F456435

General Info

Members Datasets Scaffolds Average Seq Length
505 300 449 132

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_1159684_c1|nmdc:mga05p37_1159684_c1_46_483
Length 145
Sequence MSTAERCSREYGALVSLERINPDQLARPSGFSHAVVAEGRHVYLAGQTAMDADGRIVGGDIVAQFEQALRNLLTALDAAGGRPEQLASLTIYIVDLDEYKRRARDIGAVWRELAGTTYPAMAGIGVPRLWDDTALVELQGVAVLD

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221548 Streptomyces sp. Root55 Isolate Unclassified
6 2643221578 Streptomyces sp. Root63 Isolate Unclassified
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221670 Streptomyces sp. Root431 Isolate Unclassified
10 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
11 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
12 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
13 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
14 2643221714 Streptomyces sp. Root264 Isolate Unclassified
15 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
16 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
17 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
18 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
19 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
20 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
21 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
22 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
23 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
24 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
25 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
26 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
27 2862574272 Streptomyces sp. AcE210 Isolate Nodule
28 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
29 2867369537 Streptomyces sp. Z26 Isolate Unclassified
30 2867428634 Streptomyces sp. RP5T Isolate Unclassified
31 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
32 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
33 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
34 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
35 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
36 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
37 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
38 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
39 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
40 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
41 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
42 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
43 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
44 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
45 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
46 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
47 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
48 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
49 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
50 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
51 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
52 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
53 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
54 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
55 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
56 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
125 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
159 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
160 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
161 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
162 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
293 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
294 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
298 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
299 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
300 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 1.19
Isolates 11.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0.99
Rhizoplane 1.78
Rhizosphere 83.76
Stem 0
Stem Tuber 0
Unclassified 10.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020446 3300001989 Bacteria 2365
2 JGI24737J22298_10055768 3300001990 Bacteria 1194
3 JGI24735J21928_10034794 3300002067 Bacteria 1484
4 JGI24735J21928_10148607 3300002067 Bacteria 676
5 JGI24738J21930_10017826 3300002075 Bacteria 1490
6 JGI25153J46596_10074871 3300003215 Bacteria 863
7 rootH1_10057779 3300003316 Bacteria 1643
8 rootH1_10060761 3300003316 Bacteria 1035
9 rootL2_10007134 3300003322 Bacteria 4209
10 rootH1_10007816 3300003323 Bacteria 1208
11 Ga0006562J51391_1020963 3300003578 Bacteria 570
12 Ga0006562J51391_1198742 3300003578 Bacteria 1600
13 Ga0070683_100458847 3300005329 Bacteria 1216
14 Ga0070683_101164489 3300005329 Bacteria 741
15 Ga0070689_100372951 3300005340 Bacteria 1201
16 Ga0070709_11458773 3300005434 Bacteria 555
17 Ga0070700_100000003 3300005441 Bacteria 261247
18 Ga0070698_100048360 3300005471 Bacteria 4346
19 Ga0070679_100560504 3300005530 Bacteria 1086
20 Ga0070684_100907283 3300005535 Bacteria 826
21 Ga0068855_100047262 3300005563 Bacteria 5085
22 Ga0068855_100560559 3300005563 Bacteria 1236
23 Ga0068857_100050372 3300005577 Bacteria 3695
24 Ga0068856_100065183 3300005614 Bacteria 3599
25 Ga0068856_100188187 3300005614 Bacteria 2078
26 Ga0081455_10000352 3300005937 Bacteria 60576
27 Ga0081455_10147959 3300005937 Bacteria 1814
28 Ga0081538_10018634 3300005981 Bacteria 5201
29 Ga0070717_11107732 3300006028 Bacteria 721
30 Ga0075365_10176297 3300006038 Bacteria 1493
31 Ga0075365_10342193 3300006038 Bacteria 1054
32 Ga0075363_100061968 3300006048 Bacteria 2016
33 Ga0075363_100140635 3300006048 Bacteria 1359
34 Ga0075363_100190856 3300006048 Bacteria 1169
35 Ga0075432_10095281 3300006058 Bacteria 1094
36 Ga0075370_10089697 3300006353 Bacteria 1773
37 Ga0075370_10215551 3300006353 Bacteria 1134
38 Ga0075428_100003619 3300006844 Bacteria 16938
39 Ga0075430_100006192 3300006846 Bacteria 10087
40 Ga0075431_100001725 3300006847 Bacteria 20568
41 Ga0075431_100001755 3300006847 Bacteria 20403
42 Ga0075429_100001988 3300006880 Bacteria 16983
43 Ga0099826_10330950 3300006948 Bacteria 765
44 Ga0105240_10603750 3300009093 Bacteria 1208
45 Ga0114129_10023082 3300009147 Bacteria 8824
46 Ga0105241_10108507 3300009174 Bacteria 2219
47 Ga0105238_11425915 3300009551 Bacteria 720
48 Ga0105246_10074119 3300011119 Bacteria 2405
49 Ga0105246_10470736 3300011119 Bacteria 1061
50 Ga0105246_12055846 3300011119 Bacteria 552
51 Ga0157347_1025414 3300012502 Bacteria 716
52 Ga0157369_10174649 3300013105 Bacteria 2262
53 Ga0157374_12964800 3300013296 Bacteria 501
54 Ga0157372_10149891 3300013307 Bacteria 2691
55 Ga0157372_13065593 3300013307 Bacteria 534
56 Ga0157375_10481082 3300013308 Bacteria 1407
57 Ga0182008_10086515 3300014497 Bacteria 1543
58 Ga0182008_10275806 3300014497 Bacteria 874
59 Ga0182006_1017706 3300015261 Bacteria 3022
60 Ga0182007_10000129 3300015262 Bacteria 53263
61 Ga0182005_1013736 3300015265 Bacteria 2276
62 Ga0183367_1001 3300015688 Bacteria 1225545
63 Ga0206354_11569546 3300020081 Bacteria 1446
64 Ga0206353_11173208 3300020082 Bacteria 4339
65 Ga0213875_10031785 3300021388 Bacteria 2496
