F456434
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 505 | 218 | 505 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_102820_c1|nmdc:mga0k408_102820_c1_570_998 |
| Length | 142 |
| Sequence | VNDAAPQEAALPLCHSAALEEKGRAVVWDVMEWRRPARAFALRYDGQVRAYMNRCLHVPTEMDWQPGEFLDLDKRVILCSIHGASYEPTSGQCVGGPCGRGRLAAIRTEERDGQVYWYPSRDIQPVDFDPPAPGTSPASSFT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 70 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 176 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 177 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 178 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 179 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 180 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 208 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 209 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 210 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 211 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 213 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 218 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.77 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 89.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1002399 | 3300002773 | Bacteria | 7164 |
| 2 | JGI25150J39212_1015235 | 3300002774 | Bacteria | 1287 |
| 3 | JGI25153J46596_10000448 | 3300003215 | Bacteria | 26516 |
| 4 | Ga0055526_1001528 | 3300003771 | Bacteria | 16371 |
| 5 | Ga0065707_10162173 | 3300005295 | Bacteria | 1554 |
| 6 | Ga0070658_10038745 | 3300005327 | Bacteria | 3843 |
| 7 | Ga0070676_10011226 | 3300005328 | Bacteria | 4871 |
| 8 | Ga0070676_10017824 | 3300005328 | Bacteria | 3931 |
| 9 | Ga0070683_100030662 | 3300005329 | Bacteria | 4884 |
| 10 | Ga0070683_100277505 | 3300005329 | Bacteria | 1594 |
| 11 | Ga0070690_100147016 | 3300005330 | Bacteria | 1604 |
| 12 | Ga0070690_100648741 | 3300005330 | Bacteria | 806 |
| 13 | Ga0070670_100031224 | 3300005331 | Bacteria | 4587 |
| 14 | Ga0070670_100159071 | 3300005331 | Bacteria | 1957 |
| 15 | Ga0070670_100170357 | 3300005331 | Bacteria | 1888 |
| 16 | Ga0070670_100236337 | 3300005331 | Bacteria | 1591 |
| 17 | Ga0070670_100259898 | 3300005331 | Bacteria | 1513 |
| 18 | Ga0070670_100356007 | 3300005331 | Bacteria | 1286 |
| 19 | Ga0070670_101028991 | 3300005331 | Bacteria | 749 |
| 20 | Ga0070677_10003535 | 3300005333 | Bacteria | 5040 |
| 21 | Ga0070677_10005471 | 3300005333 | Bacteria | 4186 |
| 22 | Ga0070677_10087685 | 3300005333 | Bacteria | 1347 |
| 23 | Ga0070677_10168040 | 3300005333 | Bacteria | 1034 |
| 24 | Ga0068869_100001022 | 3300005334 | Bacteria | 16269 |
| 25 | Ga0070666_10220545 | 3300005335 | Bacteria | 1337 |
| 26 | Ga0070666_11017141 | 3300005335 | Bacteria | 615 |
| 27 | Ga0070666_11352849 | 3300005335 | Bacteria | 532 |
| 28 | Ga0070682_100036970 | 3300005337 | Bacteria | 2987 |
| 29 | Ga0068868_100144617 | 3300005338 | Bacteria | 1954 |
| 30 | Ga0068868_100473716 | 3300005338 | Bacteria | 1093 |
| 31 | Ga0068868_100839259 | 3300005338 | Bacteria | 831 |
| 32 | Ga0068868_101214735 | 3300005338 | Bacteria | 697 |
| 33 | Ga0070660_101109870 | 3300005339 | Bacteria | 670 |
| 34 | Ga0070689_100627706 | 3300005340 | Bacteria | 933 |
| 35 | Ga0070689_101644466 | 3300005340 | Bacteria | 584 |
| 36 | Ga0070687_100229945 | 3300005343 | Bacteria | 1141 |
| 37 | Ga0070661_100098688 | 3300005344 | Bacteria | 2169 |
| 38 | Ga0070661_100115960 | 3300005344 | Bacteria | 2003 |
| 39 | Ga0070661_100550156 | 3300005344 | Bacteria | 928 |
| 40 | Ga0070692_10146618 | 3300005345 | Bacteria | 1341 |
| 41 | Ga0070668_100020179 | 3300005347 | Bacteria | 5025 |
| 42 | Ga0070668_100184515 | 3300005347 | Bacteria | 1706 |
| 43 | Ga0070668_100392406 | 3300005347 | Bacteria | 1183 |
| 44 | Ga0070669_100013909 | 3300005353 | Bacteria | 5723 |
| 45 | Ga0070669_100059049 | 3300005353 | Bacteria | 2816 |
| 46 | Ga0070669_100165516 | 3300005353 | Bacteria | 1721 |
| 47 | Ga0070669_100198374 | 3300005353 | Bacteria | 1578 |
| 48 | Ga0070669_100694805 | 3300005353 | Bacteria | 858 |
| 49 | Ga0070675_100008605 | 3300005354 | Bacteria | 7924 |
| 50 | Ga0070675_100023561 | 3300005354 | Bacteria | 4924 |
| 51 | Ga0070675_100027175 | 3300005354 | Bacteria | 4596 |
| 52 | Ga0070675_100051376 | 3300005354 | Bacteria | 3387 |
| 53 | Ga0070671_100020819 | 3300005355 | Bacteria | 5350 |
| 54 | Ga0070671_100362886 | 3300005355 | Bacteria | 1237 |
| 55 | Ga0070671_100572607 | 3300005355 | Bacteria | 975 |
| 56 | Ga0070671_100759819 | 3300005355 | Bacteria | 843 |
| 57 | Ga0070671_100802319 | 3300005355 | Bacteria | 820 |
| 58 | Ga0070671_101549658 | 3300005355 | Unclassified | 587 |
| 59 | Ga0070674_100014769 | 3300005356 | Bacteria | 4860 |
| 60 | Ga0070674_100284204 | 3300005356 | Bacteria | 1312 |
| 61 | Ga0070674_100729366 | 3300005356 | Bacteria | 850 |
| 62 | Ga0070674_101379358 | 3300005356 | Bacteria | 630 |
| 63 | Ga0070673_100028726 | 3300005364 | Bacteria | 4139 |
| 64 | Ga0070659_100015447 | 3300005366 | Bacteria | 5719 |
| 65 | Ga0070659_100142814 | 3300005366 | Bacteria | 1949 |
| 66 | Ga0070659_100328522 | 3300005366 | Bacteria | 1279 |
| 67 | Ga0070659_100332115 | 3300005366 | Bacteria | 1272 |
| 68 | Ga0070659_101466054 | 3300005366 | Bacteria | 607 |
| 69 | Ga0070667_100000945 | 3300005367 | Bacteria | 26692 |
| 70 | Ga0070667_100019842 | 3300005367 | Bacteria | 5577 |
| 71 | Ga0070667_100685408 | 3300005367 | Bacteria | 947 |
| 72 | Ga0070700_100212462 | 3300005441 | Bacteria | 1366 |
| 73 | Ga0070700_100473928 | 3300005441 | Bacteria | 957 |
| 74 | Ga0070663_100159862 | 3300005455 | Bacteria | 1733 |
| 75 | Ga0070663_100199860 | 3300005455 | Bacteria | 1559 |
| 76 | Ga0070663_100829226 | 3300005455 | Bacteria | 795 |
| 77 | Ga0070678_100021132 | 3300005456 | Bacteria | 4285 |
| 78 | Ga0070678_100179138 | 3300005456 | Bacteria | 1733 |
| 79 | Ga0070678_100198400 | 3300005456 | Bacteria | 1655 |
| 80 | Ga0070678_100215151 | 3300005456 | Bacteria | 1594 |
| 81 | Ga0070678_100225899 | 3300005456 | Bacteria | 1558 |
| 82 | Ga0070662_100198013 | 3300005457 | Bacteria | 1592 |
| 83 | Ga0070662_100249065 | 3300005457 | Bacteria | 1427 |
