609_0063609
767 Ga0495597_0000027
768 Ga0495597_0050755
769 Ga0495645_0446194
770 Ga0495622_0000280
771 Ga0495622_0000397
772 Ga0495622_0009252
773 Ga0495622_0119766
774 Ga0495622_0318944
775 Ga0495633_0000238
776 Ga0495633_0042276
777 Ga0495656_0059024
778 Ga0495668_0007939
779 Ga0495668_0030087
780 Ga0495668_0177128
781 Ga0495668_0232232
782 Ga0495634_0000572
783 Ga0495611_0316529
784 Ga0495625_0000293
785 Ga0495625_0000954
786 Ga0495625_0008685
787 Ga0495625_0028552
788 Ga0495625_0157996
789 Ga0495625_0226449
790 Ga0495625_0362499
791 Ga0495635_0000115
792 Ga0495659_0000002
793 Ga0495659_0004481
794 Ga0495661_0015960
795 Ga0495661_0025656
796 Ga0495588_0016450
797 Ga0495588_0102625
798 Ga0495588_0299998
799 Ga0495599_0330890
800 Ga0495623_0002573
801 Ga0495623_0004300
802 Ga0495646_0007178
803 Ga0495669_0098033
804 Ga0495613_0011859
805 Ga0495670_0038319
806 Ga0495670_0064782
807 Ga0495671_0002664
808 Ga0495671_0063936
809 Ga0495671_0155173
810 Ga0495671_0269099
811 Ga0495671_0303844
812 Ga0495649_0012783
813 Ga0495649_0021345
814 Ga0495649_0170144
815 Ga0495649_0185228
816 Ga0495649_0189079
817 Ga0495589_0002253
818 Ga0495589_0002333
819 Ga0495589_0027824
820 Ga0495589_0030658
821 Ga0495660_0009758
822 Ga0495660_0012366
823 Ga0495660_0012681
824 Ga0495660_0015356
825 Ga0495660_0050800
826 Ga0495660_0091401
827 Ga0495660_0131813
828 Ga0495604_0001399
829 Ga0495636_0069925
830 Ga0495636_0238686
831 Ga0495674_0005618
832 Ga0495674_0046730
833 Ga0495674_0084444
834 Ga0495674_0234915
835 Ga0495672_0014546
836 Ga0495672_0019928
837 Ga0495672_0060743
838 Ga0495672_0122838
839 Ga0495676_0109557
840 Ga0495676_0160787
841 Ga0495680_0019504
842 Ga0495680_0111271
843 Ga0495680_0198065
844 Ga0495683_0002806
845 Ga0495683_0012020
846 Ga0495683_0112757
847 Ga0495683_0118300
848 Ga0495687_000343
849 Ga0495687_000358
850 Ga0495687_000412
851 Ga0495687_010176
852 Ga0495677_0000247
853 Ga0495677_0035349
854 Ga0495679_066047
855 Ga0495679_074685
856 Ga0495679_144224
857 Ga0495685_009831
858 Ga0495685_111114
859 Ga0495673_0000120
860 Ga0495673_0000184
861 Ga0495673_0012647
862 Ga0495673_0013400
863 Ga0495673_0022655
864 Ga0495681_0002497
865 Ga0495681_0003977
866 Ga0495681_0025611
867 Ga0495686_0102425
868 Ga0495593_0017665
869 Ga0495593_0024379
870 Ga0495602_0083992
871 Ga0495602_0123503
872 Ga0495614_0042111
873 Ga0495615_0119826
874 Ga0495626_0000031
875 Ga0495626_0009930
876 Ga0495626_0035537
877 Ga0496100_0333052
878 Ga0496100_0666800
879 Ga0496101_0001468
880 Ga0496101_0071749
881 Ga0496102_0000073
882 Ga0496102_0004797
883 Ga0496102_0087817
884 Ga0496103_0000755
885 Ga0496103_0004322
886 Ga0496104_0045368
887 Ga0496104_0949107
888 Ga0496105_0022532
889 Ga0496105_0120269
890 Ga0496105_0632379
891 Ga0496106_0004486
892 Ga0496106_0150274
893 Ga0496106_0400922
894 Ga0496107_0002304
895 Ga0496107_0093585
896 Ga0496108_0039081
897 Ga0496109_0247189
898 Ga0496110_0273633
899 Ga0496110_1303365
900 Ga0496111_0012309
901 Ga0496112_0326478
902 Ga0496113_0016664
903 Ga0496113_0029195
904 Ga0496114_1329837
905 Ga0496115_0027588
906 Ga0496115_0038374
907 Ga0496116_0000231
908 Ga0496116_0031718
909 Ga0496116_0206254
910 Ga0496117_0014244
911 Ga0496117_0034540
912 Ga0496117_0067429
913 Ga0496117_0090720
914 Ga0496117_0150621
915 Ga0496118_0000107
916 Ga0496118_0003254
917 Ga0496118_0074693
918 Ga0496119_0032370
919 Ga0496119_0275683
920 Ga0496121_0006111
921 Ga0496121_0062032