66 Ga0213875_10140605 3300021388 Bacteria 1129
67 Ga0213875_10268351 3300021388 Bacteria 805
68 Ga0224712_10100107 3300022467 Bacteria 1228
69 Ga0224572_1004068 3300024225 Bacteria 2518
70 Ga0228598_1013995 3300024227 Bacteria 1587
71 Ga0209758_1002823 3300025297 Bacteria 16901
72 Ga0207426_1145109 3300025302 Bacteria 559
73 Ga0207647_10026769 3300025904 Bacteria 3768
74 Ga0207647_10085319 3300025904 Bacteria 1889
75 Ga0207654_10770810 3300025911 Bacteria 694
76 Ga0207695_10997777 3300025913 Bacteria 717
77 Ga0207671_10578828 3300025914 Bacteria 895
78 Ga0207652_10456953 3300025921 Bacteria 1151
79 Ga0207694_11510585 3300025924 Bacteria 567
80 Ga0207700_10330994 3300025928 Bacteria 1322
81 Ga0207709_10266104 3300025935 Bacteria 1259
82 Ga0207670_11166734 3300025936 Bacteria 651
83 Ga0207665_10879777 3300025939 Bacteria 710
84 Ga0207661_10219195 3300025944 Bacteria 1681
85 Ga0207667_10042464 3300025949 Bacteria 4833
86 Ga0207708_10000002 3300026075 Bacteria 411071
87 Ga0207674_10444029 3300026116 Bacteria 1254
88 Ga0209371_1024266 3300027312 Bacteria 1414
89 Ga0209282_1383972 3300027666 Bacteria 559
90 Ga0207428_10065386 3300027907 Bacteria 2869
91 Ga0268256_1027553 3300030500 Bacteria 1414
92 Ga0307512_10025078 3300030522 Bacteria 5290
93 Ga0265760_10080770 3300031090 Bacteria 1007
94 Ga0307513_10012522 3300031456 Bacteria 10459
95 Ga0307508_10004826 3300031616 Bacteria 13002
96 Ga0307508_10072568 3300031616 Bacteria 3016
97 Ga0307508_10393578 3300031616 Bacteria 977
98 Ga0307514_10495390 3300031649 Bacteria 583
99 Ga0307516_10720543 3300031730 Bacteria 655
100 Ga0307518_10229745 3300031838 Bacteria 1202
101 Ga0307416_100670540 3300032002 Bacteria 1124
102 Ga0307416_100723620 3300032002 Bacteria 1086
103 Ga0307411_11185418 3300032005 Bacteria 692
104 Ga0307415_100586107 3300032126 Bacteria 990
105 Ga0307507_10109761 3300033179 Bacteria 2261
106 Ga0307510_10542042 3300033180 Bacteria 609
107 Ga0373936_0642638 3300035113 Bacteria 500
108 Ga0373953_0286086 3300035117 Bacteria 719
109 Ga0395899_0421602 3300037312 Bacteria 879
110 Ga0395900_0020500 3300037418 Bacteria 6749
111 Ga0395900_0224281 3300037418 Bacteria 1893
112 Ga0395898_0001533 3300037466 Bacteria 31819
113 Ga0395898_0085895 3300037466 Bacteria 3033
114 Ga0436364_0411600 3300037853 Bacteria 3276
115 Ga0436364_0424988 3300037853 Bacteria 2577
116 Ga0436364_1241828 3300037853 Bacteria 2867
117 Ga0395901_0106620 3300038443 Bacteria 2941
118 Ga0436365_1931413 3300039437 Bacteria 1262
119 Ga0439436_0088426 3300041404 Bacteria 862
120 Ga0451789_0270642 3300041443 Bacteria 1000
121 Ga0451791_0797615 3300041451 Bacteria 731
122 Ga0451793_1198551 3300041452 Bacteria 563
123 Ga0451797_0037216 3300041453 Bacteria 1163
124 Ga0451833_1147405 3300041491 Bacteria 1154
125 Ga0451847_0841898 3300041503 Bacteria 628
126 Ga0451853_0231615 3300041512 Bacteria 894
127 Ga0451853_2451145 3300041512 Bacteria 4537
128 Ga0451853_3631754 3300041512 Bacteria 1405
129 Ga0439442_022775 3300042002 Bacteria 1301
130 Ga0439448_0005487 3300042005 Bacteria 3616
131 Ga0439448_0313460 3300042005 Bacteria 558
132 Ga0439449_0001397 3300042007 Bacteria 9433
133 Ga0439449_0044454 3300042007 Bacteria 1647
134 Ga0439449_0137691 3300042007 Bacteria 908
135 Ga0439450_018581 3300042008 Bacteria 1462
136 Ga0439455_0018262 3300042012 Bacteria 1643
137 Ga0439456_108264 3300042013 Bacteria 632
138 Ga0439457_002184 3300042014 Bacteria 5661
139 Ga0439457_013738 3300042014 Bacteria 1817
140 Ga0450890_014911 3300042127 Bacteria 1020
141 Ga0450902_018722 3300042137 Bacteria 1137
142 Ga0450903_000502 3300042138 Bacteria 8199
143 Ga0439458_0017853 3300042157 Bacteria 1622
144 Ga0466969_0005688 3300044656 Bacteria 6628
145 Ga0466969_0086878 3300044656 Bacteria 1485
146 Ga0466972_0020771 3300044658 Bacteria 3279
147 Ga0466972_0055773 3300044658 Bacteria 1900
148 Ga0466965_0001179 3300044683 Bacteria 10302
149 Ga0466965_0048637 3300044683 Bacteria 2101
150 Ga0466965_0275670 3300044683 Bacteria 907
151 Ga0466966_0016819 3300044684 Bacteria 4832
152 Ga0466966_0089851 3300044684 Bacteria 1908
153 Ga0466966_0118082 3300044684 Bacteria 1631
154 Ga0466966_0231522 3300044684 Bacteria 1114
155 Ga0466966_0267672 3300044684 Bacteria 1028
156 Ga0466966_0519751 3300044684 Bacteria 716
157 Ga0466961_0020033 3300044693 Bacteria 4304
158 Ga0466961_0061372 3300044693 Bacteria 2389
159 Ga0466961_0182772 3300044693 Bacteria 1301
160 Ga0466961_0214309 3300044693 Bacteria 1188
161 Ga0466961_0241929 3300044693 Bacteria 1109
162 Ga0466961_0339105 3300044693 Bacteria 915
163 Ga0466963_0002112 3300044694 Bacteria 10990
164 Ga0466963_0197223 3300044694 Bacteria 1408
165 Ga0466963_0240198 3300044694 Bacteria 1270
166 Ga0466963_0674720 3300044694 Bacteria 729
167 Ga0466964_0030850 3300044706 Bacteria 2123
168 Ga0466964_0262847 3300044706 Bacteria 856
169 Ga0466971_0003023 3300044719 Bacteria 7147
170 Ga0466971_0546714 3300044719 Bacteria 574
171 Ga0466971_0547221 3300044719 Bacteria 574
172 Ga0466968_0067803 3300044735 Bacteria 1548
173 Ga0466968_0173647 3300044735 Bacteria 1000
174 Ga0466970_0002404 3300044765 Bacteria 9043
175 Ga0466970_0053683 3300044765 Bacteria 2152
176 Ga0466970_0083431 3300044765 Bacteria 1729
177 Ga0466957_0001587 3300044842 Bacteria 11937
178 Ga0466957_0357076 3300044842 Bacteria 992
179 Ga0466960_0048172 3300044901 Bacteria 2047
180 Ga0466960_0052248 3300044901 Bacteria 1976
181 Ga0466960_0119085 3300044901 Bacteria 1381
182 Ga0466960_0239653 3300044901 Bacteria 1004
183 Ga0466960_0317836 3300044901 Bacteria 881
184 Ga0466960_0369682 3300044901 Bacteria 821
185 Ga0466959_0095803 3300045049 Bacteria 2128
186 Ga0466959_0171435 3300045049 Bacteria 1522
187 Ga0466959_0199110 3300045049 Bacteria 1395
188 Ga0466959_0260143 3300045049 Bacteria 1195
189 Ga0466959_0380376 3300045049 Bacteria 961
190 Ga0466959_0472238 3300045049 Bacteria 849
191 Ga0466959_0496317 3300045049 Bacteria 825
192 Ga0466958_0009526 3300045836 Bacteria 5415
193 Ga0466958_0151857 3300045836 Bacteria 1461
194 Ga0466958_0391663 3300045836 Bacteria 896
195 Ga0466967_0010635 3300045976 Bacteria 6915
196 Ga0466967_0040024 3300045976 Bacteria 4033
197 Ga0466967_0044798 3300045976 Bacteria 3840
198 Ga0466967_0167767 3300045976 Bacteria 2064
199 Ga0466967_0298172 3300045976 Bacteria 1550
200 Ga0466967_0385967 3300045976 Bacteria 1360
201 Ga0466967_1122412 3300045976 Bacteria 783
202 Ga0466967_1938589 3300045976 Bacteria 586
203 Ga0466967_1991204 3300045976 Bacteria 577
204 Ga0466967_2162125 3300045976 Bacteria 552
205 Ga0495617_009331 3300046452 Bacteria 3367
206 Ga0495627_020310 3300046453 Bacteria 2215
207 Ga0495627_081871 3300046453 Bacteria 935
208 Ga0495592_0018118 3300046454 Bacteria 5350
209 Ga0495592_0107119 3300046454 Bacteria 1983
210 Ga0495603_0001177 3300046455 Bacteria 15234
211 Ga0495603_0004380 3300046455 Bacteria 8413
212 Ga0495603_0004858 3300046455 Bacteria 8037
213 Ga0495603_0014177 3300046455 Bacteria 4822
214 Ga0495603_0049499 3300046455 Bacteria 2501
215 Ga0495603_0163413 3300046455 Bacteria 1291
216 Ga0495629_0001112 3300046459 Bacteria 21291
217 Ga0495629_0002571 3300046459 Bacteria 13908