| 84 | Ga0070662_100438441 | 3300005457 | Bacteria | 1083 |
| 85 | Ga0070662_100445064 | 3300005457 | Bacteria | 1075 |
| 86 | Ga0068867_100017097 | 3300005459 | Bacteria | 5152 |
| 87 | Ga0068867_100070723 | 3300005459 | Bacteria | 2609 |
| 88 | Ga0068867_100076999 | 3300005459 | Bacteria | 2505 |
| 89 | Ga0068867_100094239 | 3300005459 | Bacteria | 2276 |
| 90 | Ga0068867_100254617 | 3300005459 | Bacteria | 1429 |
| 91 | Ga0068867_100450299 | 3300005459 | Bacteria | 1097 |
| 92 | Ga0068867_100814910 | 3300005459 | Bacteria | 833 |
| 93 | Ga0070684_100094951 | 3300005535 | Bacteria | 2657 |
| 94 | Ga0070684_100209033 | 3300005535 | Bacteria | 1778 |
| 95 | Ga0068853_100045677 | 3300005539 | Bacteria | 3753 |
| 96 | Ga0068853_100121254 | 3300005539 | Bacteria | 2333 |
| 97 | Ga0068853_100172184 | 3300005539 | Bacteria | 1959 |
| 98 | Ga0068853_100216711 | 3300005539 | Bacteria | 1747 |
| 99 | Ga0068853_101505079 | 3300005539 | Bacteria | 652 |
| 100 | Ga0070672_100027232 | 3300005543 | Bacteria | 4262 |
| 101 | Ga0070672_100060582 | 3300005543 | Bacteria | 2980 |
| 102 | Ga0070672_100070201 | 3300005543 | Bacteria | 2783 |
| 103 | Ga0070672_100167919 | 3300005543 | Bacteria | 1823 |
| 104 | Ga0070672_100190207 | 3300005543 | Bacteria | 1713 |
| 105 | Ga0070672_100364638 | 3300005543 | Bacteria | 1233 |
| 106 | Ga0070672_100389311 | 3300005543 | Unclassified | 1193 |
| 107 | Ga0070672_100465182 | 3300005543 | Bacteria | 1091 |
| 108 | Ga0070686_100177623 | 3300005544 | Bacteria | 1511 |
| 109 | Ga0070693_100058687 | 3300005547 | Bacteria | 2228 |
| 110 | Ga0070693_100171658 | 3300005547 | Bacteria | 1389 |
| 111 | Ga0070693_100719388 | 3300005547 | Bacteria | 733 |
| 112 | Ga0070665_100146105 | 3300005548 | Bacteria | 2367 |
| 113 | Ga0070665_100514509 | 3300005548 | Bacteria | 1208 |
| 114 | Ga0068855_100159699 | 3300005563 | Bacteria | 2559 |
| 115 | Ga0068855_100725355 | 3300005563 | Bacteria | 1062 |
| 116 | Ga0070664_100100044 | 3300005564 | Bacteria | 2520 |
| 117 | Ga0070664_100257528 | 3300005564 | Bacteria | 1569 |
| 118 | Ga0070664_100354463 | 3300005564 | Bacteria | 1335 |
| 119 | Ga0070664_100439410 | 3300005564 | Bacteria | 1197 |
| 120 | Ga0070664_100861494 | 3300005564 | Bacteria | 849 |
| 121 | Ga0070664_101132209 | 3300005564 | Bacteria | 737 |
| 122 | Ga0068857_100092959 | 3300005577 | Bacteria | 2701 |
| 123 | Ga0068857_100373161 | 3300005577 | Bacteria | 1324 |
| 124 | Ga0068854_100006289 | 3300005578 | Bacteria | 7550 |
| 125 | Ga0068854_100532872 | 3300005578 | Bacteria | 993 |
| 126 | Ga0068854_100568689 | 3300005578 | Bacteria | 964 |
| 127 | Ga0068854_100956616 | 3300005578 | Bacteria | 756 |
| 128 | Ga0068856_100066064 | 3300005614 | Bacteria | 3574 |
| 129 | Ga0068852_100085720 | 3300005616 | Bacteria | 2806 |
| 130 | Ga0068852_100187831 | 3300005616 | Bacteria | 1947 |
| 131 | Ga0068852_100309042 | 3300005616 | Bacteria | 1532 |
| 132 | Ga0068852_100785771 | 3300005616 | Bacteria | 965 |
| 133 | Ga0068852_100882911 | 3300005616 | Bacteria | 911 |
| 134 | Ga0068852_101103630 | 3300005616 | Bacteria | 814 |
| 135 | Ga0068859_100051551 | 3300005617 | Bacteria | 4136 |
| 136 | Ga0068859_100118968 | 3300005617 | Bacteria | 2708 |
| 137 | Ga0068864_100024428 | 3300005618 | Bacteria | 5084 |
| 138 | Ga0068864_100055519 | 3300005618 | Bacteria | 3420 |
| 139 | Ga0068864_100201737 | 3300005618 | Bacteria | 1827 |
| 140 | Ga0068866_10015851 | 3300005718 | Bacteria | 3357 |
| 141 | Ga0068866_10333167 | 3300005718 | Bacteria | 959 |
| 142 | Ga0068861_100001754 | 3300005719 | Bacteria | 13938 |
| 143 | Ga0068861_100003902 | 3300005719 | Bacteria | 9971 |
| 144 | Ga0068861_100039958 | 3300005719 | Bacteria | 3505 |
| 145 | Ga0068861_100149255 | 3300005719 | Bacteria | 1916 |
| 146 | Ga0068851_10123322 | 3300005834 | Bacteria | 1394 |
| 147 | Ga0068851_10233557 | 3300005834 | Bacteria | 1037 |
| 148 | Ga0068851_10351520 | 3300005834 | Bacteria | 858 |
| 149 | Ga0068863_100129436 | 3300005841 | Bacteria | 2409 |
| 150 | Ga0068863_100170181 | 3300005841 | Bacteria | 2089 |
| 151 | Ga0068863_100318849 | 3300005841 | Bacteria | 1509 |
| 152 | Ga0068863_101088131 | 3300005841 | Bacteria | 804 |
| 153 | Ga0068858_100155351 | 3300005842 | Bacteria | 2152 |
| 154 | Ga0068860_100021348 | 3300005843 | Bacteria | 6269 |
| 155 | Ga0068860_100030852 | 3300005843 | Bacteria | 5153 |
| 156 | Ga0068860_100048804 | 3300005843 | Bacteria | 4034 |
| 157 | Ga0068860_102625336 | 3300005843 | Bacteria | 523 |
| 158 | Ga0068862_100018761 | 3300005844 | Bacteria | 5764 |
| 159 | Ga0068862_100273897 | 3300005844 | Bacteria | 1545 |
| 160 | Ga0097621_100173814 | 3300006237 | Bacteria | 1858 |
| 161 | Ga0097621_100192556 | 3300006237 | Bacteria | 1766 |
| 162 | Ga0097621_100860512 | 3300006237 | Bacteria | 843 |
| 163 | Ga0068871_100342416 | 3300006358 | Bacteria | 1321 |
| 164 | Ga0068871_100527906 | 3300006358 | Bacteria | 1067 |
| 165 | Ga0068871_101074969 | 3300006358 | Bacteria | 752 |
| 166 | Ga0075429_100002479 | 3300006880 | Bacteria | 15530 |
| 167 | Ga0068865_100612024 | 3300006881 | Bacteria | 922 |
| 168 | Ga0075436_100716567 | 3300006914 | Bacteria | 742 |
| 169 | Ga0097620_100051554 | 3300006931 | Bacteria | 4136 |
| 170 | Ga0097620_100118966 | 3300006931 | Bacteria | 2708 |
| 171 | Ga0105245_10334264 | 3300009098 | Bacteria | 1496 |
| 172 | Ga0105245_10588124 | 3300009098 | Bacteria | 1138 |
| 173 | Ga0105243_10022500 | 3300009148 | Bacteria | 4792 |
| 174 | Ga0105243_10077444 | 3300009148 | Bacteria | 2704 |
| 175 | Ga0105243_10762819 | 3300009148 | Bacteria | 949 |
| 176 | Ga0105243_10811107 | 3300009148 | Bacteria | 923 |
| 177 | Ga0105241_10307230 | 3300009174 | Bacteria | 1363 |
| 178 | Ga0105242_10036764 | 3300009176 | Bacteria | 3930 |
| 179 | Ga0105248_10000563 | 3300009177 | Bacteria | 42070 |
| 180 | Ga0105248_10061862 | 3300009177 | Bacteria | 4204 |
| 181 | Ga0105248_10112888 | 3300009177 | Bacteria | 3065 |
| 182 | Ga0105248_10230062 | 3300009177 | Bacteria | 2087 |
| 183 | Ga0105248_10262338 | 3300009177 | Bacteria | 1945 |
| 184 | Ga0105248_10545004 | 3300009177 | Bacteria | 1309 |
| 185 | Ga0105238_10068984 | 3300009551 | Bacteria | 3536 |
