F456437

General Info

Members Datasets Scaffolds Average Seq Length
505 263 1010 167

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_570525_c1|nmdc:mga0n895_570525_c1_262_801
Length 179
Sequence MRLSTISPGPKMKISMYQVSAPRFVNMLGNLAAILDKAQAHAEAKKIDPTALTDDRLFPDMLPMKRQVQIACDTAKGAVARLAGVEVPKYEDTEQTFAELKARIAKTIDFIKTIQPAQLEGSEDKNIHLKLGPREIDYIGMQYLLGHALPNFYFHVTTAYDILRHNGVEVGKRDYLGNP

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
223 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
240 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 0
Rhizosphere 99.6
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_570525_c1 3300050512 Bacteria 1136
2 JGI25406J46586_10074069 3300003203 Bacteria 1060
3 Ga0065707_10099067 3300005295 Bacteria 3026
4 Ga0065707_10267069 3300005295 Bacteria 1081
5 Ga0070690_100000821 3300005330 Bacteria 15752
6 Ga0068869_100000793 3300005334 Bacteria 18058
7 Ga0068869_100023864 3300005334 Bacteria 4232
8 Ga0068869_100158757 3300005334 Bacteria 1759
9 Ga0070680_100000848 3300005336 Bacteria 21664
10 Ga0070680_100034453 3300005336 Bacteria 4082
11 Ga0070680_100040279 3300005336 Bacteria 3782
12 Ga0070682_100006997 3300005337 Bacteria 6344
13 Ga0068868_100002473 3300005338 Bacteria 12816
14 Ga0070689_100023425 3300005340 Bacteria 4621
15 Ga0070689_100301915 3300005340 Bacteria 1333
16 Ga0070691_10000265 3300005341 Bacteria 18244
17 Ga0070687_100000208 3300005343 Bacteria 20470
18 Ga0070687_100194678 3300005343 Bacteria 1224
19 Ga0070687_100224643 3300005343 Bacteria 1152
20 Ga0070692_10002651 3300005345 Bacteria 6998
21 Ga0070692_10016657 3300005345 Bacteria 3499
22 Ga0070692_10038106 3300005345 Bacteria 2447
23 Ga0070669_100003100 3300005353 Bacteria 11960
24 Ga0070675_100023802 3300005354 Bacteria 4900
25 Ga0070675_100143179 3300005354 Bacteria 2045
26 Ga0070671_100699883 3300005355 Bacteria 879
27 Ga0070674_100013372 3300005356 Bacteria 5072
28 Ga0070703_10037807 3300005406 Bacteria 1489
29 Ga0070709_10727895 3300005434 Bacteria 774
30 Ga0070701_10000274 3300005438 Bacteria 16803
31 Ga0070701_10196830 3300005438 Bacteria 1189
32 Ga0070711_100513838 3300005439 Bacteria 989
33 Ga0070711_100702269 3300005439 Bacteria 852
34 Ga0070705_100002100 3300005440 Bacteria 10155
35 Ga0070705_100011561 3300005440 Bacteria 4458
36 Ga0070705_100329381 3300005440 Bacteria 1106
37 Ga0070700_100001699 3300005441 Bacteria 11048
38 Ga0070700_100004722 3300005441 Bacteria 7141
39 Ga0070700_100172238 3300005441 Bacteria 1500
40 Ga0070700_100241983 3300005441 Bacteria 1290
41 Ga0070694_100000809 3300005444 Bacteria 17539
42 Ga0070694_100001344 3300005444 Bacteria 14344
43 Ga0070694_100032380 3300005444 Bacteria 3433
44 Ga0070694_100269672 3300005444 Bacteria 1294
45 Ga0070708_100526366 3300005445 Unclassified 1115
46 Ga0070681_10004616 3300005458 Bacteria 13153
47 Ga0070681_10038968 3300005458 Bacteria 4765
48 Ga0070681_10286828 3300005458 Bacteria 1556
49 Ga0068867_100000914 3300005459 Bacteria 20051
50 Ga0068867_100002292 3300005459 Bacteria 13451
51 Ga0068867_100152024 3300005459 Bacteria 1819
52 Ga0070706_100064823 3300005467 Bacteria 3377
53 Ga0070706_100071643 3300005467 Bacteria 3206
54 Ga0070706_100094946 3300005467 Bacteria 2767
55 Ga0070707_100048011 3300005468 Bacteria 4088
56 Ga0070707_100392324 3300005468 Bacteria 1348
57 Ga0070698_100605829 3300005471 Bacteria 1036
58 Ga0070699_100003778 3300005518 Bacteria 13384
59 Ga0070679_100015746 3300005530 Bacteria 7274
60 Ga0070679_100037434 3300005530 Bacteria 4819
61 Ga0070679_100047520 3300005530 Bacteria 4278
62 Ga0070697_100013803 3300005536 Bacteria 6337
63 Ga0070697_100070337 3300005536 Bacteria 2868
64 Ga0070697_100734297 3300005536 Bacteria 872
65 Ga0068853_100153907 3300005539 Bacteria 2071
66 Ga0070686_100023391 3300005544 Bacteria 3692
67 Ga0070695_100000546 3300005545 Bacteria 19898
68 Ga0070695_100016909 3300005545 Bacteria 4420
69 Ga0070695_100023971 3300005545 Bacteria 3756
70 Ga0070696_100000525 3300005546 Bacteria 24298
71 Ga0070696_100000534 3300005546 Bacteria 24147
72 Ga0070696_100034267 3300005546 Bacteria 3492
73 Ga0070696_100059774 3300005546 Bacteria 2664
74 Ga0070696_100077860 3300005546 Bacteria 2344
75 Ga0070696_100080598 3300005546 Unclassified 2305
76 Ga0070693_100000463 3300005547 Bacteria 18199
77 Ga0070693_100057063 3300005547 Bacteria 2256
78 Ga0070693_100518789 3300005547 Bacteria 848
79 Ga0070704_100000523 3300005549 Bacteria 18349
80 Ga0070704_100003460 3300005549 Bacteria 9055
81 Ga0070704_100014316 3300005549 Bacteria 4953
82 Ga0070704_100473300 3300005549 Bacteria 1083
83 Ga0070704_100766377 3300005549 Bacteria 860
84 Ga0070704_101525445 3300005549 Bacteria 615
85 Ga0068855_100023080 3300005563 Bacteria 7455