218 Ga0495629_0016752 3300046459 Bacteria 5259
219 Ga0495629_0048662 3300046459 Bacteria 2972
220 Ga0495629_0076301 3300046459 Bacteria 2340
221 Ga0495638_0057060 3300046460 Bacteria 2423
222 Ga0495638_0147027 3300046460 Bacteria 1370
223 Ga0495638_0165167 3300046460 Bacteria 1274
224 Ga0495651_0047349 3300046462 Bacteria 3325
225 Ga0495651_0330326 3300046462 Bacteria 1013
226 Ga0495582_0105356 3300046473 Bacteria 1581
227 Ga0495582_0304381 3300046473 Bacteria 916
228 Ga0495582_0926158 3300046473 Bacteria 504
229 Ga0495605_0316425 3300046474 Bacteria 658
230 Ga0495639_0035540 3300046475 Bacteria 2229
231 Ga0495662_0000376 3300046476 Bacteria 19754
232 Ga0495662_0022476 3300046476 Bacteria 3045
233 Ga0495662_0174038 3300046476 Bacteria 1061
234 Ga0495664_0155466 3300046477 Bacteria 1387
235 Ga0495664_0461873 3300046477 Bacteria 760
236 Ga0495584_0095583 3300046491 Bacteria 1500
237 Ga0495585_0107523 3300046492 Bacteria 1486
238 Ga0495585_0413906 3300046492 Bacteria 648
239 Ga0495594_0001188 3300046499 Bacteria 13626
240 Ga0495594_0009615 3300046499 Bacteria 4998
241 Ga0495594_0025955 3300046499 Bacteria 3151
242 Ga0495594_0081636 3300046499 Bacteria 1805
243 Ga0495594_0243819 3300046499 Bacteria 1024
244 Ga0495594_0387218 3300046499 Bacteria 795
245 Ga0495594_0870865 3300046499 Bacteria 506
246 Ga0495596_0182977 3300046500 Bacteria 815
247 Ga0495583_0030848 3300046506 Bacteria 2605
248 Ga0495583_0200332 3300046506 Bacteria 811
249 Ga0495583_0357873 3300046506 Bacteria 575
250 Ga0495606_0024579 3300046507 Bacteria 4336
251 Ga0495608_0060530 3300046511 Bacteria 2491
252 Ga0495610_0015806 3300046512 Bacteria 4371
253 Ga0495616_0032403 3300046513 Bacteria 2730
254 Ga0495616_0233523 3300046513 Bacteria 796
255 Ga0495618_0087445 3300046514 Bacteria 1993
256 Ga0495618_0092075 3300046514 Bacteria 1938
257 Ga0495618_0649160 3300046514 Bacteria 624
258 Ga0495620_0004818 3300046515 Bacteria 7583
259 Ga0495620_0169328 3300046515 Bacteria 847
260 Ga0495628_0004108 3300046516 Bacteria 12953
261 Ga0495628_0736774 3300046516 Bacteria 693
262 Ga0495628_0778778 3300046516 Bacteria 670
263 Ga0495631_0018135 3300046518 Bacteria 3317
264 Ga0495631_0103669 3300046518 Bacteria 1224
265 Ga0495631_0323453 3300046518 Bacteria 656
266 Ga0495632_0042804 3300046519 Bacteria 2268
267 Ga0495637_0112749 3300046520 Bacteria 1052
268 Ga0495643_0003273 3300046522 Bacteria 11987
269 Ga0495648_0103364 3300046524 Bacteria 1567
270 Ga0495666_0018157 3300046526 Bacteria 3503
271 Ga0495666_0136741 3300046526 Bacteria 1144
272 Ga0495642_0071545 3300046528 Bacteria 1451
273 Ga0495652_0100229 3300046529 Bacteria 2350
274 Ga0495652_1112685 3300046529 Bacteria 512
275 Ga0495640_0005838 3300046533 Bacteria 9776
276 Ga0495640_0051641 3300046533 Bacteria 2825
277 Ga0495609_0098428 3300046538 Bacteria 1268
278 Ga0495597_0021732 3300046542 Bacteria 2982
279 Ga0495597_0023511 3300046542 Bacteria 2850
280 Ga0495597_0277783 3300046542 Bacteria 653
281 Ga0495645_0395012 3300046543 Bacteria 882
282 Ga0495645_0860832 3300046543 Bacteria 540
283 Ga0495622_0004928 3300046557 Bacteria 6181
284 Ga0495622_0041211 3300046557 Bacteria 2147
285 Ga0495622_0418340 3300046557 Bacteria 576
286 Ga0495633_0170031 3300046558 Bacteria 1004
287 Ga0495667_0096636 3300046559 Bacteria 1912
288 Ga0495656_0368046 3300046615 Bacteria 747
289 Ga0495668_0069197 3300046616 Bacteria 1941
290 Ga0495634_0190998 3300046642 Bacteria 1277
291 Ga0495611_0069173 3300046648 Bacteria 1612
292 Ga0495611_0228396 3300046648 Bacteria 865
293 Ga0495625_0067097 3300046660 Bacteria 2526
294 Ga0495625_0077574 3300046660 Bacteria 2320
295 Ga0495625_0502264 3300046660 Bacteria 741
296 Ga0495635_0027370 3300046663 Bacteria 3966
297 Ga0495635_0260234 3300046663 Bacteria 1168
298 Ga0495635_0426333 3300046663 Bacteria 879
299 Ga0495635_0496254 3300046663 Bacteria 804
300 Ga0495635_0565380 3300046663 Bacteria 744
301 Ga0495661_0137669 3300046665 Bacteria 1331
302 Ga0495588_0000835 3300046674 Bacteria 13655
303 Ga0495588_0174928 3300046674 Bacteria 1135
304 Ga0495588_0239862 3300046674 Bacteria 956
305 Ga0495657_0008117 3300046675 Bacteria 8050
306 Ga0495657_0021772 3300046675 Bacteria 4598
307 Ga0495657_0057847 3300046675 Bacteria 2576
308 Ga0495623_0153491 3300046679 Bacteria 1359
309 Ga0495623_0305379 3300046679 Bacteria 878
310 Ga0495646_0143210 3300046680 Bacteria 1335
311 Ga0495613_0006723 3300046689 Bacteria 8586
312 Ga0495613_0018505 3300046689 Bacteria 5193
313 Ga0495613_0044065 3300046689 Bacteria 3301
314 Ga0495613_0089289 3300046689 Bacteria 2232
315 Ga0495613_0129133 3300046689 Bacteria 1810
316 Ga0495613_0280376 3300046689 Bacteria 1157
317 Ga0495624_0025235 3300046690 Bacteria 3904
318 Ga0495624_0043042 3300046690 Bacteria 2882
319 Ga0495670_0147740 3300046691 Bacteria 1232
320 Ga0495670_0235493 3300046691 Bacteria 974
321 Ga0495671_0171938 3300046692 Bacteria 1053
322 Ga0495649_0014093 3300046694 Bacteria 4592
323 Ga0495649_0330320 3300046694 Bacteria 773
324 Ga0495589_0012689 3300046794 Bacteria 4357
325 Ga0495589_0020163 3300046794 Bacteria 3411
326 Ga0495589_0053257 3300046794 Bacteria 1997
327 Ga0495600_0047740 3300046809 Bacteria 2793
328 Ga0495600_0105585 3300046809 Bacteria 1835
329 Ga0495660_0204643 3300046810 Bacteria 940
330 Ga0495581_0023679 3300047315 Bacteria 3557
331 Ga0495581_0099986 3300047315 Bacteria 1685
332 Ga0495581_0103243 3300047315 Bacteria 1657
333 Ga0495604_0075837 3300047317 Bacteria 2530
334 Ga0495604_0262748 3300047317 Bacteria 1172
335 Ga0495604_0485017 3300047317 Bacteria 803
336 Ga0495636_0004176 3300047318 Bacteria 5669
337 Ga0495636_0024781 3300047318 Bacteria 2435
338 Ga0495636_0036820 3300047318 Bacteria 2019
339 Ga0495636_0151345 3300047318 Bacteria 1041
340 Ga0495636_0272012 3300047318 Bacteria 787
341 Ga0495674_0134414 3300047319 Bacteria 2082
342 Ga0495672_0130685 3300047320 Bacteria 1321
343 Ga0495676_0001036 3300047321 Bacteria 23480
344 Ga0495676_0002499 3300047321 Bacteria 16364
345 Ga0495676_0024436 3300047321 Bacteria 5230
346 Ga0495676_0040601 3300047321 Bacteria 3837
347 Ga0495676_0044357 3300047321 Bacteria 3629
348 Ga0495676_0054316 3300047321 Bacteria 3185
349 Ga0495680_0001234 3300047322 Bacteria 28056
350 Ga0495680_0710192 3300047322 Bacteria 663
351 Ga0495683_0063754 3300047323 Bacteria 1820
352 Ga0495683_0155826 3300047323 Bacteria 1059
353 Ga0495683_0388391 3300047323 Bacteria 582
354 Ga0495683_0400482 3300047323 Bacteria 571
355 Ga0495687_083787 3300047443 Bacteria 1240
356 Ga0495687_105467 3300047443 Bacteria 1048
357 Ga0495687_112935 3300047443 Bacteria 995
358 Ga0495687_140268 3300047443 Bacteria 841
359 Ga0495675_0013779 3300047444 Bacteria 5110
360 Ga0495677_0077287 3300047445 Bacteria 1245
361 Ga0495677_0131892 3300047445 Bacteria 957
362 Ga0495679_080844 3300047446 Bacteria 923
363 Ga0495685_007461 3300047447 Bacteria 3611
364 Ga0495685_013099 3300047447 Bacteria 2813
365 Ga0495685_016412 3300047447 Bacteria 2529
366 Ga0495685_018347 3300047447 Bacteria 2401
367 Ga0495685_026109 3300047447 Bacteria 2010
368 Ga0495685_027113 3300047447 Bacteria 1970
369 Ga0495685_029024 3300047447 Bacteria 1903
370 Ga0495685_034338 3300047447 Bacteria 1742