| 186 | Ga0105238_10523269 | 3300009551 | Bacteria | 1189 |
| 187 | Ga0105238_10880377 | 3300009551 | Bacteria | 913 |
| 188 | Ga0105249_10103684 | 3300009553 | Bacteria | 2679 |
| 189 | Ga0105239_10350672 | 3300010375 | Bacteria | 1666 |
| 190 | Ga0157346_1033995 | 3300012480 | Unclassified | 509 |
| 191 | Ga0157315_1035471 | 3300012508 | Unclassified | 607 |
| 192 | Ga0157373_10016057 | 3300013100 | Bacteria | 5465 |
| 193 | Ga0157371_10083250 | 3300013102 | Bacteria | 2265 |
| 194 | Ga0157370_11615178 | 3300013104 | Bacteria | 582 |
| 195 | Ga0157369_10034527 | 3300013105 | Bacteria | 5550 |
| 196 | Ga0157374_10028577 | 3300013296 | Bacteria | 5039 |
| 197 | Ga0157374_10078403 | 3300013296 | Bacteria | 3128 |
| 198 | Ga0157374_10182368 | 3300013296 | Bacteria | 2051 |
| 199 | Ga0157374_10956398 | 3300013296 | Bacteria | 875 |
| 200 | Ga0157374_12564838 | 3300013296 | Bacteria | 537 |
| 201 | Ga0157378_11208962 | 3300013297 | Bacteria | 795 |
| 202 | Ga0163162_10026890 | 3300013306 | Bacteria | 5690 |
| 203 | Ga0163162_10135885 | 3300013306 | Bacteria | 2569 |
| 204 | Ga0163162_10253188 | 3300013306 | Bacteria | 1893 |
| 205 | Ga0163162_10280693 | 3300013306 | Bacteria | 1798 |
| 206 | Ga0163162_10766616 | 3300013306 | Bacteria | 1083 |
| 207 | Ga0163162_11589422 | 3300013306 | Bacteria | 746 |
| 208 | Ga0157372_10007404 | 3300013307 | Bacteria | 11674 |
| 209 | Ga0157372_10127441 | 3300013307 | Bacteria | 2927 |
| 210 | Ga0157372_10812655 | 3300013307 | Bacteria | 1086 |
| 211 | Ga0157375_10025412 | 3300013308 | Bacteria | 5502 |
| 212 | Ga0157375_10030347 | 3300013308 | Bacteria | 5096 |
| 213 | Ga0157375_10174358 | 3300013308 | Bacteria | 2299 |
| 214 | Ga0157375_10545251 | 3300013308 | Bacteria | 1322 |
| 215 | Ga0157375_10688908 | 3300013308 | Bacteria | 1176 |
| 216 | Ga0157375_11700437 | 3300013308 | Unclassified | 747 |
| 217 | Ga0163163_10289797 | 3300014325 | Bacteria | 1689 |
| 218 | Ga0163163_10321469 | 3300014325 | Bacteria | 1601 |
| 219 | Ga0163163_10913146 | 3300014325 | Bacteria | 941 |
| 220 | Ga0157380_10012299 | 3300014326 | Bacteria | 6205 |
| 221 | Ga0157380_10056684 | 3300014326 | Bacteria | 3118 |
| 222 | Ga0157380_10124631 | 3300014326 | Bacteria | 2188 |
| 223 | Ga0157380_10233378 | 3300014326 | Bacteria | 1654 |
| 224 | Ga0157380_10386750 | 3300014326 | Bacteria | 1322 |
| 225 | Ga0157380_10677578 | 3300014326 | Bacteria | 1033 |
| 226 | Ga0182008_10353665 | 3300014497 | Bacteria | 780 |
| 227 | Ga0157377_10013110 | 3300014745 | Bacteria | 4187 |
| 228 | Ga0157379_10010986 | 3300014968 | Bacteria | 7896 |
| 229 | Ga0157379_10040167 | 3300014968 | Bacteria | 4174 |
| 230 | Ga0157379_10254321 | 3300014968 | Bacteria | 1595 |
| 231 | Ga0157379_11266461 | 3300014968 | Unclassified | 711 |
| 232 | Ga0157376_10070834 | 3300014969 | Bacteria | 2961 |
| 233 | Ga0157376_10219775 | 3300014969 | Bacteria | 1759 |
| 234 | Ga0157376_10506212 | 3300014969 | Bacteria | 1188 |
| 235 | Ga0157376_10855342 | 3300014969 | Bacteria | 925 |
| 236 | Ga0157376_11071034 | 3300014969 | Bacteria | 831 |
| 237 | Ga0157376_12804174 | 3300014969 | Bacteria | 527 |
| 238 | Ga0163161_10016186 | 3300017792 | Bacteria | 5204 |
| 239 | Ga0163161_10217261 | 3300017792 | Bacteria | 1479 |
| 240 | Ga0163161_10269217 | 3300017792 | Bacteria | 1333 |
| 241 | Ga0163161_10763585 | 3300017792 | Bacteria | 810 |
| 242 | Ga0213876_10009528 | 3300021384 | Bacteria | 5226 |
| 243 | Ga0207425_1000619 | 3300025245 | Bacteria | 20305 |
| 244 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 245 | Ga0209673_1021175 | 3300025273 | Bacteria | 2282 |
| 246 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 247 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 248 | Ga0209256_1026172 | 3300025299 | Bacteria | 1685 |
| 249 | Ga0207697_10033816 | 3300025315 | Bacteria | 2093 |
| 250 | Ga0207656_10033342 | 3300025321 | Bacteria | 2144 |
| 251 | Ga0207656_10054993 | 3300025321 | Bacteria | 1731 |
| 252 | Ga0207656_10062587 | 3300025321 | Bacteria | 1636 |
| 253 | Ga0207656_10168308 | 3300025321 | Bacteria | 1046 |
| 254 | Ga0207682_10004786 | 3300025893 | Bacteria | 5609 |
| 255 | Ga0207682_10006106 | 3300025893 | Bacteria | 4870 |
| 256 | Ga0207682_10034028 | 3300025893 | Bacteria | 2053 |
| 257 | Ga0207682_10056855 | 3300025893 | Bacteria | 1629 |
| 258 | Ga0207642_10027250 | 3300025899 | Bacteria | 2337 |
| 259 | Ga0207642_10322616 | 3300025899 | Bacteria | 902 |
| 260 | Ga0207642_10821108 | 3300025899 | Bacteria | 592 |
| 261 | Ga0207688_10052552 | 3300025901 | Bacteria | 2283 |
| 262 | Ga0207688_10272269 | 3300025901 | Bacteria | 1030 |
| 263 | Ga0207688_10310506 | 3300025901 | Bacteria | 966 |
| 264 | Ga0207680_10148338 | 3300025903 | Bacteria | 1561 |
| 265 | Ga0207645_10010005 | 3300025907 | Bacteria | 6530 |
| 266 | Ga0207645_10085787 | 3300025907 | Bacteria | 2022 |
| 267 | Ga0207705_10027820 | 3300025909 | Bacteria | 4032 |
| 268 | Ga0207705_10467647 | 3300025909 | Bacteria | 978 |
| 269 | Ga0207662_10046762 | 3300025918 | Bacteria | 2561 |
| 270 | Ga0207662_10704386 | 3300025918 | Bacteria | 708 |
| 271 | Ga0207657_10083566 | 3300025919 | Bacteria | 2678 |
| 272 | Ga0207657_10365358 | 3300025919 | Bacteria | 1137 |
| 273 | Ga0207649_10016004 | 3300025920 | Bacteria | 4222 |
| 274 | Ga0207649_10178352 | 3300025920 | Bacteria | 1485 |
| 275 | Ga0207649_11003120 | 3300025920 | Bacteria | 657 |
| 276 | Ga0207681_10007361 | 3300025923 | Bacteria | 6744 |
| 277 | Ga0207681_10631388 | 3300025923 | Bacteria | 887 |
| 278 | Ga0207681_10908535 | 3300025923 | Bacteria | 737 |
| 279 | Ga0207650_10157416 | 3300025925 | Bacteria | 1797 |
| 280 | Ga0207650_10175936 | 3300025925 | Bacteria | 1703 |
| 281 | Ga0207650_10230625 | 3300025925 | Bacteria | 1493 |
| 282 | Ga0207650_10421550 | 3300025925 | Bacteria | 1107 |
| 283 | Ga0207650_10447590 | 3300025925 | Bacteria | 1074 |
| 284 | Ga0207650_10506619 | 3300025925 | Bacteria | 1009 |
| 285 | Ga0207659_10017664 | 3300025926 | Bacteria | 4662 |
| 286 | Ga0207659_10170517 | 3300025926 | Bacteria | 1717 |
| 287 | Ga0207659_10354386 | 3300025926 | Bacteria | 1218 |
| 288 | Ga0207659_10451218 | 3300025926 | Bacteria | 1083 |