86 Ga0068854_100006574 3300005578 Bacteria 7403
87 Ga0068856_100108623 3300005614 Bacteria 2770
88 Ga0068856_100239696 3300005614 Bacteria 1829
89 Ga0070702_100000341 3300005615 Bacteria 16257
90 Ga0068852_100046794 3300005616 Bacteria 3687
91 Ga0068859_100001632 3300005617 Bacteria 22919
92 Ga0068859_100663269 3300005617 Bacteria 1135
93 Ga0068864_100120453 3300005618 Bacteria 2346
94 Ga0068866_10000096 3300005718 Bacteria 36786
95 Ga0068866_10142482 3300005718 Unclassified 1378
96 Ga0068861_100000483 3300005719 Bacteria 23160
97 Ga0068861_100002127 3300005719 Bacteria 12816
98 Ga0068861_100506849 3300005719 Bacteria 1092
99 Ga0068870_10040766 3300005840 Bacteria 2410
100 Ga0068870_10098887 3300005840 Bacteria 1645
101 Ga0068870_10149514 3300005840 Bacteria 1374
102 Ga0068863_100394055 3300005841 Bacteria 1353
103 Ga0068858_100041913 3300005842 Bacteria 4243
104 Ga0068858_100051683 3300005842 Bacteria 3802
105 Ga0068860_100054547 3300005843 Bacteria 3799
106 Ga0068862_100000705 3300005844 Bacteria 34116
107 Ga0068862_100030354 3300005844 Bacteria 4555
108 Ga0068862_100039476 3300005844 Bacteria 4009
109 Ga0068862_101359648 3300005844 Bacteria 713
110 Ga0081539_10003529 3300005985 Bacteria 19037
111 Ga0075432_10194801 3300006058 Bacteria 799
112 Ga0070715_10005249 3300006163 Bacteria 4307
113 Ga0070716_100004097 3300006173 Bacteria 6914
114 Ga0070716_100154995 3300006173 Bacteria 1478
115 Ga0070716_100348613 3300006173 Bacteria 1047
116 Ga0097621_100003389 3300006237 Bacteria 10972
117 Ga0097621_100239664 3300006237 Bacteria 1585
118 Ga0068871_100004026 3300006358 Bacteria 10149
119 Ga0068871_100782952 3300006358 Bacteria 878
120 Ga0075428_100018132 3300006844 Bacteria 7777
121 Ga0075428_100122396 3300006844 Bacteria 2832
122 Ga0075428_100230539 3300006844 Bacteria 1998
123 Ga0075430_100005627 3300006846 Bacteria 10583
124 Ga0075430_100030556 3300006846 Bacteria 4575
125 Ga0075430_100288385 3300006846 Bacteria 1358
126 Ga0075430_100458019 3300006846 Bacteria 1052
127 Ga0075430_100538092 3300006846 Bacteria 963
128 Ga0075431_100195330 3300006847 Unclassified 2072
129 Ga0075431_100425637 3300006847 Bacteria 1326
130 Ga0075433_10000503 3300006852 Bacteria 25468
131 Ga0075433_10116051 3300006852 Bacteria 2375
132 Ga0075433_10188496 3300006852 Bacteria 1835
133 Ga0075434_100003256 3300006871 Bacteria 14509
134 Ga0075434_100031549 3300006871 Bacteria 5224
135 Ga0075434_100094442 3300006871 Bacteria 2995
136 Ga0075434_100236376 3300006871 Bacteria 1847
137 Ga0075434_100277509 3300006871 Bacteria 1695
138 Ga0075429_100011845 3300006880 Bacteria 7562
139 Ga0075429_100131834 3300006880 Bacteria 2186
140 Ga0075429_100432217 3300006880 Bacteria 1153
141 Ga0075429_100685961 3300006880 Bacteria 897
142 Ga0075429_100744622 3300006880 Bacteria 858
143 Ga0068865_100005029 3300006881 Bacteria 7999
144 Ga0068865_100027170 3300006881 Bacteria 3777
145 Ga0075436_100000124 3300006914 Bacteria 45658
146 Ga0075436_100000888 3300006914 Bacteria 19869
147 Ga0075436_100008166 3300006914 Bacteria 7166
148 Ga0075436_100008388 3300006914 Bacteria 7067
149 Ga0075436_100033094 3300006914 Bacteria 3562
150 Ga0075436_100034891 3300006914 Bacteria 3470
151 Ga0097620_100001632 3300006931 Bacteria 22919
152 Ga0097620_100663306 3300006931 Bacteria 1135
153 Ga0075435_100000501 3300007076 Bacteria 23857
154 Ga0075435_100025335 3300007076 Bacteria 4617
155 Ga0075435_100041270 3300007076 Bacteria 3688
156 Ga0075435_100046488 3300007076 Bacteria 3482
157 Ga0075435_100085630 3300007076 Bacteria 2594
158 Ga0099794_10058368 3300007265 Bacteria 1870
159 Ga0099794_10081163 3300007265 Bacteria 1600
160 Ga0105240_10638889 3300009093 Bacteria 1168
161 Ga0111539_10086876 3300009094 Bacteria 3674
162 Ga0111539_10157383 3300009094 Bacteria 2658
163 Ga0111539_10598124 3300009094 Bacteria 1284
164 Ga0111539_11707573 3300009094 Bacteria 730
165 Ga0105245_10000086 3300009098 Bacteria 93019
166 Ga0105245_10153395 3300009098 Bacteria 2180
167 Ga0105245_11000399 3300009098 Bacteria 880
168 Ga0114129_10065687 3300009147 Bacteria 5062
169 Ga0114129_10736129 3300009147 Bacteria 1264
170 Ga0114129_11190454 3300009147 Bacteria 950
171 Ga0105243_10001549 3300009148 Bacteria 20112
172 Ga0105243_10024573 3300009148 Bacteria 4596
173 Ga0105241_11169858 3300009174 Bacteria 727
174 Ga0105242_10005004 3300009176 Bacteria 10248
175 Ga0105242_10007538 3300009176 Bacteria 8374
176 Ga0105242_10634896 3300009176 Bacteria 1036
177 Ga0105248_10384214 3300009177 Bacteria 1581
178 Ga0105237_11601903 3300009545 Bacteria 658
179 Ga0105249_10001346 3300009553 Bacteria 21478
180 Ga0105249_10603014 3300009553 Bacteria 1153
181 Ga0105249_10660214 3300009553 Bacteria 1104
182 Ga0099796_10202199 3300010159 Unclassified 806