371 Ga0495685_084270 3300047447 Bacteria 1057
372 Ga0495685_093692 3300047447 Bacteria 994
373 Ga0495681_0165290 3300047470 Bacteria 919
374 Ga0495593_0020451 3300047673 Bacteria 3706
375 Ga0495593_0080676 3300047673 Bacteria 1683
376 Ga0495593_0117540 3300047673 Bacteria 1354
377 Ga0495593_0412869 3300047673 Bacteria 675
378 Ga0495602_0425259 3300048088 Bacteria 942
379 Ga0495614_0008692 3300048089 Bacteria 4515
380 Ga0495614_0326311 3300048089 Bacteria 712
381 Ga0495626_0083188 3300048091 Bacteria 1418
382 Ga0495626_0169336 3300048091 Bacteria 911
383 Ga0496100_0906672 3300048903 Bacteria 692
384 Ga0496102_1749206 3300048905 Bacteria 539
385 Ga0496106_0094550 3300048909 Bacteria 2311
386 Ga0496108_0472142 3300048911 Bacteria 1096
387 Ga0496109_0004022 3300048912 Bacteria 12277
388 Ga0495678_197562 3300049459 Bacteria 622
389 Ga0495682_0031278 3300049460 Bacteria 1967
390 Ga0501032_0007045 3300049569 Bacteria 8247
391 Ga0501032_0225066 3300049569 Bacteria 1220
392 Ga0501033_0670212 3300049570 Bacteria 707
393 Ga0501034_0059600 3300049571 Bacteria 3834
394 Ga0501034_0114606 3300049571 Bacteria 2684
395 Ga0501034_0548615 3300049571 Bacteria 1065
396 Ga0501036_0052093 3300049572 Bacteria 3466
397 Ga0501036_0372466 3300049572 Bacteria 1192
398 Ga0501036_0395583 3300049572 Bacteria 1153
399 Ga0501038_0017443 3300049574 Bacteria 6490
400 Ga0501038_0157525 3300049574 Bacteria 1848
401 Ga0501043_0740067 3300049579 Bacteria 716
402 Ga0501046_0657065 3300049580 Bacteria 741
403 Ga0501047_0015719 3300049581 Bacteria 7211
404 Ga0501047_0274255 3300049581 Bacteria 1532
405 Ga0501047_0303755 3300049581 Bacteria 1438
406 Ga0501067_0009599 3300049583 Bacteria 5360
407 Ga0501067_0737613 3300049583 Bacteria 554
408 Ga0501069_0392592 3300049585 Bacteria 820
409 Ga0501070_0036052 3300049586 Bacteria 4130
410 Ga0501070_0336715 3300049586 Bacteria 1226
411 Ga0501070_0548755 3300049586 Bacteria 925
412 Ga0501070_0580676 3300049586 Bacteria 895
413 Ga0501070_1327679 3300049586 Bacteria 548
414 Ga0501071_0202465 3300049587 Bacteria 1491
415 Ga0501072_0004348 3300049588 Bacteria 10753
416 Ga0501073_0042638 3300049589 Bacteria 3201
417 Ga0501073_0161316 3300049589 Bacteria 1553
418 Ga0501074_0176291 3300049590 Bacteria 1525
419 Ga0501074_1218574 3300049590 Bacteria 528
420 Ga0501079_0239880 3300049741 Bacteria 1416
421 Ga0501080_0016400 3300049742 Bacteria 6841
422 Ga0501083_0335964 3300049744 Bacteria 982
423 Ga0501035_0013175 3300049822 Bacteria 7632
424 Ga0501035_0184138 3300049822 Bacteria 1798
425 Ga0501035_0502688 3300049822 Bacteria 997
426 Ga0501044_0001972 3300049823 Bacteria 23738
427 Ga0501044_0018759 3300049823 Bacteria 7410
428 Ga0501044_0061532 3300049823 Bacteria 3840
429 Ga0501044_0158888 3300049823 Bacteria 2238
430 Ga0501045_0254651 3300049824 Bacteria 1307
431 nmdc:mga03n38_198716_c1 3300050490 Bacteria 1037
432 nmdc:mga0yw44_274905_c1 3300050492 Bacteria 1125
433 nmdc:mga07m45_423288_c1 3300050496 Bacteria 772
434 nmdc:mga05p37_1159684_c1 3300050507 Bacteria 803
435 nmdc:mga05p37_573_c1 3300050507 Bacteria 40363
436 nmdc:mga09592_227_c1 3300050508 Bacteria 40641
437 nmdc:mga09592_495282_c1 3300050508 Bacteria 1052
438 nmdc:mga09592_613378_c1 3300050508 Bacteria 931
439 nmdc:mga0qj67_14713_c1 3300050509 Bacteria 5916
440 nmdc:mga06r32_25027_c1 3300050510 Bacteria 5547
441 nmdc:mga06r32_83_c1 3300050510 Bacteria 64174
442 nmdc:mga08y16_1700_c1 3300050511 Bacteria 22309
443 Ga0495601_0098220 3300053077 Bacteria 1890
444 Ga0495655_0128012 3300053083 Bacteria 779
445 Ga0500600_0236774 3300053149 Bacteria 829
446 Ga0500587_028712 3300053739 Bacteria 755
447 Ga0501084_0182622 3300054114 Bacteria 1771
448 Ga0466962_0017597 3300061719 Bacteria 3440
449 Ga0466962_0499323 3300061719 Bacteria 616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0547221 Ga0466971_0547221_220_561 112
2 3300031649 Ga0307514_10495390 Ga0307514_104953901 122
3 3300041512 Ga0451853_3631754 Ga0451853_3631754_550_948 125
4 iso_pu_bacteria 2675903059 2676479749 126
5 3300030522 Ga0307512_10025078 Ga0307512_100250782 127
6 3300031616 Ga0307508_10072568 Ga0307508_100725683 127
7 3300033180 Ga0307510_10542042 Ga0307510_105420421 127
8 iso_pu_bacteria 2935390628 2935391088 127
9 iso_pu_bacteria 2582581313 2585307396 128
10 iso_pu_bacteria 2582581314 2585317478 128
11 iso_pu_bacteria 2616644814 2616699189 128
12 iso_pu_bacteria 2643221587 2643943542 128
13 iso_pu_bacteria 2643221647 2644264935 128
14 iso_pu_bacteria 2643221670 2644388358 128
15 iso_pu_bacteria 2643221677 2644430856 128
16 iso_pu_bacteria 2643221678 2644442448 128
17 iso_pu_bacteria 2643221714 2644626608 128
18 iso_pu_bacteria 2643221962 2645725231 128
19 iso_pu_bacteria 2784746763 2785340604 128
20 iso_pu_bacteria 2784746768 2785372160 128
21 iso_pu_bacteria 2786546132 2786673246 128
22 iso_pu_bacteria 2808606359 2808844618 128
23 iso_pu_bacteria 2808606982 2811843879 128
24 iso_pu_bacteria 2811994879 2812355345 128
25 iso_pu_bacteria 2862178590 2862180258 128
26 iso_pu_bacteria 2862290372 2862294071 128
27 iso_pu_bacteria 2862382967 2862385455 128
28 iso_pu_bacteria 2862507626 2862514667 128
29 iso_pu_bacteria 2863404153 2863409232 128
30 iso_pu_bacteria 2867369537 2867374413 128
31 iso_pu_bacteria 2867428634 2867432497 128
32 iso_pu_bacteria 2873151551 2873153470 128
33 iso_pu_bacteria 2877676314 2877678468 128
34 iso_pu_bacteria 2919468124 2919474843 128
35 iso_pu_bacteria 2946064051 2946070531 128
36 iso_pu_bacteria 2946072368 2946078306 128
37 iso_pu_bacteria 2947224130 2947226308 128
38 iso_pu_bacteria 2954002825 2954010539 128
39 iso_pu_bacteria 2954380949 2954383425 128
40 iso_pu_bacteria 2954673503 2954679546 128
41 iso_pu_bacteria 2954682443 2954684607 128
42 iso_pu_bacteria 2954691527 2954694203 128
43 iso_pu_bacteria 2954701450 2954709315 128
44 iso_pu_bacteria 2954711539 2954713738 128
45 iso_pu_bacteria 2954721474 2954723704 128
46 iso_pu_bacteria 2954731030 2954738132 128
47 iso_pu_bacteria 2954749733 2954756990 128
48 iso_pu_bacteria 2990059506 2990064179 128
49 iso_pu_bacteria 8008558824 8008563332 128
50 iso_pu_bacteria 8048406513 8048409419 128
51 iso_pu_bacteria 8056667051 8056672052 128
52 3300002067 JGI24735J21928_10148607 JGI24735J21928_101486072 129
53 3300005563 Ga0068855_100047262 Ga0068855_1000472624 129
54 3300005563 Ga0068855_100560559 Ga0068855_1005605592 129
55 3300005614 Ga0068856_100065183 Ga0068856_1000651833 129
56 3300009093 Ga0105240_10603750 Ga0105240_106037501 129
57 3300009174 Ga0105241_10108507 Ga0105241_101085073 129
58 3300025904 Ga0207647_10085319 Ga0207647_100853193 129
59 3300025911 Ga0207654_10770810 Ga0207654_107708102 129
60 3300025913 Ga0207695_10997777 Ga0207695_109977772 129
61 3300025914 Ga0207671_10578828 Ga0207671_105788281 129
62 3300025949 Ga0207667_10042464 Ga0207667_100424645 129
63 3300026116 Ga0207674_10444029 Ga0207674_104440292 129
64 3300041512 Ga0451853_0231615 Ga0451853_0231615_35_424 129
65 3300049590 Ga0501074_1218574 Ga0501074_1218574_12_401 129
66 3300053083 Ga0495655_0128012 Ga0495655_0128012_70_459 129
67 iso_pu_bacteria 2582581312 2585297084 129
68 iso_pu_bacteria 2643221548 2643760945 129