| 289 | Ga0207687_10384784 | 3300025927 | Bacteria | 1150 |
| 290 | Ga0207644_10014818 | 3300025931 | Bacteria | 5226 |
| 291 | Ga0207644_10637303 | 3300025931 | Bacteria | 886 |
| 292 | Ga0207644_10773989 | 3300025931 | Bacteria | 802 |
| 293 | Ga0207690_10010745 | 3300025932 | Bacteria | 5455 |
| 294 | Ga0207690_11271290 | 3300025932 | Bacteria | 615 |
| 295 | Ga0207706_10004316 | 3300025933 | Bacteria | 13357 |
| 296 | Ga0207706_10124501 | 3300025933 | Bacteria | 2268 |
| 297 | Ga0207706_10134501 | 3300025933 | Bacteria | 2175 |
| 298 | Ga0207706_10586205 | 3300025933 | Bacteria | 958 |
| 299 | Ga0207686_10024275 | 3300025934 | Bacteria | 3511 |
| 300 | Ga0207709_10176624 | 3300025935 | Bacteria | 1504 |
| 301 | Ga0207670_10282082 | 3300025936 | Bacteria | 1295 |
| 302 | Ga0207669_10010461 | 3300025937 | Bacteria | 4468 |
| 303 | Ga0207669_10067425 | 3300025937 | Bacteria | 2230 |
| 304 | Ga0207669_10208823 | 3300025937 | Bacteria | 1423 |
| 305 | Ga0207669_10227951 | 3300025937 | Bacteria | 1372 |
| 306 | Ga0207669_10578067 | 3300025937 | Bacteria | 910 |
| 307 | Ga0207704_10004534 | 3300025938 | Bacteria | 6354 |
| 308 | Ga0207704_10227929 | 3300025938 | Bacteria | 1383 |
| 309 | Ga0207704_10260189 | 3300025938 | Bacteria | 1308 |
| 310 | Ga0207665_10051322 | 3300025939 | Bacteria | 2775 |
| 311 | Ga0207691_10041873 | 3300025940 | Bacteria | 4225 |
| 312 | Ga0207691_10076128 | 3300025940 | Bacteria | 3024 |
| 313 | Ga0207691_10089565 | 3300025940 | Bacteria | 2759 |
| 314 | Ga0207691_10153127 | 3300025940 | Bacteria | 2026 |
| 315 | Ga0207691_10168050 | 3300025940 | Bacteria | 1921 |
| 316 | Ga0207691_10172930 | 3300025940 | Bacteria | 1891 |
| 317 | Ga0207691_10182868 | 3300025940 | Bacteria | 1831 |
| 318 | Ga0207691_11217388 | 3300025940 | Bacteria | 624 |
| 319 | Ga0207711_10022818 | 3300025941 | Bacteria | 5237 |
| 320 | Ga0207711_10023435 | 3300025941 | Bacteria | 5167 |
| 321 | Ga0207711_10028987 | 3300025941 | Bacteria | 4665 |
| 322 | Ga0207711_10082885 | 3300025941 | Bacteria | 2804 |
| 323 | Ga0207711_10256622 | 3300025941 | Bacteria | 1606 |
| 324 | Ga0207711_10534600 | 3300025941 | Bacteria | 1093 |
| 325 | Ga0207711_10654217 | 3300025941 | Bacteria | 980 |
| 326 | Ga0207689_10029321 | 3300025942 | Bacteria | 4596 |
| 327 | Ga0207689_10029707 | 3300025942 | Bacteria | 4560 |
| 328 | Ga0207679_10011347 | 3300025945 | Bacteria | 5765 |
| 329 | Ga0207679_10285796 | 3300025945 | Bacteria | 1416 |
| 330 | Ga0207679_10613843 | 3300025945 | Bacteria | 981 |
| 331 | Ga0207679_10729120 | 3300025945 | Bacteria | 901 |
| 332 | Ga0207679_11867448 | 3300025945 | Bacteria | 548 |
| 333 | Ga0207667_10038311 | 3300025949 | Bacteria | 5121 |
| 334 | Ga0207667_11276437 | 3300025949 | Bacteria | 711 |
| 335 | Ga0207651_10066938 | 3300025960 | Bacteria | 2526 |
| 336 | Ga0207651_10377985 | 3300025960 | Bacteria | 1200 |
| 337 | Ga0207651_10406793 | 3300025960 | Bacteria | 1159 |
| 338 | Ga0207651_10898977 | 3300025960 | Bacteria | 788 |
| 339 | Ga0207712_10017376 | 3300025961 | Bacteria | 4670 |
| 340 | Ga0207712_10035127 | 3300025961 | Bacteria | 3402 |
| 341 | Ga0207668_10155183 | 3300025972 | Bacteria | 1777 |
| 342 | Ga0207668_10282383 | 3300025972 | Bacteria | 1362 |
| 343 | Ga0207668_10716960 | 3300025972 | Bacteria | 880 |
| 344 | Ga0207640_10006478 | 3300025981 | Bacteria | 6428 |
| 345 | Ga0207658_10003655 | 3300025986 | Bacteria | 10853 |
| 346 | Ga0207658_10023479 | 3300025986 | Bacteria | 4305 |
| 347 | Ga0207658_10834597 | 3300025986 | Bacteria | 838 |
| 348 | Ga0207677_10114297 | 3300026023 | Bacteria | 2017 |
| 349 | Ga0207677_10173637 | 3300026023 | Bacteria | 1688 |
| 350 | Ga0207703_10003934 | 3300026035 | Bacteria | 12326 |
| 351 | Ga0207703_10004035 | 3300026035 | Bacteria | 12135 |
| 352 | Ga0207639_10076089 | 3300026041 | Bacteria | 2642 |
| 353 | Ga0207639_10122155 | 3300026041 | Bacteria | 2141 |
| 354 | Ga0207639_10297980 | 3300026041 | Bacteria | 1424 |
| 355 | Ga0207678_10026960 | 3300026067 | Bacteria | 5011 |
| 356 | Ga0207678_10539800 | 3300026067 | Bacteria | 1019 |
| 357 | Ga0207678_10742517 | 3300026067 | Bacteria | 865 |
| 358 | Ga0207678_11781460 | 3300026067 | Bacteria | 539 |
| 359 | Ga0207708_10030068 | 3300026075 | Bacteria | 4120 |
| 360 | Ga0207702_10036629 | 3300026078 | Bacteria | 4104 |
| 361 | Ga0207641_10111324 | 3300026088 | Bacteria | 2427 |
| 362 | Ga0207641_10145388 | 3300026088 | Bacteria | 2143 |
| 363 | Ga0207641_10172837 | 3300026088 | Bacteria | 1973 |
| 364 | Ga0207641_12047070 | 3300026088 | Bacteria | 574 |
| 365 | Ga0207648_10024843 | 3300026089 | Bacteria | 5344 |
| 366 | Ga0207648_10030038 | 3300026089 | Bacteria | 4818 |
| 367 | Ga0207648_10220809 | 3300026089 | Bacteria | 1684 |
| 368 | Ga0207648_10326830 | 3300026089 | Bacteria | 1379 |
| 369 | Ga0207676_10027724 | 3300026095 | Bacteria | 4222 |
| 370 | Ga0207676_10029078 | 3300026095 | Bacteria | 4134 |
| 371 | Ga0207676_10029474 | 3300026095 | Bacteria | 4110 |
| 372 | Ga0207674_10211929 | 3300026116 | Bacteria | 1886 |
| 373 | Ga0207674_10451525 | 3300026116 | Bacteria | 1242 |
| 374 | Ga0207674_11535989 | 3300026116 | Bacteria | 635 |
| 375 | Ga0207675_100003935 | 3300026118 | Bacteria | 14420 |
| 376 | Ga0207675_100004056 | 3300026118 | Bacteria | 14185 |
| 377 | Ga0207683_10032105 | 3300026121 | Bacteria | 4560 |
| 378 | Ga0207683_10174615 | 3300026121 | Bacteria | 1947 |
| 379 | Ga0207683_10187078 | 3300026121 | Bacteria | 1879 |
| 380 | Ga0207683_10271798 | 3300026121 | Bacteria | 1548 |
| 381 | Ga0207683_10290091 | 3300026121 | Bacteria | 1496 |
| 382 | Ga0207683_10305389 | 3300026121 | Bacteria | 1456 |
| 383 | Ga0207683_10861201 | 3300026121 | Bacteria | 841 |
| 384 | Ga0207683_11002762 | 3300026121 | Bacteria | 775 |
| 385 | Ga0207698_10017120 | 3300026142 | Bacteria | 4908 |
| 386 | Ga0207698_10064789 | 3300026142 | Bacteria | 2866 |
| 387 | Ga0207698_10530800 | 3300026142 | Bacteria | 1150 |
| 388 | Ga0207698_11132905 | 3300026142 | Bacteria | 796 |
| 389 | Ga0207698_11271409 | 3300026142 | Unclassified | 750 |
| 390 | Ga0209974_10002346 | 3300027876 | Bacteria | 6865 |