183 Ga0157374_11103871 3300013296 Bacteria 814
184 Ga0157378_10001676 3300013297 Bacteria 19965
185 Ga0157378_10148852 3300013297 Bacteria 2180
186 Ga0157378_12339401 3300013297 Bacteria 586
187 Ga0163162_10028512 3300013306 Bacteria 5525
188 Ga0163162_11953603 3300013306 Bacteria 672
189 Ga0163162_12177727 3300013306 Bacteria 636
190 Ga0157372_10417830 3300013307 Bacteria 1563
191 Ga0157380_10006520 3300014326 Bacteria 8230
192 Ga0157377_10031036 3300014745 Bacteria 2901
193 Ga0157379_10206056 3300014968 Bacteria 1779
194 Ga0157376_10001287 3300014969 Bacteria 16515
195 Ga0163161_10301881 3300017792 Unclassified 1261
196 Ga0207653_10011561 3300025885 Bacteria 2753
197 Ga0207692_10289400 3300025898 Bacteria 994
198 Ga0207642_10001459 3300025899 Bacteria 7322
199 Ga0207642_10075144 3300025899 Bacteria 1622
200 Ga0207688_10035268 3300025901 Bacteria 2771
201 Ga0207645_10127166 3300025907 Bacteria 1657
202 Ga0207643_10033422 3300025908 Bacteria 2878
203 Ga0207643_10175444 3300025908 Bacteria 1295
204 Ga0207643_10223920 3300025908 Bacteria 1152
205 Ga0207684_10063903 3300025910 Bacteria 3125
206 Ga0207707_10014547 3300025912 Bacteria 6853
207 Ga0207707_10015916 3300025912 Bacteria 6560
208 Ga0207707_10080636 3300025912 Bacteria 2842
209 Ga0207660_10012639 3300025917 Bacteria 5529
210 Ga0207660_10086129 3300025917 Bacteria 2319
211 Ga0207660_10159086 3300025917 Bacteria 1741
212 Ga0207660_10171596 3300025917 Bacteria 1679
213 Ga0207660_10817879 3300025917 Bacteria 760
214 Ga0207662_10000360 3300025918 Bacteria 20465
215 Ga0207662_10024203 3300025918 Bacteria 3494
216 Ga0207662_10355084 3300025918 Bacteria 985
217 Ga0207662_10369109 3300025918 Bacteria 967
218 Ga0207652_10017199 3300025921 Bacteria 5915
219 Ga0207652_10078011 3300025921 Bacteria 2891
220 Ga0207652_10229658 3300025921 Bacteria 1672
221 Ga0207652_11137913 3300025921 Bacteria 681
222 Ga0207646_10098651 3300025922 Bacteria 2618
223 Ga0207681_10000543 3300025923 Bacteria 25987
224 Ga0207681_10240398 3300025923 Bacteria 1409
225 Ga0207659_10052374 3300025926 Bacteria 2907
226 Ga0207659_11251826 3300025926 Bacteria 637
227 Ga0207687_10016044 3300025927 Bacteria 4916
228 Ga0207687_10157358 3300025927 Bacteria 1740
229 Ga0207706_10062788 3300025933 Bacteria 3271
230 Ga0207686_10002386 3300025934 Bacteria 10248
231 Ga0207709_10002490 3300025935 Bacteria 11546
232 Ga0207709_10150766 3300025935 Unclassified 1610
233 Ga0207670_10005165 3300025936 Bacteria 7135
234 Ga0207670_10146899 3300025936 Bacteria 1745
235 Ga0207669_10020264 3300025937 Bacteria 3483
236 Ga0207704_10000193 3300025938 Bacteria 31520
237 Ga0207704_10001054 3300025938 Bacteria 12253
238 Ga0207665_10006734 3300025939 Bacteria 7617
239 Ga0207665_10410090 3300025939 Bacteria 1033
240 Ga0207665_10414350 3300025939 Bacteria 1028
241 Ga0207691_10183822 3300025940 Bacteria 1826
242 Ga0207689_10000246 3300025942 Bacteria 48497
243 Ga0207689_10121895 3300025942 Bacteria 2144
244 Ga0207689_10187946 3300025942 Bacteria 1704
245 Ga0207667_10277276 3300025949 Bacteria 1714
246 Ga0207651_10156269 3300025960 Bacteria 1782
247 Ga0207651_10261032 3300025960 Bacteria 1422
248 Ga0207712_10004335 3300025961 Bacteria 8963
249 Ga0207712_10206393 3300025961 Bacteria 1562
250 Ga0207640_10000657 3300025981 Bacteria 20214
251 Ga0207677_10002651 3300026023 Bacteria 9419
252 Ga0207677_11661969 3300026023 Bacteria 592
253 Ga0207703_10026061 3300026035 Bacteria 4601
254 Ga0207703_10085097 3300026035 Bacteria 2645
255 Ga0207639_11164449 3300026041 Bacteria 723
256 Ga0207708_10002917 3300026075 Bacteria 12593
257 Ga0207708_10003847 3300026075 Bacteria 11055
258 Ga0207708_10120102 3300026075 Bacteria 2047
259 Ga0207708_10208901 3300026075 Bacteria 1560
260 Ga0207708_10210092 3300026075 Bacteria 1555
261 Ga0207708_10544547 3300026075 Bacteria 978
262 Ga0207708_11303394 3300026075 Bacteria 636
263 Ga0207702_10178303 3300026078 Bacteria 1955
264 Ga0207702_10548509 3300026078 Bacteria 1130
265 Ga0207641_10207512 3300026088 Bacteria 1810
266 Ga0207648_10000145 3300026089 Bacteria 70734
267 Ga0207648_10001737 3300026089 Bacteria 23844
268 Ga0207648_10402634 3300026089 Bacteria 1240
269 Ga0207648_10725957 3300026089 Bacteria 922
270 Ga0207676_10113003 3300026095 Bacteria 2276
271 Ga0207675_100003197 3300026118 Bacteria 16070
272 Ga0207675_100004275 3300026118 Bacteria 13802
273 Ga0207675_100079342 3300026118 Bacteria 3076
274 Ga0207683_10105531 3300026121 Bacteria 2519
275 Ga0207698_10049755 3300026142 Bacteria 3192
276 Ga0209995_1016864 3300027471 Bacteria 1200
277 Ga0209179_1011793 3300027512 Bacteria 1557
278 Ga0209588_1000960 3300027671 Bacteria 7380
279 Ga0209588_1008372 3300027671 Bacteria 3065
280 Ga0209588_1102547 3300027671 Bacteria 920
281 Ga0209971_1004920 3300027682 Bacteria 3176