69 iso_pu_bacteria 2643221578 2643904291 129
70 iso_pu_bacteria 2643221673 2644402645 129
71 iso_pu_bacteria 2643221682 2644462268 129
72 iso_pu_bacteria 2862574272 2862576879 129
73 iso_pu_bacteria 2875391855 2875397301 129
74 iso_pu_bacteria 2946045630 2946047268 129
75 3300006028 Ga0070717_11107732 Ga0070717_111077321 130
76 3300011119 Ga0105246_10470736 Ga0105246_104707362 130
77 3300025928 Ga0207700_10330994 Ga0207700_103309942 130
78 3300032002 Ga0307416_100670540 Ga0307416_1006705402 130
79 3300032126 Ga0307415_100586107 Ga0307415_1005861072 130
80 3300035117 Ga0373953_0286086 Ga0373953_0286086_144_566 130
81 3300044684 Ga0466966_0089851 Ga0466966_0089851_514_906 130
82 3300045049 Ga0466959_0199110 Ga0466959_0199110_81_473 130
83 3300045976 Ga0466967_1122412 Ga0466967_1122412_340_741 130
84 3300046663 Ga0495635_0426333 Ga0495635_0426333_423_845 130
85 3300047323 Ga0495683_0063754 Ga0495683_0063754_1360_1752 130
86 3300049571 Ga0501034_0059600 Ga0501034_0059600_3016_3411 130
87 3300049572 Ga0501036_0372466 Ga0501036_0372466_459_854 130
88 3300049574 Ga0501038_0157525 Ga0501038_0157525_997_1392 130
89 3300049583 Ga0501067_0009599 Ga0501067_0009599_2729_3124 130
90 3300049585 Ga0501069_0392592 Ga0501069_0392592_341_736 130
91 3300049586 Ga0501070_0036052 Ga0501070_0036052_1554_1949 130
92 3300049587 Ga0501071_0202465 Ga0501071_0202465_334_729 130
93 3300049588 Ga0501072_0004348 Ga0501072_0004348_8905_9300 130
94 3300049589 Ga0501073_0042638 Ga0501073_0042638_2243_2638 130
95 3300049590 Ga0501074_0176291 Ga0501074_0176291_430_825 130
96 3300049741 Ga0501079_0239880 Ga0501079_0239880_301_696 130
97 3300049742 Ga0501080_0016400 Ga0501080_0016400_3058_3453 130
98 3300049744 Ga0501083_0335964 Ga0501083_0335964_430_825 130
99 3300054114 Ga0501084_0182622 Ga0501084_0182622_242_637 130
100 iso_pu_bacteria 2870782633 2870786629 130
101 3300005340 Ga0070689_100372951 Ga0070689_1003729511 131
102 3300005471 Ga0070698_100048360 Ga0070698_1000483603 131
103 3300005577 Ga0068857_100050372 Ga0068857_1000503722 131
104 3300005937 Ga0081455_10000352 Ga0081455_100003524 131
105 3300005937 Ga0081455_10147959 Ga0081455_101479592 131
106 3300005981 Ga0081538_10018634 Ga0081538_100186345 131
107 3300006058 Ga0075432_10095281 Ga0075432_100952812 131
108 3300006844 Ga0075428_100003619 Ga0075428_1000036195 131
109 3300006846 Ga0075430_100006192 Ga0075430_1000061928 131
110 3300006847 Ga0075431_100001725 Ga0075431_10000172510 131
111 3300006847 Ga0075431_100001755 Ga0075431_10000175518 131
112 3300006880 Ga0075429_100001988 Ga0075429_10000198817 131
113 3300009147 Ga0114129_10023082 Ga0114129_100230822 131
114 3300021388 Ga0213875_10140605 Ga0213875_101406052 131
115 3300021388 Ga0213875_10268351 Ga0213875_102683512 131
116 3300022467 Ga0224712_10100107 Ga0224712_101001072 131
117 3300024225 Ga0224572_1004068 Ga0224572_10040682 131
118 3300024227 Ga0228598_1013995 Ga0228598_10139952 131
119 3300025936 Ga0207670_11166734 Ga0207670_111667341 131
120 3300027907 Ga0207428_10065386 Ga0207428_100653862 131
121 3300031090 Ga0265760_10080770 Ga0265760_100807702 131
122 3300032005 Ga0307411_11185418 Ga0307411_111854181 131
123 3300035113 Ga0373936_0642638 Ga0373936_0642638_25_423 131
124 3300037853 Ga0436364_0411600 Ga0436364_0411600_674_1075 131
125 3300037853 Ga0436364_0424988 Ga0436364_0424988_764_1180 131
126 3300039437 Ga0436365_1931413 Ga0436365_1931413_353_751 131
127 3300044842 Ga0466957_0357076 Ga0466957_0357076_456_857 131
128 3300045049 Ga0466959_0171435 Ga0466959_0171435_768_1166 131
129 3300045049 Ga0466959_0496317 Ga0466959_0496317_411_812 131
130 3300045836 Ga0466958_0151857 Ga0466958_0151857_729_1130 131
131 3300045976 Ga0466967_2162125 Ga0466967_2162125_32_433 131
132 3300046477 Ga0495664_0461873 Ga0495664_0461873_294_692 131
133 3300046514 Ga0495618_0649160 Ga0495618_0649160_103_501 131
134 3300046529 Ga0495652_1112685 Ga0495652_1112685_97_495 131
135 3300046543 Ga0495645_0395012 Ga0495645_0395012_87_485 131
136 3300050507 nmdc:mga05p37_1159684_c1 nmdc:mga05p37_1159684_c1_46_483 131
137 3300050507 nmdc:mga05p37_573_c1 nmdc:mga05p37_573_c1_36119_36520 131
138 3300050508 nmdc:mga09592_227_c1 nmdc:mga09592_227_c1_11476_11877 131
139 3300050508 nmdc:mga09592_495282_c1 nmdc:mga09592_495282_c1_11_427 131
140 3300050508 nmdc:mga09592_613378_c1 nmdc:mga09592_613378_c1_482_877 131
141 3300050509 nmdc:mga0qj67_14713_c1 nmdc:mga0qj67_14713_c1_1310_1711 131
142 3300050510 nmdc:mga06r32_25027_c1 nmdc:mga06r32_25027_c1_3007_3402 131
143 3300050510 nmdc:mga06r32_83_c1 nmdc:mga06r32_83_c1_43177_43578 131
144 3300050511 nmdc:mga08y16_1700_c1 nmdc:mga08y16_1700_c1_10352_10753 131
145 3300053077 Ga0495601_0098220 Ga0495601_0098220_1012_1434 131
146 3300001989 JGI24739J22299_10020446 JGI24739J22299_100204464 132
147 3300001990 JGI24737J22298_10055768 JGI24737J22298_100557682 132
148 3300002067 JGI24735J21928_10034794 JGI24735J21928_100347942 132
149 3300002075 JGI24738J21930_10017826 JGI24738J21930_100178262 132
150 3300003215 JGI25153J46596_10074871 JGI25153J46596_100748711 132
151 3300003316 rootH1_10057779 rootH1_100577794 132
152 3300003316 rootH1_10060761 rootH1_100607612 132
153 3300003322 rootL2_10007134 rootL2_100071345 132
154 3300003323 rootH1_10007816 rootH1_100078161 132
155 3300003578 Ga0006562J51391_1020963 Ga0006562J51391_10209631 132
156 3300003578 Ga0006562J51391_1198742 Ga0006562J51391_11987422 132
157 3300005329 Ga0070683_100458847 Ga0070683_1004588471 132
158 3300005329 Ga0070683_101164489 Ga0070683_1011644892 132
159 3300005434 Ga0070709_11458773 Ga0070709_114587731 132
160 3300005441 Ga0070700_100000003 Ga0070700_10000000313 132
161 3300005530 Ga0070679_100560504 Ga0070679_1005605041 132
162 3300005535 Ga0070684_100907283 Ga0070684_1009072832 132
163 3300005614 Ga0068856_100188187 Ga0068856_1001881872 132
164 3300006038 Ga0075365_10176297 Ga0075365_101762972 132
165 3300006038 Ga0075365_10342193 Ga0075365_103421932 132
166 3300006048 Ga0075363_100061968 Ga0075363_1000619682 132
167 3300006048 Ga0075363_100140635 Ga0075363_1001406352 132
168 3300006048 Ga0075363_100190856 Ga0075363_1001908562 132
169 3300006353 Ga0075370_10089697 Ga0075370_100896972 132
170 3300006353 Ga0075370_10215551 Ga0075370_102155512 132
171 3300006948 Ga0099826_10330950 Ga0099826_103309502 132
172 3300009551 Ga0105238_11425915 Ga0105238_114259151 132
173 3300011119 Ga0105246_10074119 Ga0105246_100741192 132
174 3300011119 Ga0105246_12055846 Ga0105246_120558461 132
175 3300012502 Ga0157347_1025414 Ga0157347_10254142 132
176 3300013105 Ga0157369_10174649 Ga0157369_101746492 132
177 3300013296 Ga0157374_12964800 Ga0157374_129648002 132
178 3300013307 Ga0157372_10149891 Ga0157372_101498913 132
179 3300013307 Ga0157372_13065593 Ga0157372_130655931 132
180 3300013308 Ga0157375_10481082 Ga0157375_104810822 132
181 3300014497 Ga0182008_10086515 Ga0182008_100865152 132
182 3300014497 Ga0182008_10275806 Ga0182008_102758061 132
183 3300015261 Ga0182006_1017706 Ga0182006_10177063 132
184 3300015262 Ga0182007_10000129 Ga0182007_1000012916 132
185 3300015265 Ga0182005_1013736 Ga0182005_10137361 132
186 3300015688 Ga0183367_1001 Ga0183367_1001128 132