| 391 | Ga0268266_11040874 | 3300028379 | Unclassified | 792 |
| 392 | Ga0268265_10016243 | 3300028380 | Bacteria | 5110 |
| 393 | Ga0268265_10184241 | 3300028380 | Bacteria | 1797 |
| 394 | Ga0268264_10010699 | 3300028381 | Bacteria | 7579 |
| 395 | Ga0268264_10013122 | 3300028381 | Bacteria | 6814 |
| 396 | Ga0268264_10288824 | 3300028381 | Bacteria | 1539 |
| 397 | Ga0307515_10000180 | 3300028794 | Bacteria | 156173 |
| 398 | Ga0307515_10042426 | 3300028794 | Bacteria | 7117 |
| 399 | Ga0307513_10002929 | 3300031456 | Bacteria | 23340 |
| 400 | Ga0307513_10012866 | 3300031456 | Bacteria | 10297 |
| 401 | Ga0307513_10044700 | 3300031456 | Bacteria | 4849 |
| 402 | Ga0307408_100091977 | 3300031548 | Bacteria | 2292 |
| 403 | Ga0307408_100519641 | 3300031548 | Bacteria | 1045 |
| 404 | Ga0307408_100683156 | 3300031548 | Bacteria | 921 |
| 405 | Ga0307405_10015992 | 3300031731 | Bacteria | 4080 |
| 406 | Ga0307405_10020439 | 3300031731 | Bacteria | 3699 |
| 407 | Ga0307405_10474979 | 3300031731 | Bacteria | 997 |
| 408 | Ga0307413_10171456 | 3300031824 | Bacteria | 1536 |
| 409 | Ga0307410_10140622 | 3300031852 | Bacteria | 1785 |
| 410 | Ga0307410_10580254 | 3300031852 | Bacteria | 933 |
| 411 | Ga0307406_10052176 | 3300031901 | Bacteria | 2600 |
| 412 | Ga0307407_10211853 | 3300031903 | Unclassified | 1305 |
| 413 | Ga0307412_10010436 | 3300031911 | Bacteria | 5349 |
| 414 | Ga0307412_10264077 | 3300031911 | Bacteria | 1344 |
| 415 | Ga0307412_10618239 | 3300031911 | Bacteria | 920 |
| 416 | Ga0307409_100011848 | 3300031995 | Bacteria | 5522 |
| 417 | Ga0307409_100024026 | 3300031995 | Bacteria | 4240 |
| 418 | Ga0307416_100013171 | 3300032002 | Bacteria | 5612 |
| 419 | Ga0307416_100072217 | 3300032002 | Bacteria | 2871 |
| 420 | Ga0307416_100972404 | 3300032002 | Bacteria | 951 |
| 421 | Ga0307414_10068026 | 3300032004 | Bacteria | 2554 |
| 422 | Ga0307414_11291135 | 3300032004 | Bacteria | 677 |
| 423 | Ga0307411_10001517 | 3300032005 | Bacteria | 9564 |
| 424 | Ga0307411_10039177 | 3300032005 | Bacteria | 2996 |
| 425 | Ga0307411_10293668 | 3300032005 | Bacteria | 1300 |
| 426 | Ga0307415_100029538 | 3300032126 | Bacteria | 3505 |
| 427 | Ga0307415_100032049 | 3300032126 | Bacteria | 3394 |
| 428 | Ga0373934_0426945 | 3300035086 | Unclassified | 555 |
| 429 | Ga0373945_0161915 | 3300035116 | Bacteria | 912 |
| 430 | Ga0373953_0157870 | 3300035117 | Bacteria | 974 |
| 431 | Ga0373946_0149689 | 3300035171 | Bacteria | 1088 |
| 432 | Ga0373927_0350577 | 3300035695 | Bacteria | 973 |
| 433 | Ga0373947_0106128 | 3300035725 | Bacteria | 1770 |
| 434 | Ga0373947_0171315 | 3300035725 | Bacteria | 1409 |
| 435 | Ga0373937_0211522 | 3300036401 | Bacteria | 1825 |
| 436 | Ga0373925_0549227 | 3300037068 | Bacteria | 950 |
| 437 | Ga0395898_1742760 | 3300037466 | Bacteria | 545 |
| 438 | Ga0395905_0023657 | 3300037471 | Bacteria | 5801 |
| 439 | Ga0395905_0084526 | 3300037471 | Bacteria | 2973 |
| 440 | Ga0395905_0209837 | 3300037471 | Bacteria | 1825 |
| 441 | Ga0395905_1663098 | 3300037471 | Bacteria | 543 |
| 442 | Ga0436365_0518101 | 3300039437 | Bacteria | 4489 |
| 443 | Ga0436360_0074551 | 3300039438 | Unclassified | 509 |
| 444 | Ga0451789_0791032 | 3300041443 | Unclassified | 513 |
| 445 | Ga0451793_1933739 | 3300041452 | Unclassified | 549 |
| 446 | Ga0451800_1396471 | 3300041459 | Unclassified | 595 |
| 447 | Ga0451807_1063648 | 3300041486 | Bacteria | 1729 |
| 448 | Ga0451839_1161710 | 3300041496 | Unclassified | 580 |
| 449 | Ga0451841_0744158 | 3300041498 | Bacteria | 514 |
| 450 | Ga0451853_3252086 | 3300041512 | Bacteria | 793 |
| 451 | Ga0451577_0025469 | 3300042876 | Bacteria | 5366 |
| 452 | Ga0466966_0018064 | 3300044684 | Bacteria | 4655 |
| 453 | Ga0466970_0044935 | 3300044765 | Bacteria | 2352 |
| 454 | Ga0466959_0002529 | 3300045049 | Bacteria | 11728 |
| 455 | Ga0451576_0541456 | 3300045051 | Bacteria | 1223 |
| 456 | Ga0495580_0089481 | 3300046472 | Bacteria | 2143 |
| 457 | Ga0495664_0656099 | 3300046477 | Unclassified | 622 |
| 458 | Ga0495586_0458683 | 3300046535 | Unclassified | 735 |
| 459 | Ga0495645_0123148 | 3300046543 | Bacteria | 1824 |
| 460 | Ga0495667_0348144 | 3300046559 | Bacteria | 936 |
| 461 | Ga0495623_0546834 | 3300046679 | Unclassified | 607 |
| 462 | Ga0495647_0158192 | 3300046681 | Bacteria | 975 |
| 463 | Ga0495658_0099451 | 3300046683 | Bacteria | 1734 |
| 464 | Ga0495658_0129362 | 3300046683 | Bacteria | 1535 |
| 465 | Ga0495613_0603417 | 3300046689 | Unclassified | 730 |
| 466 | Ga0495670_0296599 | 3300046691 | Bacteria | 866 |
| 467 | Ga0495681_0135035 | 3300047470 | Bacteria | 1047 |
| 468 | Ga0496100_0232257 | 3300048903 | Bacteria | 1358 |
| 469 | Ga0496100_0479088 | 3300048903 | Bacteria | 957 |
| 470 | Ga0496101_1295719 | 3300048904 | Bacteria | 570 |
| 471 | Ga0496104_0024119 | 3300048907 | Bacteria | 5598 |
| 472 | Ga0496104_0047976 | 3300048907 | Bacteria | 4026 |
| 473 | Ga0496105_0055992 | 3300048908 | Bacteria | 3256 |
| 474 | Ga0496105_0131973 | 3300048908 | Bacteria | 2059 |
| 475 | Ga0496105_0364256 | 3300048908 | Bacteria | 1153 |
| 476 | Ga0496105_0503194 | 3300048908 | Bacteria | 951 |
| 477 | Ga0496106_0966220 | 3300048909 | Bacteria | 671 |
| 478 | Ga0496107_0575538 | 3300048910 | Bacteria | 833 |
| 479 | Ga0496108_0533507 | 3300048911 | Bacteria | 1024 |
| 480 | Ga0496108_0791234 | 3300048911 | Bacteria | 819 |
| 481 | Ga0496109_0415238 | 3300048912 | Bacteria | 1271 |
| 482 | Ga0496109_0618475 | 3300048912 | Bacteria | 1020 |
| 483 | Ga0496109_1161279 | 3300048912 | Bacteria | 709 |
| 484 | Ga0496111_0233843 | 3300048914 | Bacteria | 1365 |
| 485 | Ga0496112_0024162 | 3300048915 | Bacteria | 5816 |
| 486 | Ga0496112_0246800 | 3300048915 | Bacteria | 1737 |
| 487 | Ga0496112_1282999 | 3300048915 | Bacteria | 648 |
| 488 | Ga0496113_0218601 | 3300048916 | Bacteria | 1518 |
| 489 | Ga0496114_0218998 | 3300048917 | Bacteria | 1671 |
| 490 | Ga0496114_0852770 | 3300048917 | Bacteria | 791 |
| 491 | Ga0496114_1071296 | 3300048917 | Bacteria | 690 |
| 492 | Ga0496115_0145115 | 3300048918 | Bacteria | 1959 |
| 493 | Ga0501301_017020 | 3300049524 | Bacteria | 664 |
| 494 | Ga0501239_016593 | 3300049672 | Bacteria | 871 |