282 Ga0209966_1016781 3300027695 Bacteria 1388
283 Ga0209974_10173837 3300027876 Bacteria 786
284 Ga0207428_10003049 3300027907 Bacteria 16488
285 Ga0207428_10028880 3300027907 Bacteria 4603
286 Ga0207428_10131278 3300027907 Bacteria 1916
287 Ga0207428_10340667 3300027907 Bacteria 1104
288 Ga0268265_10001398 3300028380 Bacteria 20454
289 Ga0268265_10002069 3300028380 Bacteria 15664
290 Ga0268265_10845252 3300028380 Bacteria 895
291 Ga0268264_10018511 3300028381 Bacteria 5696
292 Ga0268264_10148400 3300028381 Bacteria 2099
293 Ga0265338_10236501 3300028800 Unclassified 1355
294 Ga0265340_10138767 3300031247 Bacteria 1112
295 Ga0265316_10417924 3300031344 Bacteria 964
296 Ga0307408_100193556 3300031548 Bacteria 1640
297 Ga0307408_100329030 3300031548 Bacteria 1290
298 Ga0307405_10324202 3300031731 Bacteria 1178
299 Ga0307412_10423596 3300031911 Bacteria 1089
300 Ga0307416_100084309 3300032002 Bacteria 2700
301 Ga0307416_101392771 3300032002 Bacteria 807
302 Ga0307411_10376592 3300032005 Bacteria 1166
303 Ga0307411_10678223 3300032005 Bacteria 895
304 Ga0307415_100427036 3300032126 Bacteria 1139
305 Ga0373959_0048627 3300034820 Bacteria 910
306 Ga0373959_0152234 3300034820 Bacteria 586
307 Ga0373928_0101602 3300035084 Bacteria 751
308 Ga0373934_0000026 3300035086 Bacteria 48420
309 Ga0373940_0122710 3300035088 Bacteria 807
310 Ga0373944_0034168 3300035089 Bacteria 1544
311 Ga0373952_0069756 3300035092 Bacteria 877
312 Ga0373923_0204587 3300035111 Bacteria 913
313 Ga0373936_0008357 3300035113 Bacteria 3895
314 Ga0373936_0295419 3300035113 Bacteria 730
315 Ga0373939_0369243 3300035114 Bacteria 588
316 Ga0373945_0064283 3300035116 Bacteria 1375
317 Ga0373954_0000922 3300035118 Bacteria 11431
318 Ga0373956_0000172 3300035119 Bacteria 24505
319 Ga0373960_0104638 3300035121 Bacteria 922
320 Ga0373946_0004265 3300035171 Bacteria 5110
321 Ga0373955_0013983 3300035172 Bacteria 3896
322 Ga0373955_0243647 3300035172 Bacteria 1077
323 Ga0373955_0456369 3300035172 Bacteria 779
324 Ga0373955_0706477 3300035172 Bacteria 619
325 Ga0373942_0042125 3300035207 Bacteria 1250
326 Ga0373942_0122744 3300035207 Bacteria 813
327 Ga0373961_0140742 3300035241 Bacteria 815
328 Ga0373962_0216715 3300035242 Bacteria 653
329 Ga0373924_0187341 3300035410 Bacteria 911
330 Ga0373931_0008487 3300035691 Bacteria 4875
331 Ga0373931_0028579 3300035691 Bacteria 2856
332 Ga0373931_0175353 3300035691 Bacteria 1266
333 Ga0373931_0621137 3300035691 Bacteria 708
334 Ga0373935_0003430 3300035692 Bacteria 9211
335 Ga0373933_0001191 3300035724 Bacteria 15425
336 Ga0373933_0320898 3300035724 Bacteria 1004
337 Ga0373937_0000491 3300036401 Bacteria 35991
338 Ga0373937_0063842 3300036401 Bacteria 3387
339 Ga0439453_0007880 3300041408 Bacteria 1701
340 Ga0439431_0105496 3300041997 Bacteria 777
341 Ga0439441_001301 3300042001 Bacteria 3217
342 Ga0439441_002245 3300042001 Bacteria 2697
343 Ga0439441_004722 3300042001 Bacteria 2080
344 Ga0439443_020194 3300042003 Bacteria 1044
345 Ga0439435_0000361 3300042436 Bacteria 6926
346 Ga0439435_0068840 3300042436 Bacteria 1045
347 Ga0439435_0095033 3300042436 Bacteria 910
348 Ga0439444_0014510 3300042437 Bacteria 1318
349 Ga0439444_0101179 3300042437 Bacteria 653
350 Ga0439460_0003842 3300042461 Bacteria 3638
351 Ga0439460_0056338 3300042461 Bacteria 1190
352 Ga0450893_0033504 3300042532 Bacteria 922
353 Ga0451577_0230212 3300042876 Bacteria 1676
354 Ga0466972_0250114 3300044658 Bacteria 829
355 Ga0453684_0283679 3300044712 Bacteria 1888
356 Ga0466957_0179631 3300044842 Bacteria 1382
357 Ga0451576_0001484 3300045051 Bacteria 39667
358 Ga0451576_0007261 3300045051 Bacteria 13313
359 Ga0451576_0144249 3300045051 Bacteria 2483
360 Ga0451576_0205444 3300045051 Bacteria 2057
361 Ga0451576_1082408 3300045051 Bacteria 839
362 Ga0466967_0086867 3300045976 Bacteria 2834
363 Ga0495592_0033106 3300046454 Bacteria 3900
364 Ga0495592_0115096 3300046454 Bacteria 1898
365 Ga0495603_0022771 3300046455 Bacteria 3791
366 Ga0495590_0128658 3300046457 Bacteria 910
367 Ga0495629_0063417 3300046459 Bacteria 2581
368 Ga0495651_0002488 3300046462 Bacteria 14249
369 Ga0495651_0129072 3300046462 Bacteria 1847
370 Ga0495651_0301194 3300046462 Bacteria 1075
371 Ga0495580_0050125 3300046472 Bacteria 2952
372 Ga0495582_0047755 3300046473 Bacteria 2358
373 Ga0495639_0058497 3300046475 Bacteria 1763
374 Ga0495662_0017671 3300046476 Bacteria 3452
375 Ga0495594_0040348 3300046499 Bacteria 2554
376 Ga0495608_0121755 3300046511 Bacteria 1673
377 Ga0495628_0001226 3300046516 Bacteria 23478
378 Ga0495628_0011581 3300046516 Bacteria 7456
379 Ga0495628_0659293 3300046516 Bacteria 742
380 Ga0495630_0172419 3300046517 Bacteria 1648
381 Ga0495630_0500974 3300046517 Bacteria 931