187 3300020081 Ga0206354_11569546 Ga0206354_115695462 132
188 3300020082 Ga0206353_11173208 Ga0206353_111732084 132
189 3300021388 Ga0213875_10031785 Ga0213875_100317854 132
190 3300025297 Ga0209758_1002823 Ga0209758_100282312 132
191 3300025302 Ga0207426_1145109 Ga0207426_11451092 132
192 3300025904 Ga0207647_10026769 Ga0207647_100267692 132
193 3300025921 Ga0207652_10456953 Ga0207652_104569532 132
194 3300025924 Ga0207694_11510585 Ga0207694_115105851 132
195 3300025935 Ga0207709_10266104 Ga0207709_102661041 132
196 3300025939 Ga0207665_10879777 Ga0207665_108797771 132
197 3300025944 Ga0207661_10219195 Ga0207661_102191951 132
198 3300026075 Ga0207708_10000002 Ga0207708_10000002153 132
199 3300027312 Ga0209371_1024266 Ga0209371_10242662 132
200 3300027666 Ga0209282_1383972 Ga0209282_13839721 132
201 3300030500 Ga0268256_1027553 Ga0268256_10275532 132
202 3300031456 Ga0307513_10012522 Ga0307513_100125223 132
203 3300031616 Ga0307508_10004826 Ga0307508_1000482612 132
204 3300031616 Ga0307508_10393578 Ga0307508_103935782 132
205 3300031730 Ga0307516_10720543 Ga0307516_107205431 132
206 3300031838 Ga0307518_10229745 Ga0307518_102297452 132
207 3300032002 Ga0307416_100723620 Ga0307416_1007236201 132
208 3300033179 Ga0307507_10109761 Ga0307507_101097612 132
209 3300037312 Ga0395899_0421602 Ga0395899_0421602_20_424 132
210 3300037418 Ga0395900_0020500 Ga0395900_0020500_4551_4955 132
211 3300037418 Ga0395900_0224281 Ga0395900_0224281_1280_1681 132
212 3300037466 Ga0395898_0001533 Ga0395898_0001533_6867_7265 132
213 3300037466 Ga0395898_0085895 Ga0395898_0085895_1065_1466 132
214 3300037853 Ga0436364_1241828 Ga0436364_1241828_641_1042 132
215 3300038443 Ga0395901_0106620 Ga0395901_0106620_2324_2725 132
216 3300041404 Ga0439436_0088426 Ga0439436_0088426_108_506 132
217 3300041443 Ga0451789_0270642 Ga0451789_0270642_528_926 132
218 3300041451 Ga0451791_0797615 Ga0451791_0797615_235_633 132
219 3300041452 Ga0451793_1198551 Ga0451793_1198551_103_501 132
220 3300041453 Ga0451797_0037216 Ga0451797_0037216_698_1096 132
221 3300041491 Ga0451833_1147405 Ga0451833_1147405_435_833 132
222 3300041503 Ga0451847_0841898 Ga0451847_0841898_66_464 132
223 3300041512 Ga0451853_2451145 Ga0451853_2451145_357_758 132
224 3300042002 Ga0439442_022775 Ga0439442_022775_51_449 132
225 3300042005 Ga0439448_0005487 Ga0439448_0005487_2688_3086 132
226 3300042005 Ga0439448_0313460 Ga0439448_0313460_38_436 132
227 3300042007 Ga0439449_0001397 Ga0439449_0001397_5028_5429 132
228 3300042007 Ga0439449_0044454 Ga0439449_0044454_807_1205 132
229 3300042007 Ga0439449_0137691 Ga0439449_0137691_455_853 132
230 3300042008 Ga0439450_018581 Ga0439450_018581_607_1005 132
231 3300042012 Ga0439455_0018262 Ga0439455_0018262_290_688 132
232 3300042013 Ga0439456_108264 Ga0439456_108264_56_454 132
233 3300042014 Ga0439457_002184 Ga0439457_002184_911_1309 132
234 3300042014 Ga0439457_013738 Ga0439457_013738_69_467 132
235 3300042127 Ga0450890_014911 Ga0450890_014911_525_923 132
236 3300042137 Ga0450902_018722 Ga0450902_018722_443_841 132
237 3300042138 Ga0450903_000502 Ga0450903_000502_5604_6002 132
238 3300042157 Ga0439458_0017853 Ga0439458_0017853_991_1389 132
239 3300044656 Ga0466969_0005688 Ga0466969_0005688_414_812 132
240 3300044656 Ga0466969_0086878 Ga0466969_0086878_18_416 132
241 3300044658 Ga0466972_0020771 Ga0466972_0020771_169_567 132
242 3300044658 Ga0466972_0055773 Ga0466972_0055773_1100_1498 132
243 3300044683 Ga0466965_0001179 Ga0466965_0001179_8447_8845 132
244 3300044683 Ga0466965_0048637 Ga0466965_0048637_936_1334 132
245 3300044683 Ga0466965_0275670 Ga0466965_0275670_391_792 132
246 3300044684 Ga0466966_0016819 Ga0466966_0016819_68_466 132
247 3300044684 Ga0466966_0118082 Ga0466966_0118082_256_654 132
248 3300044684 Ga0466966_0231522 Ga0466966_0231522_691_1089 132
249 3300044684 Ga0466966_0267672 Ga0466966_0267672_587_988 132
250 3300044684 Ga0466966_0519751 Ga0466966_0519751_124_522 132
251 3300044693 Ga0466961_0020033 Ga0466961_0020033_3303_3707 132
252 3300044693 Ga0466961_0061372 Ga0466961_0061372_1700_2098 132
253 3300044693 Ga0466961_0182772 Ga0466961_0182772_697_1095 132
254 3300044693 Ga0466961_0214309 Ga0466961_0214309_622_1023 132
255 3300044693 Ga0466961_0241929 Ga0466961_0241929_258_656 132
256 3300044693 Ga0466961_0339105 Ga0466961_0339105_364_762 132
257 3300044694 Ga0466963_0002112 Ga0466963_0002112_1685_2083 132
258 3300044694 Ga0466963_0197223 Ga0466963_0197223_590_994 132
259 3300044694 Ga0466963_0240198 Ga0466963_0240198_413_814 132
260 3300044694 Ga0466963_0674720 Ga0466963_0674720_53_451 132
261 3300044706 Ga0466964_0030850 Ga0466964_0030850_760_1158 132
262 3300044706 Ga0466964_0262847 Ga0466964_0262847_412_813 132
263 3300044719 Ga0466971_0003023 Ga0466971_0003023_4130_4528 132
264 3300044719 Ga0466971_0546714 Ga0466971_0546714_166_564 132
265 3300044735 Ga0466968_0067803 Ga0466968_0067803_335_733 132
266 3300044735 Ga0466968_0173647 Ga0466968_0173647_375_776 132
267 3300044765 Ga0466970_0002404 Ga0466970_0002404_364_762 132
268 3300044765 Ga0466970_0053683 Ga0466970_0053683_1034_1435 132
269 3300044765 Ga0466970_0083431 Ga0466970_0083431_486_884 132
270 3300044842 Ga0466957_0001587 Ga0466957_0001587_2894_3292 132
271 3300044901 Ga0466960_0048172 Ga0466960_0048172_703_1104 132
272 3300044901 Ga0466960_0052248 Ga0466960_0052248_1008_1406 132
273 3300044901 Ga0466960_0119085 Ga0466960_0119085_686_1087 132
274 3300044901 Ga0466960_0239653 Ga0466960_0239653_556_954 132
275 3300044901 Ga0466960_0317836 Ga0466960_0317836_23_421 132
276 3300044901 Ga0466960_0369682 Ga0466960_0369682_233_637 132
277 3300045049 Ga0466959_0095803 Ga0466959_0095803_1585_1989 132
278 3300045049 Ga0466959_0260143 Ga0466959_0260143_57_458 132
279 3300045049 Ga0466959_0380376 Ga0466959_0380376_154_552 132
280 3300045049 Ga0466959_0472238 Ga0466959_0472238_112_510 132
281 3300045836 Ga0466958_0009526 Ga0466958_0009526_1175_1573 132
282 3300045836 Ga0466958_0391663 Ga0466958_0391663_357_758 132
283 3300045976 Ga0466967_0010635 Ga0466967_0010635_2777_3175 132
284 3300045976 Ga0466967_0040024 Ga0466967_0040024_2016_2414 132
285 3300045976 Ga0466967_0044798 Ga0466967_0044798_1331_1729 132
286 3300045976 Ga0466967_0167767 Ga0466967_0167767_238_717 132
287 3300045976 Ga0466967_0298172 Ga0466967_0298172_719_1120 132
288 3300045976 Ga0466967_0385967 Ga0466967_0385967_923_1324 132
289 3300045976 Ga0466967_1938589 Ga0466967_1938589_157_558 132
290 3300045976 Ga0466967_1991204 Ga0466967_1991204_96_500 132
291 3300046452 Ga0495617_009331 Ga0495617_009331_680_1078 132
292 3300046453 Ga0495627_020310 Ga0495627_020310_601_999 132
293 3300046453 Ga0495627_081871 Ga0495627_081871_364_768 132
294 3300046454 Ga0495592_0018118 Ga0495592_0018118_1554_1952 132
295 3300046454 Ga0495592_0107119 Ga0495592_0107119_674_1072 132
296 3300046455 Ga0495603_0001177 Ga0495603_0001177_2812_3210 132
297 3300046455 Ga0495603_0004380 Ga0495603_0004380_594_995 132
298 3300046455 Ga0495603_0004858 Ga0495603_0004858_4256_4657 132
299 3300046455 Ga0495603_0014177 Ga0495603_0014177_13_411 132
300 3300046455 Ga0495603_0049499 Ga0495603_0049499_1285_1689 132