| 495 | Ga0501262_002942 | 3300049759 | Bacteria | 1936 |
| 496 | Ga0501265_007314 | 3300049762 | Bacteria | 1298 |
| 497 | Ga0501035_0103460 | 3300049822 | Bacteria | 2498 |
| 498 | nmdc:mga0k408_102820_c1 | 3300050493 | Bacteria | 1685 |
| 499 | nmdc:mga0k408_542868_c1 | 3300050493 | Bacteria | 687 |
| 500 | nmdc:mga09592_2859_c1 | 3300050508 | Bacteria | 14008 |
| 501 | Ga0495601_0194498 | 3300053077 | Bacteria | 1325 |
| 502 | Ga0495612_0160579 | 3300053078 | Bacteria | 981 |
| 503 | Ga0495595_0301461 | 3300053084 | Unclassified | 806 |
| 504 | Ga0500593_006916 | 3300053117 | Bacteria | 4573 |
| 505 | Ga0500636_0482569 | 3300053177 | Bacteria | 552 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028794 | Ga0307515_10000180 | Ga0307515_1000018052 | 121 |
| 2 | 3300005457 | Ga0070662_100438441 | Ga0070662_1004384412 | 122 |
| 3 | 3300053177 | Ga0500636_0482569 | Ga0500636_0482569_124_522 | 122 |
| 4 | 3300005331 | Ga0070670_100031224 | Ga0070670_1000312242 | 124 |
| 5 | 3300005354 | Ga0070675_100023561 | Ga0070675_1000235612 | 124 |
| 6 | 3300005834 | Ga0068851_10233557 | Ga0068851_102335572 | 124 |
| 7 | 3300005841 | Ga0068863_100170181 | Ga0068863_1001701812 | 124 |
| 8 | 3300013306 | Ga0163162_10766616 | Ga0163162_107666162 | 124 |
| 9 | 3300014325 | Ga0163163_10289797 | Ga0163163_102897973 | 124 |
| 10 | 3300017792 | Ga0163161_10763585 | Ga0163161_107635852 | 124 |
| 11 | 3300025321 | Ga0207656_10168308 | Ga0207656_101683082 | 124 |
| 12 | 3300025925 | Ga0207650_10157416 | Ga0207650_101574162 | 124 |
| 13 | 3300025926 | Ga0207659_10354386 | Ga0207659_103543862 | 124 |
| 14 | 3300041496 | Ga0451839_1161710 | Ga0451839_1161710_161_553 | 124 |
| 15 | 3300048911 | Ga0496108_0791234 | Ga0496108_0791234_367_789 | 124 |
| 16 | 3300013308 | Ga0157375_11700437 | Ga0157375_117004372 | 125 |
| 17 | 3300014969 | Ga0157376_10855342 | Ga0157376_108553422 | 125 |
| 18 | 3300031731 | Ga0307405_10020439 | Ga0307405_100204393 | 126 |
| 19 | 3300031824 | Ga0307413_10171456 | Ga0307413_101714562 | 126 |
| 20 | 3300031852 | Ga0307410_10140622 | Ga0307410_101406223 | 126 |
| 21 | 3300031903 | Ga0307407_10211853 | Ga0307407_102118532 | 126 |
| 22 | 3300031911 | Ga0307412_10010436 | Ga0307412_100104363 | 126 |
| 23 | 3300031995 | Ga0307409_100024026 | Ga0307409_1000240263 | 126 |
| 24 | 3300032002 | Ga0307416_100013171 | Ga0307416_1000131712 | 126 |
| 25 | 3300032004 | Ga0307414_10068026 | Ga0307414_100680263 | 126 |
| 26 | 3300032005 | Ga0307411_10001517 | Ga0307411_1000151710 | 126 |
| 27 | 3300032126 | Ga0307415_100032049 | Ga0307415_1000320493 | 126 |
| 28 | 3300037471 | Ga0395905_0084526 | Ga0395905_0084526_177_587 | 126 |
| 29 | 3300041486 | Ga0451807_1063648 | Ga0451807_1063648_1332_1712 | 126 |
| 30 | 3300005295 | Ga0065707_10162173 | Ga0065707_101621731 | 127 |
| 31 | 3300005539 | Ga0068853_101505079 | Ga0068853_1015050791 | 127 |
| 32 | 3300014326 | Ga0157380_10233378 | Ga0157380_102333782 | 127 |
| 33 | 3300028381 | Ga0268264_10288824 | Ga0268264_102888242 | 127 |
| 34 | 3300031456 | Ga0307513_10002929 | Ga0307513_100029295 | 127 |
| 35 | 3300041498 | Ga0451841_0744158 | Ga0451841_0744158_19_447 | 127 |
| 36 | 3300050493 | nmdc:mga0k408_102820_c1 | nmdc:mga0k408_102820_c1_570_998 | 127 |
| 37 | 3300005335 | Ga0070666_11017141 | Ga0070666_110171412 | 128 |
| 38 | 3300005353 | Ga0070669_100198374 | Ga0070669_1001983743 | 128 |
| 39 | 3300005355 | Ga0070671_101549658 | Ga0070671_1015496581 | 128 |
| 40 | 3300005457 | Ga0070662_100445064 | Ga0070662_1004450642 | 128 |
| 41 | 3300005459 | Ga0068867_100070723 | Ga0068867_1000707231 | 128 |
| 42 | 3300005459 | Ga0068867_100254617 | Ga0068867_1002546172 | 128 |
| 43 | 3300005616 | Ga0068852_100882911 | Ga0068852_1008829112 | 128 |
| 44 | 3300014326 | Ga0157380_10677578 | Ga0157380_106775782 | 128 |
| 45 | 3300014969 | Ga0157376_12804174 | Ga0157376_128041741 | 128 |
| 46 | 3300025940 | Ga0207691_10076128 | Ga0207691_100761284 | 128 |
| 47 | 3300025960 | Ga0207651_10406793 | Ga0207651_104067931 | 128 |
| 48 | 3300025986 | Ga0207658_10834597 | Ga0207658_108345972 | 128 |
| 49 | 3300026088 | Ga0207641_12047070 | Ga0207641_120470701 | 128 |
| 50 | 3300026121 | Ga0207683_10305389 | Ga0207683_103053892 | 128 |
| 51 | 3300026121 | Ga0207683_11002762 | Ga0207683_110027622 | 128 |
| 52 | 3300028794 | Ga0307515_10042426 | Ga0307515_100424264 | 128 |
| 53 | 3300031548 | Ga0307408_100519641 | Ga0307408_1005196412 | 128 |
| 54 | 3300032005 | Ga0307411_10293668 | Ga0307411_102936682 | 128 |
| 55 | 3300037466 | Ga0395898_1742760 | Ga0395898_1742760_28_444 | 128 |
| 56 | 3300049524 | Ga0501301_017020 | Ga0501301_017020_206_592 | 128 |
| 57 | 3300049672 | Ga0501239_016593 | Ga0501239_016593_43_429 | 128 |
| 58 | 3300049759 | Ga0501262_002942 | Ga0501262_002942_579_965 | 128 |
| 59 | 3300049762 | Ga0501265_007314 | Ga0501265_007314_283_669 | 128 |
| 60 | 3300049822 | Ga0501035_0103460 | Ga0501035_0103460_1210_1638 | 128 |
| 61 | 3300050493 | nmdc:mga0k408_542868_c1 | nmdc:mga0k408_542868_c1_54_440 | 128 |
| 62 | 3300005843 | Ga0068860_100048804 | Ga0068860_1000488044 | 129 |
| 63 | 3300006880 | Ga0075429_100002479 | Ga0075429_1000024794 | 129 |
| 64 | 3300006914 | Ga0075436_100716567 | Ga0075436_1007165672 | 129 |
| 65 | 3300027876 | Ga0209974_10002346 | Ga0209974_100023464 | 129 |
| 66 | 3300031456 | Ga0307513_10012866 | Ga0307513_100128665 | 129 |
| 67 | 3300031548 | Ga0307408_100683156 | Ga0307408_1006831562 | 129 |
| 68 | 3300031731 | Ga0307405_10474979 | Ga0307405_104749791 | 129 |
| 69 | 3300031911 | Ga0307412_10618239 | Ga0307412_106182392 | 129 |
| 70 | 3300032002 | Ga0307416_100972404 | Ga0307416_1009724041 | 129 |
| 71 | 3300032005 | Ga0307411_10039177 | Ga0307411_100391773 | 129 |
| 72 | 3300037471 | Ga0395905_0023657 | Ga0395905_0023657_4972_5397 | 129 |
| 73 | 3300037471 | Ga0395905_0209837 | Ga0395905_0209837_774_1193 | 129 |
| 74 | 3300037471 | Ga0395905_1663098 | Ga0395905_1663098_54_473 | 129 |
| 75 | 3300042876 | Ga0451577_0025469 | Ga0451577_0025469_1272_1685 | 129 |
| 76 | 3300044684 | Ga0466966_0018064 | Ga0466966_0018064_2918_3352 | 129 |