382 Ga0495666_0069595 3300046526 Bacteria 1674
383 Ga0495642_0013530 3300046528 Bacteria 3158
384 Ga0495652_0009017 3300046529 Bacteria 9074
385 Ga0495652_0143474 3300046529 Bacteria 1875
386 Ga0495652_0416360 3300046529 Bacteria 948
387 Ga0495586_0055624 3300046535 Bacteria 2144
388 Ga0495586_0132383 3300046535 Bacteria 1396
389 Ga0495586_0471983 3300046535 Bacteria 723
390 Ga0495598_0012433 3300046537 Bacteria 2090
391 Ga0495598_0340637 3300046537 Bacteria 575
392 Ga0495621_0091797 3300046539 Bacteria 1145
393 Ga0495621_0409115 3300046539 Bacteria 576
394 Ga0495645_0015038 3300046543 Bacteria 5498
395 Ga0495645_0144083 3300046543 Bacteria 1660
396 Ga0495667_0005030 3300046559 Bacteria 8934
397 Ga0495667_0671254 3300046559 Bacteria 643
398 Ga0495656_0118978 3300046615 Bacteria 1244
399 Ga0495659_0090186 3300046664 Bacteria 1176
400 Ga0495659_0227312 3300046664 Bacteria 772
401 Ga0495657_0008591 3300046675 Bacteria 7799
402 Ga0495599_0038980 3300046678 Bacteria 2986
403 Ga0495599_0348273 3300046678 Bacteria 888
404 Ga0495599_0652353 3300046678 Bacteria 610
405 Ga0495647_0000339 3300046681 Bacteria 13164
406 Ga0495658_0009921 3300046683 Bacteria 4751
407 Ga0495658_0137703 3300046683 Bacteria 1491
408 Ga0495669_0020912 3300046684 Bacteria 2835
409 Ga0495669_0022603 3300046684 Bacteria 2732
410 Ga0495600_0654476 3300046809 Bacteria 635
411 Ga0495581_0056756 3300047315 Bacteria 2260
412 Ga0495604_0469138 3300047317 Bacteria 820
413 Ga0495636_0009165 3300047318 Bacteria 3893
414 Ga0495636_0155458 3300047318 Bacteria 1028
415 Ga0495674_0284992 3300047319 Bacteria 1352
416 Ga0495676_0063510 3300047321 Bacteria 2878
417 Ga0495680_0422498 3300047322 Bacteria 917
418 Ga0495675_0197967 3300047444 Bacteria 1224
419 Ga0495593_0245214 3300047673 Bacteria 897
420 Ga0495602_0884697 3300048088 Bacteria 595
421 Ga0495615_0241500 3300048090 Bacteria 570
422 Ga0501298_003871 3300049521 Bacteria 2338
423 Ga0501033_0090746 3300049570 Bacteria 2235
424 Ga0501036_0110996 3300049572 Bacteria 2317
425 Ga0501037_0258017 3300049573 Bacteria 1218
426 Ga0501038_0013751 3300049574 Bacteria 7378
427 Ga0501038_0675920 3300049574 Bacteria 775
428 Ga0501039_0014112 3300049575 Bacteria 6117
429 Ga0501040_0014161 3300049576 Bacteria 5250
430 Ga0501040_0014751 3300049576 Bacteria 5156
431 Ga0501040_0149950 3300049576 Bacteria 1645
432 Ga0501041_0014360 3300049577 Bacteria 4702
433 Ga0501041_0101570 3300049577 Bacteria 1781
434 Ga0501042_0038663 3300049578 Bacteria 3388
435 Ga0501042_0293681 3300049578 Bacteria 1174
436 Ga0501042_0340129 3300049578 Bacteria 1085
437 Ga0501046_0337086 3300049580 Bacteria 1096
438 Ga0501048_0084508 3300049582 Bacteria 2238
439 Ga0501048_0259061 3300049582 Bacteria 1236
440 Ga0501067_0028471 3300049583 Bacteria 3096
441 Ga0501071_0583750 3300049587 Bacteria 859
442 Ga0501072_0000548 3300049588 Bacteria 27023
443 Ga0501075_0003382 3300049591 Bacteria 10676
444 Ga0501075_0653678 3300049591 Bacteria 801
445 Ga0501076_0004380 3300049592 Bacteria 10030
446 Ga0501076_1193322 3300049592 Bacteria 626
447 Ga0501216_080705 3300049660 Bacteria 688
448 Ga0501233_160074 3300049668 Bacteria 633
449 Ga0501235_053851 3300049669 Bacteria 935
450 Ga0501079_0009438 3300049741 Bacteria 7394
451 Ga0501080_0026277 3300049742 Bacteria 5410
452 Ga0501080_0210301 3300049742 Bacteria 1783
453 Ga0501080_0973156 3300049742 Bacteria 737
454 Ga0501081_0006495 3300049743 Bacteria 7595
455 Ga0501083_0222205 3300049744 Bacteria 1230
456 Ga0501035_0319716 3300049822 Bacteria 1304
457 Ga0501035_0745903 3300049822 Bacteria 786
458 Ga0501045_0029578 3300049824 Bacteria 3961
459 nmdc:mga05p37_1262075_c1 3300050507 Bacteria 757
460 nmdc:mga05p37_474156_c1 3300050507 Bacteria 1443
461 nmdc:mga05p37_65880_c1 3300050507 Bacteria 4456
462 nmdc:mga05p37_858087_c1 3300050507 Bacteria 985
463 nmdc:mga09592_10184_c1 3300050508 Bacteria 7652
464 nmdc:mga09592_225725_c1 3300050508 Bacteria 1623
465 nmdc:mga09592_25663_c1 3300050508 Bacteria 4880
466 nmdc:mga09592_535453_c1 3300050508 Bacteria 1007
467 nmdc:mga09592_56691_c1 3300050508 Bacteria 3311
468 nmdc:mga0qj67_248745_c1 3300050509 Bacteria 1443
469 nmdc:mga0qj67_3629_c1 3300050509 Bacteria 11138
470 nmdc:mga0qj67_839_c1 3300050509 Bacteria 21054
471 nmdc:mga06r32_392735_c1 3300050510 Bacteria 1370
472 nmdc:mga08y16_543335_c1 3300050511 Bacteria 1177
473 nmdc:mga08y16_83894_c1 3300050511 Bacteria 3321
474 nmdc:mga08y16_89351_c1 3300050511 Bacteria 3211
475 nmdc:mga08y16_95531_c1 3300050511 Bacteria 3096
476 nmdc:mga0n895_1045084_c1 3300050512 Bacteria 796
477 nmdc:mga0n895_1352070_c1 3300050512 Bacteria 682
478 nmdc:mga0n895_3678_c1 3300050512 Bacteria 12390
479 nmdc:mga0n895_387043_c1 3300050512 Bacteria 1415