922 Ga0496121_0094953
923 Ga0496121_0097408
924 Ga0496121_0114105
925 Ga0496121_0215323
926 Ga0496122_0002004
927 Ga0496123_0168824
928 Ga0496124_0164596
929 Ga0496124_0866510
930 Ga0496125_0001119
931 Ga0496125_0003226
932 Ga0496125_0179600
933 Ga0496126_0162984
934 Ga0496126_0447973
935 Ga0495678_006025
936 Ga0495678_008180
937 Ga0495678_031575
938 Ga0495682_0007047
939 Ga0495682_0023540
940 Ga0495682_0247536
941 Ga0501032_0146480
942 Ga0501033_0042103
943 Ga0501034_0016913
944 Ga0501034_0078629
945 Ga0501036_0940961
946 Ga0501037_0001149
947 Ga0501037_0351382
948 Ga0501038_0083458
949 Ga0501038_0619784
950 Ga0501039_0003700
951 Ga0501039_0196494
952 Ga0501043_0000951
953 Ga0501043_0150468
954 Ga0501046_0095459
955 Ga0501046_0788621
956 Ga0501047_0203206
957 Ga0501067_0172985
958 Ga0501068_0148573
959 Ga0501070_0000554
960 Ga0501071_0194018
961 Ga0501073_0118397
962 Ga0501258_043690
963 Ga0501035_0312265
964 Ga0501044_0044894
965 Ga0501044_0063126
966 nmdc:mga03683_177712_c1
967 nmdc:mga03683_218081_c1
968 nmdc:mga0k408_420066_c1
969 nmdc:mga06z11_43180_c1
970 nmdc:mga04h51_277043_c1
971 nmdc:mga07m45_295041_c1
972 nmdc:mga0qj67_53_c1
973 nmdc:mga0sz30_274293_c1
974 Ga0495655_0131155
975 Ga0500566_0086934
976 Ga0500641_0325645
977 Ga0500586_041003
978 Ga0500622_0002912
979 Ga0500645_001838
980 Ga0500645_038961
981 2511270409
982 2511278209
983 2511291261
984 2514049333
985 2563064751
986 2599746730
987 2600208636
988 2624491160
989 2644189460
990 2676744292
991 2713482261
992 2774118742
993 2784312379
994 2819591951
995 2819630795
996 2870071442
997 2900638759
998 2919068572
999 2919074326
1000 2919703013
1001 2921649001
1002 2928160378
1003 2928170624
1004 2928172547
1005 2931402518
1006 642597379
1007 642615238
1008 8018846769
1009 8019778047
1010 8020941444
1011 8020949360
1012 8020957766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

52

110

0.99

PF12802

MarR_2

MarR family

50

109

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

52

118

0.89

PF22381

Staph_reg_Sar_Rot

Transcriptional regulator SarA/Rot

41

124

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9229 44 99
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9115 44 89
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.886 44 89
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8796 42 98
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8788 47 98
ID Description Score Start End Superfamily
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9564 44 80 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9456 37 99 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9342 37 97 1.10.10.10
5dukA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.932 44 79 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9314 37 99 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A202ECJ5-F1-model_v4 MarR family transcriptional regulator 0.8993 37 100
AF-A0A653FJQ3-F1-model_v4 Organic hydroperoxide resistance transcriptional regulator 0.8573 7 147 GO:0003677
GO:0003700
GO:0006950
AF-A0A837CJ91-F1-model_v4 Putative transcriptional regulatory protein 0.8549 2 144 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-R9T868-F1-model_v4 ArnR1-like winged helix-turn-helix domain-containing protein 0.8547 39 108
AF-A0A2P2D5D0-F1-model_v4 Organic hydroperoxide resistance transcriptional regulator 0.8457 7 147 GO:0003677
GO:0003700
GO:0005737
GO:0006950

Map