| 77 | 3300044765 | Ga0466970_0044935 | Ga0466970_0044935_1279_1713 | 129 |
| 78 | 3300045049 | Ga0466959_0002529 | Ga0466959_0002529_419_853 | 129 |
| 79 | 3300050508 | nmdc:mga09592_2859_c1 | nmdc:mga09592_2859_c1_3358_3750 | 129 |
| 80 | 3300053078 | Ga0495612_0160579 | Ga0495612_0160579_389_790 | 129 |
| 81 | 3300005356 | Ga0070674_100284204 | Ga0070674_1002842042 | 130 |
| 82 | 3300005459 | Ga0068867_100450299 | Ga0068867_1004502992 | 130 |
| 83 | 3300009177 | Ga0105248_10000563 | Ga0105248_1000056323 | 130 |
| 84 | 3300025926 | Ga0207659_10170517 | Ga0207659_101705171 | 130 |
| 85 | 3300025941 | Ga0207711_10022818 | Ga0207711_100228185 | 130 |
| 86 | 3300026089 | Ga0207648_10220809 | Ga0207648_102208092 | 130 |
| 87 | 3300036401 | Ga0373937_0211522 | Ga0373937_0211522_1080_1478 | 130 |
| 88 | 3300048907 | Ga0496104_0024119 | Ga0496104_0024119_2696_3127 | 130 |
| 89 | 3300048908 | Ga0496105_0055992 | Ga0496105_0055992_2493_2924 | 130 |
| 90 | 3300048912 | Ga0496109_1161279 | Ga0496109_1161279_142_573 | 130 |
| 91 | 3300048915 | Ga0496112_0024162 | Ga0496112_0024162_4974_5405 | 130 |
| 92 | 3300048916 | Ga0496113_0218601 | Ga0496113_0218601_1034_1465 | 130 |
| 93 | 3300053117 | Ga0500593_006916 | Ga0500593_006916_1329_1721 | 130 |
| 94 | 3300005331 | Ga0070670_100159071 | Ga0070670_1001590712 | 131 |
| 95 | 3300005331 | Ga0070670_100259898 | Ga0070670_1002598982 | 131 |
| 96 | 3300005333 | Ga0070677_10168040 | Ga0070677_101680401 | 131 |
| 97 | 3300005340 | Ga0070689_100627706 | Ga0070689_1006277062 | 131 |
| 98 | 3300005340 | Ga0070689_101644466 | Ga0070689_1016444662 | 131 |
| 99 | 3300005347 | Ga0070668_100020179 | Ga0070668_1000201794 | 131 |
| 100 | 3300005353 | Ga0070669_100059049 | Ga0070669_1000590493 | 131 |
| 101 | 3300005354 | Ga0070675_100051376 | Ga0070675_1000513763 | 131 |
| 102 | 3300005355 | Ga0070671_100572607 | Ga0070671_1005726072 | 131 |
| 103 | 3300005355 | Ga0070671_100759819 | Ga0070671_1007598192 | 131 |
| 104 | 3300005356 | Ga0070674_101379358 | Ga0070674_1013793582 | 131 |
| 105 | 3300005366 | Ga0070659_100328522 | Ga0070659_1003285221 | 131 |
| 106 | 3300005441 | Ga0070700_100473928 | Ga0070700_1004739282 | 131 |
| 107 | 3300005455 | Ga0070663_100829226 | Ga0070663_1008292262 | 131 |
| 108 | 3300005456 | Ga0070678_100215151 | Ga0070678_1002151513 | 131 |
| 109 | 3300005459 | Ga0068867_100076999 | Ga0068867_1000769992 | 131 |
| 110 | 3300005543 | Ga0070672_100070201 | Ga0070672_1000702012 | 131 |
| 111 | 3300005543 | Ga0070672_100389311 | Ga0070672_1003893112 | 131 |
| 112 | 3300005564 | Ga0070664_100439410 | Ga0070664_1004394102 | 131 |
| 113 | 3300005719 | Ga0068861_100149255 | Ga0068861_1001492552 | 131 |
| 114 | 3300005834 | Ga0068851_10123322 | Ga0068851_101233222 | 131 |
| 115 | 3300009148 | Ga0105243_10077444 | Ga0105243_100774443 | 131 |
| 116 | 3300012480 | Ga0157346_1033995 | Ga0157346_10339951 | 131 |
| 117 | 3300013306 | Ga0163162_10280693 | Ga0163162_102806933 | 131 |
| 118 | 3300013308 | Ga0157375_10174358 | Ga0157375_101743583 | 131 |
| 119 | 3300014326 | Ga0157380_10056684 | Ga0157380_100566843 | 131 |
| 120 | 3300014969 | Ga0157376_10070834 | Ga0157376_100708343 | 131 |
| 121 | 3300025321 | Ga0207656_10062587 | Ga0207656_100625872 | 131 |
| 122 | 3300025893 | Ga0207682_10034028 | Ga0207682_100340282 | 131 |
| 123 | 3300025899 | Ga0207642_10322616 | Ga0207642_103226162 | 131 |
| 124 | 3300025901 | Ga0207688_10272269 | Ga0207688_102722692 | 131 |
| 125 | 3300025925 | Ga0207650_10230625 | Ga0207650_102306252 | 131 |
| 126 | 3300025925 | Ga0207650_10421550 | Ga0207650_104215502 | 131 |
| 127 | 3300025933 | Ga0207706_10124501 | Ga0207706_101245013 | 131 |
| 128 | 3300025935 | Ga0207709_10176624 | Ga0207709_101766242 | 131 |
| 129 | 3300025937 | Ga0207669_10067425 | Ga0207669_100674252 | 131 |
| 130 | 3300025938 | Ga0207704_10227929 | Ga0207704_102279292 | 131 |
| 131 | 3300025939 | Ga0207665_10051322 | Ga0207665_100513222 | 131 |
| 132 | 3300025940 | Ga0207691_10153127 | Ga0207691_101531272 | 131 |
| 133 | 3300025940 | Ga0207691_11217388 | Ga0207691_112173882 | 131 |
| 134 | 3300025945 | Ga0207679_10729120 | Ga0207679_107291202 | 131 |
| 135 | 3300025960 | Ga0207651_10377985 | Ga0207651_103779852 | 131 |
| 136 | 3300025961 | Ga0207712_10017376 | Ga0207712_100173764 | 131 |
| 137 | 3300026067 | Ga0207678_10742517 | Ga0207678_107425172 | 131 |
| 138 | 3300026089 | Ga0207648_10326830 | Ga0207648_103268302 | 131 |
| 139 | 3300026121 | Ga0207683_10174615 | Ga0207683_101746153 | 131 |
| 140 | 3300035086 | Ga0373934_0426945 | Ga0373934_0426945_36_452 | 131 |
| 141 | 3300035116 | Ga0373945_0161915 | Ga0373945_0161915_178_591 | 131 |
| 142 | 3300035117 | Ga0373953_0157870 | Ga0373953_0157870_288_704 | 131 |
| 143 | 3300035725 | Ga0373947_0106128 | Ga0373947_0106128_62_478 | 131 |
| 144 | 3300035725 | Ga0373947_0171315 | Ga0373947_0171315_291_704 | 131 |
| 145 | 3300041452 | Ga0451793_1933739 | Ga0451793_1933739_54_470 | 131 |
| 146 | 3300041459 | Ga0451800_1396471 | Ga0451800_1396471_63_479 | 131 |
| 147 | 3300041512 | Ga0451853_3252086 | Ga0451853_3252086_339_755 | 131 |
| 148 | 3300046477 | Ga0495664_0656099 | Ga0495664_0656099_156_572 | 131 |
| 149 | 3300046535 | Ga0495586_0458683 | Ga0495586_0458683_68_484 | 131 |
| 150 | 3300046543 | Ga0495645_0123148 | Ga0495645_0123148_708_1124 | 131 |
| 151 | 3300046559 | Ga0495667_0348144 | Ga0495667_0348144_139_555 | 131 |
| 152 | 3300046679 | Ga0495623_0546834 | Ga0495623_0546834_144_560 | 131 |
| 153 | 3300046681 | Ga0495647_0158192 | Ga0495647_0158192_356_772 | 131 |
| 154 | 3300046683 | Ga0495658_0099451 | Ga0495658_0099451_109_525 | 131 |
| 155 | 3300046689 | Ga0495613_0603417 | Ga0495613_0603417_81_497 | 131 |
| 156 | 3300048903 | Ga0496100_0232257 | Ga0496100_0232257_201_614 | 131 |
| 157 | 3300048904 | Ga0496101_1295719 | Ga0496101_1295719_50_463 | 131 |
| 158 | 3300048907 | Ga0496104_0047976 | Ga0496104_0047976_1829_2242 | 131 |
| 159 | 3300048908 | Ga0496105_0131973 | Ga0496105_0131973_408_821 | 131 |
| 160 | 3300048908 | Ga0496105_0503194 | Ga0496105_0503194_420_836 | 131 |
| 161 | 3300048917 | Ga0496114_0852770 | Ga0496114_0852770_205_618 | 131 |