480 nmdc:mga0n895_523_c1 3300050512 Bacteria 26183
481 nmdc:mga0rr50_42046_c1 3300050513 Bacteria 3335
482 nmdc:mga0rr50_426_c1 3300050513 Bacteria 22748
483 nmdc:mga0rr50_86701_c1 3300050513 Bacteria 2429
484 nmdc:mga0rr50_9323_c1 3300050513 Bacteria 6167
485 nmdc:mga08x19_164561_c1 3300050514 Bacteria 1508
486 nmdc:mga08x19_1769_c1 3300050514 Bacteria 13296
487 nmdc:mga08x19_3464_c1 3300050514 Bacteria 9410
488 nmdc:mga08x19_72950_c1 3300050514 Bacteria 2240
489 nmdc:mga08x19_8368_c1 3300050514 Bacteria 6160
490 nmdc:mga0a205_129281_c2 3300050515 Bacteria 1755
491 nmdc:mga0a205_342717_c1 3300050515 Bacteria 1363
492 nmdc:mga0a205_583945_c1 3300050515 Bacteria 971
493 nmdc:mga0a205_907_c1 3300050515 Bacteria 24381
494 Ga0495601_0002764 3300053077 Bacteria 9962
495 Ga0495601_0087398 3300053077 Bacteria 2004
496 Ga0495601_0404757 3300053077 Bacteria 884
497 Ga0495619_0479739 3300053085 Unclassified 856
498 Ga0495619_0931459 3300053085 Bacteria 583
499 Ga0500650_0307977 3300053098 Bacteria 700
500 Ga0500616_0019493 3300053153 Bacteria 3822
501 Ga0501084_0049868 3300054114 Bacteria 3504
502 Ga0590071_035042 3300059421 Bacteria 1202
503 Ga0501082_0007019 3300060353 Bacteria 9718
504 Ga0501082_1063789 3300060353 Bacteria 707
505 Ga0530510_0003859 3300061734 Bacteria 10328
506 nmdc:mga0n895_570525_c1
507 JGI25406J46586_10074069
508 Ga0065707_10099067
509 Ga0065707_10267069
510 Ga0070690_100000821
511 Ga0068869_100000793
512 Ga0068869_100023864
513 Ga0068869_100158757
514 Ga0070680_100000848
515 Ga0070680_100034453
516 Ga0070680_100040279
517 Ga0070682_100006997
518 Ga0068868_100002473
519 Ga0070689_100023425
520 Ga0070689_100301915
521 Ga0070691_10000265
522 Ga0070687_100000208
523 Ga0070687_100194678
524 Ga0070687_100224643
525 Ga0070692_10002651
526 Ga0070692_10016657
527 Ga0070692_10038106
528 Ga0070669_100003100
529 Ga0070675_100023802
530 Ga0070675_100143179
531 Ga0070671_100699883
532 Ga0070674_100013372
533 Ga0070703_10037807
534 Ga0070709_10727895
535 Ga0070701_10000274
536 Ga0070701_10196830
537 Ga0070711_100513838
538 Ga0070711_100702269
539 Ga0070705_100002100
540 Ga0070705_100011561
541 Ga0070705_100329381
542 Ga0070700_100001699
543 Ga0070700_100004722
544 Ga0070700_100172238
545 Ga0070700_100241983
546 Ga0070694_100000809
547 Ga0070694_100001344
548 Ga0070694_100032380
549 Ga0070694_100269672
550 Ga0070708_100526366
551 Ga0070681_10004616
552 Ga0070681_10038968
553 Ga0070681_10286828
554 Ga0068867_100000914
555 Ga0068867_100002292
556 Ga0068867_100152024
557 Ga0070706_100064823
558 Ga0070706_100071643
559 Ga0070706_100094946
560 Ga0070707_100048011
561 Ga0070707_100392324
562 Ga0070698_100605829
563 Ga0070699_100003778
564 Ga0070679_100015746
565 Ga0070679_100037434
566 Ga0070679_100047520
567 Ga0070697_100013803
568 Ga0070697_100070337
569 Ga0070697_100734297
570 Ga0068853_100153907
571 Ga0070686_100023391
572 Ga0070695_100000546
573 Ga0070695_100016909
574 Ga0070695_100023971
575 Ga0070696_100000525
576 Ga0070696_100000534
577 Ga0070696_100034267
578 Ga0070696_100059774
579 Ga0070696_100077860
580 Ga0070696_100080598
581 Ga0070693_100000463
582 Ga0070693_100057063
583 Ga0070693_100518789
584 Ga0070704_100000523
585 Ga0070704_100003460
586 Ga0070704_100014316
587 Ga0070704_100473300
588 Ga0070704_100766377
589 Ga0070704_101525445
590 Ga0068855_100023080
591 Ga0068854_100006574
592 Ga0068856_100108623
593 Ga0068856_100239696
594 Ga0070702_100000341
595 Ga0068852_100046794
596 Ga0068859_100001632
597 Ga0068859_100663269
598 Ga0068864_100120453
599 Ga0068866_10000096
600 Ga0068866_10142482
601 Ga0068861_100000483
602 Ga0068861_100002127
603 Ga0068861_100506849
604 Ga0068870_10040766
605 Ga0068870_10098887
606 Ga0068870_10149514
607 Ga0068863_100394055
608 Ga0068858_100041913
609 Ga0068858_100051683
610 Ga0068860_100054547
611 Ga0068862_100000705
612 Ga0068862_100030354
613 Ga0068862_100039476
614 Ga0068862_101359648
615 Ga0081539_10003529
616 Ga0075432_10194801
617 Ga0070715_10005249
618 Ga0070716_100004097
619 Ga0070716_100154995
620 Ga0070716_100348613
621 Ga0097621_100003389
622 Ga0097621_100239664
623 Ga0068871_100004026
624 Ga0068871_100782952
625 Ga0075428_100018132
626 Ga0075428_100122396
627 Ga0075428_100230539
628 Ga0075430_100005627
629 Ga0075430_100030556
630 Ga0075430_100288385
631 Ga0075430_100458019
632 Ga0075430_100538092
633 Ga0075431_100195330
634 Ga0075431_100425637
635 Ga0075433_10000503
636 Ga0075433_10116051
637 Ga0075433_10188496
638 Ga0075434_100003256
639 Ga0075434_100031549
640 Ga0075434_100094442
641 Ga0075434_100236376
642 Ga0075434_100277509
643 Ga0075429_100011845
644 Ga0075429_100131834
645 Ga0075429_100432217
646 Ga0075429_100685961
647 Ga0075429_100744622
648 Ga0068865_100005029
649 Ga0068865_100027170
650 Ga0075436_100000124