301 3300046455 Ga0495603_0163413 Ga0495603_0163413_830_1228 132
302 3300046459 Ga0495629_0001112 Ga0495629_0001112_15659_16060 132
303 3300046459 Ga0495629_0002571 Ga0495629_0002571_9688_10089 132
304 3300046459 Ga0495629_0016752 Ga0495629_0016752_2738_3136 132
305 3300046459 Ga0495629_0048662 Ga0495629_0048662_2297_2695 132
306 3300046459 Ga0495629_0076301 Ga0495629_0076301_333_731 132
307 3300046460 Ga0495638_0057060 Ga0495638_0057060_625_1023 132
308 3300046460 Ga0495638_0147027 Ga0495638_0147027_90_494 132
309 3300046460 Ga0495638_0165167 Ga0495638_0165167_378_776 132
310 3300046462 Ga0495651_0047349 Ga0495651_0047349_259_657 132
311 3300046462 Ga0495651_0330326 Ga0495651_0330326_271_669 132
312 3300046473 Ga0495582_0105356 Ga0495582_0105356_1080_1478 132
313 3300046473 Ga0495582_0304381 Ga0495582_0304381_139_537 132
314 3300046473 Ga0495582_0926158 Ga0495582_0926158_16_414 132
315 3300046474 Ga0495605_0316425 Ga0495605_0316425_154_552 132
316 3300046475 Ga0495639_0035540 Ga0495639_0035540_828_1226 132
317 3300046476 Ga0495662_0000376 Ga0495662_0000376_1081_1479 132
318 3300046476 Ga0495662_0022476 Ga0495662_0022476_587_985 132
319 3300046476 Ga0495662_0174038 Ga0495662_0174038_94_492 132
320 3300046477 Ga0495664_0155466 Ga0495664_0155466_935_1333 132
321 3300046491 Ga0495584_0095583 Ga0495584_0095583_328_726 132
322 3300046492 Ga0495585_0107523 Ga0495585_0107523_744_1148 132
323 3300046492 Ga0495585_0413906 Ga0495585_0413906_148_546 132
324 3300046499 Ga0495594_0001188 Ga0495594_0001188_11494_11895 132
325 3300046499 Ga0495594_0009615 Ga0495594_0009615_365_763 132
326 3300046499 Ga0495594_0025955 Ga0495594_0025955_661_1065 132
327 3300046499 Ga0495594_0081636 Ga0495594_0081636_796_1194 132
328 3300046499 Ga0495594_0243819 Ga0495594_0243819_534_932 132
329 3300046499 Ga0495594_0387218 Ga0495594_0387218_356_754 132
330 3300046499 Ga0495594_0870865 Ga0495594_0870865_42_440 132
331 3300046500 Ga0495596_0182977 Ga0495596_0182977_291_689 132
332 3300046506 Ga0495583_0030848 Ga0495583_0030848_2189_2587 132
333 3300046506 Ga0495583_0200332 Ga0495583_0200332_18_416 132
334 3300046506 Ga0495583_0357873 Ga0495583_0357873_69_467 132
335 3300046507 Ga0495606_0024579 Ga0495606_0024579_463_861 132
336 3300046511 Ga0495608_0060530 Ga0495608_0060530_22_420 132
337 3300046512 Ga0495610_0015806 Ga0495610_0015806_2514_2912 132
338 3300046513 Ga0495616_0032403 Ga0495616_0032403_2207_2605 132
339 3300046513 Ga0495616_0233523 Ga0495616_0233523_285_683 132
340 3300046514 Ga0495618_0087445 Ga0495618_0087445_1344_1742 132
341 3300046514 Ga0495618_0092075 Ga0495618_0092075_938_1336 132
342 3300046515 Ga0495620_0004818 Ga0495620_0004818_2391_2789 132
343 3300046515 Ga0495620_0169328 Ga0495620_0169328_273_677 132
344 3300046516 Ga0495628_0004108 Ga0495628_0004108_7984_8382 132
345 3300046516 Ga0495628_0736774 Ga0495628_0736774_144_542 132
346 3300046516 Ga0495628_0778778 Ga0495628_0778778_182_580 132
347 3300046518 Ga0495631_0018135 Ga0495631_0018135_579_977 132
348 3300046518 Ga0495631_0103669 Ga0495631_0103669_93_494 132
349 3300046518 Ga0495631_0323453 Ga0495631_0323453_37_435 132
350 3300046519 Ga0495632_0042804 Ga0495632_0042804_1209_1607 132
351 3300046520 Ga0495637_0112749 Ga0495637_0112749_376_774 132
352 3300046522 Ga0495643_0003273 Ga0495643_0003273_1043_1441 132
353 3300046524 Ga0495648_0103364 Ga0495648_0103364_129_527 132
354 3300046526 Ga0495666_0018157 Ga0495666_0018157_747_1145 132
355 3300046526 Ga0495666_0136741 Ga0495666_0136741_368_766 132
356 3300046528 Ga0495642_0071545 Ga0495642_0071545_433_831 132
357 3300046529 Ga0495652_0100229 Ga0495652_0100229_1507_1905 132
358 3300046533 Ga0495640_0005838 Ga0495640_0005838_4743_5141 132
359 3300046533 Ga0495640_0051641 Ga0495640_0051641_653_1051 132
360 3300046538 Ga0495609_0098428 Ga0495609_0098428_23_427 132
361 3300046542 Ga0495597_0021732 Ga0495597_0021732_1867_2265 132
362 3300046542 Ga0495597_0023511 Ga0495597_0023511_374_772 132
363 3300046542 Ga0495597_0277783 Ga0495597_0277783_184_582 132
364 3300046543 Ga0495645_0860832 Ga0495645_0860832_114_512 132
365 3300046557 Ga0495622_0004928 Ga0495622_0004928_1729_2130 132
366 3300046557 Ga0495622_0041211 Ga0495622_0041211_1376_1774 132
367 3300046557 Ga0495622_0418340 Ga0495622_0418340_151_549 132
368 3300046558 Ga0495633_0170031 Ga0495633_0170031_394_792 132
369 3300046559 Ga0495667_0096636 Ga0495667_0096636_1189_1587 132
370 3300046615 Ga0495656_0368046 Ga0495656_0368046_72_470 132
371 3300046616 Ga0495668_0069197 Ga0495668_0069197_805_1203 132
372 3300046642 Ga0495634_0190998 Ga0495634_0190998_807_1205 132
373 3300046648 Ga0495611_0069173 Ga0495611_0069173_1134_1538 132
374 3300046648 Ga0495611_0228396 Ga0495611_0228396_63_467 132
375 3300046660 Ga0495625_0067097 Ga0495625_0067097_1655_2059 132
376 3300046660 Ga0495625_0077574 Ga0495625_0077574_809_1207 132
377 3300046660 Ga0495625_0502264 Ga0495625_0502264_76_474 132
378 3300046663 Ga0495635_0027370 Ga0495635_0027370_2949_3347 132
379 3300046663 Ga0495635_0260234 Ga0495635_0260234_495_893 132
380 3300046663 Ga0495635_0496254 Ga0495635_0496254_321_719 132
381 3300046663 Ga0495635_0565380 Ga0495635_0565380_207_605 132
382 3300046665 Ga0495661_0137669 Ga0495661_0137669_909_1307 132
383 3300046674 Ga0495588_0000835 Ga0495588_0000835_670_1068 132
384 3300046674 Ga0495588_0174928 Ga0495588_0174928_704_1102 132
385 3300046674 Ga0495588_0239862 Ga0495588_0239862_379_777 132
386 3300046675 Ga0495657_0008117 Ga0495657_0008117_4133_4531 132
387 3300046675 Ga0495657_0021772 Ga0495657_0021772_2880_3278 132
388 3300046675 Ga0495657_0057847 Ga0495657_0057847_1949_2347 132
389 3300046679 Ga0495623_0153491 Ga0495623_0153491_949_1347 132
390 3300046679 Ga0495623_0305379 Ga0495623_0305379_190_588 132
391 3300046680 Ga0495646_0143210 Ga0495646_0143210_167_565 132
392 3300046689 Ga0495613_0006723 Ga0495613_0006723_4938_5339 132
393 3300046689 Ga0495613_0018505 Ga0495613_0018505_622_1020 132
394 3300046689 Ga0495613_0044065 Ga0495613_0044065_821_1219 132
395 3300046689 Ga0495613_0089289 Ga0495613_0089289_1668_2066 132
396 3300046689 Ga0495613_0129133 Ga0495613_0129133_112_510 132
397 3300046689 Ga0495613_0280376 Ga0495613_0280376_304_702 132
398 3300046690 Ga0495624_0025235 Ga0495624_0025235_2009_2407 132
399 3300046690 Ga0495624_0043042 Ga0495624_0043042_898_1296 132
400 3300046691 Ga0495670_0147740 Ga0495670_0147740_494_892 132
401 3300046691 Ga0495670_0235493 Ga0495670_0235493_90_494 132
402 3300046692 Ga0495671_0171938 Ga0495671_0171938_644_1042 132
403 3300046694 Ga0495649_0014093 Ga0495649_0014093_1755_2153 132
404 3300046694 Ga0495649_0330320 Ga0495649_0330320_253_657 132
405 3300046794 Ga0495589_0012689 Ga0495589_0012689_3113_3517 132
406 3300046794 Ga0495589_0020163 Ga0495589_0020163_1852_2250 132
407 3300046794 Ga0495589_0053257 Ga0495589_0053257_878_1276 132
408 3300046809 Ga0495600_0047740 Ga0495600_0047740_1590_1988 132
409 3300046809 Ga0495600_0105585 Ga0495600_0105585_866_1264 132
410 3300046810 Ga0495660_0204643 Ga0495660_0204643_531_929 132
411 3300047315 Ga0495581_0023679 Ga0495581_0023679_1450_1848 132
412 3300047315 Ga0495581_0099986 Ga0495581_0099986_895_1293 132