651 Ga0075436_100000888
652 Ga0075436_100008166
653 Ga0075436_100008388
654 Ga0075436_100033094
655 Ga0075436_100034891
656 Ga0097620_100001632
657 Ga0097620_100663306
658 Ga0075435_100000501
659 Ga0075435_100025335
660 Ga0075435_100041270
661 Ga0075435_100046488
662 Ga0075435_100085630
663 Ga0099794_10058368
664 Ga0099794_10081163
665 Ga0105240_10638889
666 Ga0111539_10086876
667 Ga0111539_10157383
668 Ga0111539_10598124
669 Ga0111539_11707573
670 Ga0105245_10000086
671 Ga0105245_10153395
672 Ga0105245_11000399
673 Ga0114129_10065687
674 Ga0114129_10736129
675 Ga0114129_11190454
676 Ga0105243_10001549
677 Ga0105243_10024573
678 Ga0105241_11169858
679 Ga0105242_10005004
680 Ga0105242_10007538
681 Ga0105242_10634896
682 Ga0105248_10384214
683 Ga0105237_11601903
684 Ga0105249_10001346
685 Ga0105249_10603014
686 Ga0105249_10660214
687 Ga0099796_10202199
688 Ga0157374_11103871
689 Ga0157378_10001676
690 Ga0157378_10148852
691 Ga0157378_12339401
692 Ga0163162_10028512
693 Ga0163162_11953603
694 Ga0163162_12177727
695 Ga0157372_10417830
696 Ga0157380_10006520
697 Ga0157377_10031036
698 Ga0157379_10206056
699 Ga0157376_10001287
700 Ga0163161_10301881
701 Ga0207653_10011561
702 Ga0207692_10289400
703 Ga0207642_10001459
704 Ga0207642_10075144
705 Ga0207688_10035268
706 Ga0207645_10127166
707 Ga0207643_10033422
708 Ga0207643_10175444
709 Ga0207643_10223920
710 Ga0207684_10063903
711 Ga0207707_10014547
712 Ga0207707_10015916
713 Ga0207707_10080636
714 Ga0207660_10012639
715 Ga0207660_10086129
716 Ga0207660_10159086
717 Ga0207660_10171596
718 Ga0207660_10817879
719 Ga0207662_10000360
720 Ga0207662_10024203
721 Ga0207662_10355084
722 Ga0207662_10369109
723 Ga0207652_10017199
724 Ga0207652_10078011
725 Ga0207652_10229658
726 Ga0207652_11137913
727 Ga0207646_10098651
728 Ga0207681_10000543
729 Ga0207681_10240398
730 Ga0207659_10052374
731 Ga0207659_11251826
732 Ga0207687_10016044
733 Ga0207687_10157358
734 Ga0207706_10062788
735 Ga0207686_10002386
736 Ga0207709_10002490
737 Ga0207709_10150766
738 Ga0207670_10005165
739 Ga0207670_10146899
740 Ga0207669_10020264
741 Ga0207704_10000193
742 Ga0207704_10001054
743 Ga0207665_10006734
744 Ga0207665_10410090
745 Ga0207665_10414350
746 Ga0207691_10183822
747 Ga0207689_10000246
748 Ga0207689_10121895
749 Ga0207689_10187946
750 Ga0207667_10277276
751 Ga0207651_10156269
752 Ga0207651_10261032
753 Ga0207712_10004335
754 Ga0207712_10206393
755 Ga0207640_10000657
756 Ga0207677_10002651
757 Ga0207677_11661969
758 Ga0207703_10026061
759 Ga0207703_10085097
760 Ga0207639_11164449
761 Ga0207708_10002917
762 Ga0207708_10003847
763 Ga0207708_10120102
764 Ga0207708_10208901
765 Ga0207708_10210092
766 Ga0207708_10544547
767 Ga0207708_11303394
768 Ga0207702_10178303
769 Ga0207702_10548509
770 Ga0207641_10207512
771 Ga0207648_10000145
772 Ga0207648_10001737
773 Ga0207648_10402634
774 Ga0207648_10725957
775 Ga0207676_10113003
776 Ga0207675_100003197
777 Ga0207675_100004275
778 Ga0207675_100079342
779 Ga0207683_10105531
780 Ga0207698_10049755
781 Ga0209995_1016864
782 Ga0209179_1011793
783 Ga0209588_1000960
784 Ga0209588_1008372
785 Ga0209588_1102547
786 Ga0209971_1004920
787 Ga0209966_1016781
788 Ga0209974_10173837
789 Ga0207428_10003049
790 Ga0207428_10028880
791 Ga0207428_10131278
792 Ga0207428_10340667
793 Ga0268265_10001398
794 Ga0268265_10002069
795 Ga0268265_10845252
796 Ga0268264_10018511
797 Ga0268264_10148400
798 Ga0265338_10236501
799 Ga0265340_10138767
800 Ga0265316_10417924
801 Ga0307408_100193556
802 Ga0307408_100329030
803 Ga0307405_10324202
804 Ga0307412_10423596
805 Ga0307416_100084309
806 Ga0307416_101392771
807 Ga0307411_10376592
808 Ga0307411_10678223
809 Ga0307415_100427036
810 Ga0373959_0048627
811 Ga0373959_0152234
812 Ga0373928_0101602
813 Ga0373934_0000026
814 Ga0373940_0122710
815 Ga0373944_0034168
816 Ga0373952_0069756
817 Ga0373923_0204587
818 Ga0373936_0008357
819 Ga0373936_0295419
820 Ga0373939_0369243
821 Ga0373945_0064283
822 Ga0373954_0000922
823 Ga0373956_0000172
824 Ga0373960_0104638
825 Ga0373946_0004265
826 Ga0373955_0013983
827 Ga0373955_0243647
828 Ga0373955_0456369
829 Ga0373955_0706477
830 Ga0373942_0042125
831 Ga0373942_0122744
832 Ga0373961_0140742
833 Ga0373962_0216715
834 Ga0373924_0187341
835 Ga0373931_0008487
836 Ga0373931_0028579
837 Ga0373931_0175353
838 Ga0373931_0621137
839 Ga0373935_0003430
840 Ga0373933_0001191
841 Ga0373933_0320898
842 Ga0373937_0000491
843 Ga0373937_0063842
844 Ga0439453_0007880
845 Ga0439431_0105496
846 Ga0439441_001301
847 Ga0439441_002245
848 Ga0439441_004722
849 Ga0439443_020194
850 Ga0439435_0000361
851 Ga0439435_0068840
852 Ga0439435_0095033
853 Ga0439444_0014510
854 Ga0439444_0101179
855 Ga0439460_0003842
856 Ga0439460_0056338
857 Ga0450893_0033504
858 Ga0451577_0230212
859 Ga0466972_0250114
860 Ga0453684_0283679
861 Ga0466957_0179631
862 Ga0451576_0001484
863 Ga0451576_0007261
864 Ga0451576_0144249
865 Ga0451576_0205444
866 Ga0451576_1082408
867 Ga0466967_0086867
868 Ga0495592_0033106
869 Ga0495592_0115096
870 Ga0495603_0022771
871 Ga0495590_0128658
872 Ga0495629_0063417
873 Ga0495651_0002488
874 Ga0495651_0129072
875 Ga0495651_0301194
876 Ga0495580_0050125
877 Ga0495582_0047755
878 Ga0495639_0058497
879 Ga0495662_0017671
880 Ga0495594_0040348
881 Ga0495608_0121755
882 Ga0495628_0001226
883 Ga0495628_0011581
884 Ga0495628_0659293
885 Ga0495630_0172419
886 Ga0495630_0500974
887 Ga0495666_0069595
888 Ga0495642_0013530
889 Ga0495652_0009017
890 Ga0495652_0143474
891 Ga0495652_0416360
892 Ga0495586_0055624
893 Ga0495586_0132383
894 Ga0495586_0471983
895 Ga0495598_0012433
896 Ga0495598_0340637
897 Ga0495621_0091797
898 Ga0495621_0409115
899 Ga0495645_0015038
900 Ga0495645_0144083
901 Ga0495667_0005030
902 Ga0495667_0671254
903 Ga0495656_0118978
904 Ga0495659_0090186
905 Ga0495659_0227312
906 Ga0495657_0008591
907 Ga0495599_0038980
908 Ga0495599_0348273
909 Ga0495599_0652353
910 Ga0495647_0000339
911 Ga0495658_0009921
912 Ga0495658_0137703
913 Ga0495669_0020912
914 Ga0495669_0022603
915 Ga0495600_0654476
916 Ga0495581_0056756
917 Ga0495604_0469138
918 Ga0495636_0009165
919 Ga0495636_0155458
920 Ga0495674_0284992
921 Ga0495676_0063510
922 Ga0495680_0422498
923 Ga0495675_0197967
924 Ga0495593_0245214
925 Ga0495602_0884697
926 Ga0495615_0241500
927 Ga0501298_003871
928 Ga0501033_0090746
929 Ga0501036_0110996
930 Ga0501037_0258017
931 Ga0501038_0013751
932 Ga0501038_0675920
933 Ga0501039_0014112
934 Ga0501040_0014161
935 Ga0501040_0014751
936 Ga0501040_0149950
937 Ga0501041_0014360
938 Ga0501041_0101570
939 Ga0501042_0038663
940 Ga0501042_0293681
941 Ga0501042_0340129
942 Ga0501046_0337086
943 Ga0501048_0084508
944 Ga0501048_0259061
945 Ga0501067_0028471
946 Ga0501071_0583750
947 Ga0501072_0000548
948 Ga0501075_0003382
949 Ga0501075_0653678
950 Ga0501076_0004380
951 Ga0501076_1193322
952 Ga0501216_080705
953 Ga0501233_160074
954 Ga0501235_053851
955 Ga0501079_0009438
956 Ga0501080_0026277
957 Ga0501080_0210301
958 Ga0501080_0973156
959 Ga0501081_0006495
960 Ga0501083_0222205
961 Ga0501035_0319716
962 Ga0501035_0745903
963 Ga0501045_0029578
964 nmdc:mga05p37_1262075_c1
965 nmdc:mga05p37_474156_c1
966 nmdc:mga05p37_65880_c1
967 nmdc:mga05p37_858087_c1
968 nmdc:mga09592_10184_c1
969 nmdc:mga09592_225725_c1
970 nmdc:mga09592_25663_c1
971 nmdc:mga09592_535453_c1
972 nmdc:mga09592_56691_c1
973 nmdc:mga0qj67_248745_c1
974 nmdc:mga0qj67_3629_c1
975 nmdc:mga0qj67_839_c1
976 nmdc:mga06r32_392735_c1
977 nmdc:mga08y16_543335_c1
978 nmdc:mga08y16_83894_c1
979 nmdc:mga08y16_89351_c1
980 nmdc:mga08y16_95531_c1
981 nmdc:mga0n895_1045084_c1
982 nmdc:mga0n895_1352070_c1
983 nmdc:mga0n895_3678_c1
984 nmdc:mga0n895_387043_c1
985 nmdc:mga0n895_523_c1
986 nmdc:mga0rr50_42046_c1
987 nmdc:mga0rr50_426_c1
988 nmdc:mga0rr50_86701_c1
989 nmdc:mga0rr50_9323_c1
990 nmdc:mga08x19_164561_c1
991 nmdc:mga08x19_1769_c1
992 nmdc:mga08x19_3464_c1
993 nmdc:mga08x19_72950_c1
994 nmdc:mga08x19_8368_c1
995 nmdc:mga0a205_129281_c2
996 nmdc:mga0a205_342717_c1
997 nmdc:mga0a205_583945_c1
998 nmdc:mga0a205_907_c1
999 Ga0495601_0002764
1000 Ga0495601_0087398
1001 Ga0495601_0404757
1002 Ga0495619_0479739
1003 Ga0495619_0931459
1004 Ga0500650_0307977
1005 Ga0500616_0019493
1006 Ga0501084_0049868
1007 Ga0590071_035042
1008 Ga0501082_0007019
1009 Ga0501082_1063789
1010 Ga0530510_0003859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

16

176

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9483 2 164
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9371 2 164
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8881 2 164
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8706 2 164
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8353 2 164
ID Description Score Start End Superfamily
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9515 2 162 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9233 2 162 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8725 2 164 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7956 2 164 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.69 8 163 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7Z6UUX4-F1-model_v4 DUF1993 domain-containing protein 0.998 1 100
AF-A0A537EBV4-F1-model_v4 DUF1993 domain-containing protein 0.9968 1 153
AF-A0A2P7ST21-F1-model_v4 DUF1993 domain-containing protein 0.9951 1 161
AF-A0A519F1L6-F1-model_v4 DUF1993 domain-containing protein 0.9933 1 164
AF-A0A537G4X9-F1-model_v4 DUF1993 domain-containing protein 0.9933 68 164

Map