413 3300047315 Ga0495581_0103243 Ga0495581_0103243_695_1093 132
414 3300047317 Ga0495604_0075837 Ga0495604_0075837_1021_1419 132
415 3300047317 Ga0495604_0262748 Ga0495604_0262748_625_1023 132
416 3300047317 Ga0495604_0485017 Ga0495604_0485017_141_539 132
417 3300047318 Ga0495636_0004176 Ga0495636_0004176_4605_5003 132
418 3300047318 Ga0495636_0024781 Ga0495636_0024781_67_468 132
419 3300047318 Ga0495636_0036820 Ga0495636_0036820_837_1235 132
420 3300047318 Ga0495636_0151345 Ga0495636_0151345_259_663 132
421 3300047318 Ga0495636_0272012 Ga0495636_0272012_35_433 132
422 3300047319 Ga0495674_0134414 Ga0495674_0134414_791_1189 132
423 3300047320 Ga0495672_0130685 Ga0495672_0130685_25_423 132
424 3300047321 Ga0495676_0001036 Ga0495676_0001036_14378_14776 132
425 3300047321 Ga0495676_0002499 Ga0495676_0002499_3803_4204 132
426 3300047321 Ga0495676_0024436 Ga0495676_0024436_3885_4283 132
427 3300047321 Ga0495676_0040601 Ga0495676_0040601_1201_1602 132
428 3300047321 Ga0495676_0044357 Ga0495676_0044357_2653_3057 132
429 3300047321 Ga0495676_0054316 Ga0495676_0054316_2677_3081 132
430 3300047322 Ga0495680_0001234 Ga0495680_0001234_9545_9943 132
431 3300047322 Ga0495680_0710192 Ga0495680_0710192_75_473 132
432 3300047323 Ga0495683_0155826 Ga0495683_0155826_593_991 132
433 3300047323 Ga0495683_0388391 Ga0495683_0388391_104_502 132
434 3300047323 Ga0495683_0400482 Ga0495683_0400482_157_558 132
435 3300047443 Ga0495687_083787 Ga0495687_083787_139_537 132
436 3300047443 Ga0495687_105467 Ga0495687_105467_383_781 132
437 3300047443 Ga0495687_112935 Ga0495687_112935_13_411 132
438 3300047443 Ga0495687_140268 Ga0495687_140268_197_595 132
439 3300047444 Ga0495675_0013779 Ga0495675_0013779_3737_4135 132
440 3300047445 Ga0495677_0077287 Ga0495677_0077287_648_1046 132
441 3300047445 Ga0495677_0131892 Ga0495677_0131892_404_802 132
442 3300047446 Ga0495679_080844 Ga0495679_080844_420_818 132
443 3300047447 Ga0495685_007461 Ga0495685_007461_2293_2691 132
444 3300047447 Ga0495685_013099 Ga0495685_013099_2022_2426 132
445 3300047447 Ga0495685_016412 Ga0495685_016412_1983_2387 132
446 3300047447 Ga0495685_018347 Ga0495685_018347_1448_1846 132
447 3300047447 Ga0495685_026109 Ga0495685_026109_337_735 132
448 3300047447 Ga0495685_027113 Ga0495685_027113_618_1016 132
449 3300047447 Ga0495685_029024 Ga0495685_029024_529_927 132
450 3300047447 Ga0495685_034338 Ga0495685_034338_446_844 132
451 3300047447 Ga0495685_084270 Ga0495685_084270_135_536 132
452 3300047447 Ga0495685_093692 Ga0495685_093692_288_701 132
453 3300047470 Ga0495681_0165290 Ga0495681_0165290_255_653 132
454 3300047673 Ga0495593_0020451 Ga0495593_0020451_412_810 132
455 3300047673 Ga0495593_0080676 Ga0495593_0080676_87_485 132
456 3300047673 Ga0495593_0117540 Ga0495593_0117540_27_425 132
457 3300047673 Ga0495593_0412869 Ga0495593_0412869_265_663 132
458 3300048088 Ga0495602_0425259 Ga0495602_0425259_80_478 132
459 3300048089 Ga0495614_0008692 Ga0495614_0008692_2646_3047 132
460 3300048089 Ga0495614_0326311 Ga0495614_0326311_175_573 132
461 3300048091 Ga0495626_0083188 Ga0495626_0083188_751_1149 132
462 3300048091 Ga0495626_0169336 Ga0495626_0169336_282_680 132
463 3300048903 Ga0496100_0906672 Ga0496100_0906672_152_550 132
464 3300048905 Ga0496102_1749206 Ga0496102_1749206_80_478 132
465 3300048909 Ga0496106_0094550 Ga0496106_0094550_204_605 132
466 3300048911 Ga0496108_0472142 Ga0496108_0472142_60_458 132
467 3300048912 Ga0496109_0004022 Ga0496109_0004022_10846_11244 132
468 3300049459 Ga0495678_197562 Ga0495678_197562_210_608 132
469 3300049460 Ga0495682_0031278 Ga0495682_0031278_816_1214 132
470 3300049569 Ga0501032_0007045 Ga0501032_0007045_7273_7671 132
471 3300049569 Ga0501032_0225066 Ga0501032_0225066_417_815 132
472 3300049570 Ga0501033_0670212 Ga0501033_0670212_220_618 132
473 3300049571 Ga0501034_0114606 Ga0501034_0114606_1384_1782 132
474 3300049571 Ga0501034_0548615 Ga0501034_0548615_90_488 132
475 3300049572 Ga0501036_0052093 Ga0501036_0052093_235_633 132
476 3300049572 Ga0501036_0395583 Ga0501036_0395583_289_687 132
477 3300049574 Ga0501038_0017443 Ga0501038_0017443_50_448 132
478 3300049579 Ga0501043_0740067 Ga0501043_0740067_190_588 132
479 3300049580 Ga0501046_0657065 Ga0501046_0657065_278_676 132
480 3300049581 Ga0501047_0015719 Ga0501047_0015719_1156_1554 132
481 3300049581 Ga0501047_0274255 Ga0501047_0274255_121_519 132
482 3300049581 Ga0501047_0303755 Ga0501047_0303755_68_466 132
483 3300049583 Ga0501067_0737613 Ga0501067_0737613_40_438 132
484 3300049586 Ga0501070_0336715 Ga0501070_0336715_738_1136 132
485 3300049586 Ga0501070_0548755 Ga0501070_0548755_484_882 132
486 3300049586 Ga0501070_0580676 Ga0501070_0580676_215_613 132
487 3300049586 Ga0501070_1327679 Ga0501070_1327679_41_439 132
488 3300049589 Ga0501073_0161316 Ga0501073_0161316_781_1179 132
489 3300049822 Ga0501035_0013175 Ga0501035_0013175_942_1340 132
490 3300049822 Ga0501035_0184138 Ga0501035_0184138_834_1232 132
491 3300049822 Ga0501035_0502688 Ga0501035_0502688_47_445 132
492 3300049823 Ga0501044_0001972 Ga0501044_0001972_10504_10902 132
493 3300049823 Ga0501044_0018759 Ga0501044_0018759_1356_1754 132
494 3300049823 Ga0501044_0061532 Ga0501044_0061532_1517_1915 132
495 3300049823 Ga0501044_0158888 Ga0501044_0158888_1140_1538 132
496 3300049824 Ga0501045_0254651 Ga0501045_0254651_235_633 132
497 3300050490 nmdc:mga03n38_198716_c1 nmdc:mga03n38_198716_c1_481_879 132
498 3300050492 nmdc:mga0yw44_274905_c1 nmdc:mga0yw44_274905_c1_313_714 132
499 3300050496 nmdc:mga07m45_423288_c1 nmdc:mga07m45_423288_c1_299_697 132
500 3300053149 Ga0500600_0236774 Ga0500600_0236774_102_500 132
501 3300053739 Ga0500587_028712 Ga0500587_028712_143_544 132
502 3300061719 Ga0466962_0017597 Ga0466962_0017597_563_961 132
503 3300061719 Ga0466962_0499323 Ga0466962_0499323_119_520 132
504 iso_pu_bacteria 2912723979 2912729582 132
505 iso_pu_bacteria 8025478263 8025483890 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

22

144

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8809 1 131
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8684 1 131
3lyb-assembly1.cif.gz_C structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.8385 23 132
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.824 14 131
3lyb-assembly1.cif.gz_B structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.8234 22 132
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.824 14 131 3.30.1330.40
3lybC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8234 23 132 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8098 18 131 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8028 18 131 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7876 12 130 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A559UDQ2-F1-model_v4 deleted 0.9929 2 132
AF-A0A1E5P4P4-F1-model_v4 Enamine deaminase RidA 0.9913 2 132
AF-A0A344TXW9-F1-model_v4 RidA family protein 0.9891 1 131
AF-E2PUZ7-F1-model_v4 Putative endoribonuclease 0.9891 3 132
AF-A0A511D8H3-F1-model_v4 Enamine deaminase RidA 0.9863 29 132 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
95.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map