| 162 | 3300053077 | Ga0495601_0194498 | Ga0495601_0194498_432_848 | 131 |
| 163 | 3300053084 | Ga0495595_0301461 | Ga0495595_0301461_286_702 | 131 |
| 164 | 3300002773 | JGI25152J39213_1002399 | JGI25152J39213_10023994 | 132 |
| 165 | 3300002774 | JGI25150J39212_1015235 | JGI25150J39212_10152352 | 132 |
| 166 | 3300003215 | JGI25153J46596_10000448 | JGI25153J46596_1000044822 | 132 |
| 167 | 3300003771 | Ga0055526_1001528 | Ga0055526_10015287 | 132 |
| 168 | 3300005327 | Ga0070658_10038745 | Ga0070658_100387454 | 132 |
| 169 | 3300005328 | Ga0070676_10011226 | Ga0070676_100112263 | 132 |
| 170 | 3300005328 | Ga0070676_10017824 | Ga0070676_100178243 | 132 |
| 171 | 3300005329 | Ga0070683_100030662 | Ga0070683_1000306624 | 132 |
| 172 | 3300005329 | Ga0070683_100277505 | Ga0070683_1002775052 | 132 |
| 173 | 3300005330 | Ga0070690_100147016 | Ga0070690_1001470161 | 132 |
| 174 | 3300005330 | Ga0070690_100648741 | Ga0070690_1006487412 | 132 |
| 175 | 3300005331 | Ga0070670_100170357 | Ga0070670_1001703572 | 132 |
| 176 | 3300005331 | Ga0070670_100236337 | Ga0070670_1002363373 | 132 |
| 177 | 3300005331 | Ga0070670_100356007 | Ga0070670_1003560072 | 132 |
| 178 | 3300005331 | Ga0070670_101028991 | Ga0070670_1010289912 | 132 |
| 179 | 3300005333 | Ga0070677_10003535 | Ga0070677_100035356 | 132 |
| 180 | 3300005333 | Ga0070677_10005471 | Ga0070677_100054715 | 132 |
| 181 | 3300005333 | Ga0070677_10087685 | Ga0070677_100876852 | 132 |
| 182 | 3300005334 | Ga0068869_100001022 | Ga0068869_1000010226 | 132 |
| 183 | 3300005335 | Ga0070666_10220545 | Ga0070666_102205452 | 132 |
| 184 | 3300005335 | Ga0070666_11352849 | Ga0070666_113528491 | 132 |
| 185 | 3300005337 | Ga0070682_100036970 | Ga0070682_1000369704 | 132 |
| 186 | 3300005338 | Ga0068868_100144617 | Ga0068868_1001446172 | 132 |
| 187 | 3300005338 | Ga0068868_100473716 | Ga0068868_1004737162 | 132 |
| 188 | 3300005338 | Ga0068868_100839259 | Ga0068868_1008392592 | 132 |
| 189 | 3300005338 | Ga0068868_101214735 | Ga0068868_1012147351 | 132 |
| 190 | 3300005339 | Ga0070660_101109870 | Ga0070660_1011098701 | 132 |
| 191 | 3300005343 | Ga0070687_100229945 | Ga0070687_1002299451 | 132 |
| 192 | 3300005344 | Ga0070661_100098688 | Ga0070661_1000986884 | 132 |
| 193 | 3300005344 | Ga0070661_100115960 | Ga0070661_1001159602 | 132 |
| 194 | 3300005344 | Ga0070661_100550156 | Ga0070661_1005501562 | 132 |
| 195 | 3300005345 | Ga0070692_10146618 | Ga0070692_101466182 | 132 |
| 196 | 3300005347 | Ga0070668_100184515 | Ga0070668_1001845153 | 132 |
| 197 | 3300005347 | Ga0070668_100392406 | Ga0070668_1003924062 | 132 |
| 198 | 3300005353 | Ga0070669_100013909 | Ga0070669_1000139096 | 132 |
| 199 | 3300005353 | Ga0070669_100165516 | Ga0070669_1001655161 | 132 |
| 200 | 3300005353 | Ga0070669_100694805 | Ga0070669_1006948052 | 132 |
| 201 | 3300005354 | Ga0070675_100008605 | Ga0070675_1000086052 | 132 |
| 202 | 3300005354 | Ga0070675_100027175 | Ga0070675_1000271752 | 132 |
| 203 | 3300005355 | Ga0070671_100020819 | Ga0070671_1000208192 | 132 |
| 204 | 3300005355 | Ga0070671_100362886 | Ga0070671_1003628861 | 132 |
| 205 | 3300005355 | Ga0070671_100802319 | Ga0070671_1008023191 | 132 |
| 206 | 3300005356 | Ga0070674_100014769 | Ga0070674_1000147692 | 132 |
| 207 | 3300005356 | Ga0070674_100729366 | Ga0070674_1007293662 | 132 |
| 208 | 3300005364 | Ga0070673_100028726 | Ga0070673_1000287262 | 132 |
| 209 | 3300005366 | Ga0070659_100015447 | Ga0070659_1000154475 | 132 |
| 210 | 3300005366 | Ga0070659_100142814 | Ga0070659_1001428142 | 132 |
| 211 | 3300005366 | Ga0070659_100332115 | Ga0070659_1003321151 | 132 |
| 212 | 3300005366 | Ga0070659_101466054 | Ga0070659_1014660542 | 132 |
| 213 | 3300005367 | Ga0070667_100000945 | Ga0070667_1000009456 | 132 |
| 214 | 3300005367 | Ga0070667_100019842 | Ga0070667_1000198425 | 132 |
| 215 | 3300005367 | Ga0070667_100685408 | Ga0070667_1006854081 | 132 |
| 216 | 3300005441 | Ga0070700_100212462 | Ga0070700_1002124622 | 132 |
| 217 | 3300005455 | Ga0070663_100159862 | Ga0070663_1001598622 | 132 |
| 218 | 3300005455 | Ga0070663_100199860 | Ga0070663_1001998602 | 132 |
| 219 | 3300005456 | Ga0070678_100021132 | Ga0070678_1000211325 | 132 |
| 220 | 3300005456 | Ga0070678_100179138 | Ga0070678_1001791382 | 132 |
| 221 | 3300005456 | Ga0070678_100198400 | Ga0070678_1001984002 | 132 |
| 222 | 3300005456 | Ga0070678_100225899 | Ga0070678_1002258992 | 132 |
| 223 | 3300005457 | Ga0070662_100198013 | Ga0070662_1001980132 | 132 |
| 224 | 3300005457 | Ga0070662_100249065 | Ga0070662_1002490652 | 132 |
| 225 | 3300005459 | Ga0068867_100017097 | Ga0068867_1000170976 | 132 |
| 226 | 3300005459 | Ga0068867_100094239 | Ga0068867_1000942392 | 132 |
| 227 | 3300005459 | Ga0068867_100814910 | Ga0068867_1008149101 | 132 |
| 228 | 3300005535 | Ga0070684_100094951 | Ga0070684_1000949514 | 132 |
| 229 | 3300005535 | Ga0070684_100209033 | Ga0070684_1002090332 | 132 |
| 230 | 3300005539 | Ga0068853_100045677 | Ga0068853_1000456774 | 132 |
| 231 | 3300005539 | Ga0068853_100121254 | Ga0068853_1001212542 | 132 |
| 232 | 3300005539 | Ga0068853_100172184 | Ga0068853_1001721843 | 132 |
| 233 | 3300005539 | Ga0068853_100216711 | Ga0068853_1002167112 | 132 |
| 234 | 3300005543 | Ga0070672_100027232 | Ga0070672_1000272325 | 132 |
| 235 | 3300005543 | Ga0070672_100060582 | Ga0070672_1000605823 | 132 |
| 236 | 3300005543 | Ga0070672_100167919 | Ga0070672_1001679192 | 132 |
| 237 | 3300005543 | Ga0070672_100190207 | Ga0070672_1001902072 | 132 |
| 238 | 3300005543 | Ga0070672_100364638 | Ga0070672_1003646382 | 132 |
| 239 | 3300005543 | Ga0070672_100465182 | Ga0070672_1004651822 | 132 |
| 240 | 3300005544 | Ga0070686_100177623 | Ga0070686_1001776232 | 132 |
| 241 | 3300005547 | Ga0070693_100058687 | Ga0070693_1000586872 | 132 |
| 242 | 3300005547 | Ga0070693_100171658 | Ga0070693_1001716582 | 132 |
| 243 | 3300005547 | Ga0070693_100719388 | Ga0070693_1007193881 | 132 |
| 244 | 3300005548 | Ga0070665_100146105 | Ga0070665_1001461053 | 132 |
| 245 | 3300005548 | Ga0070665_100514509 | Ga0070665_1005145091 | 132 |
| 246 | 3300005563 | Ga0068855_100159699 | Ga0068855_1001596994 | 132 |
| 247 | 3300005563 | Ga0068855_100725355 | Ga0068855_1007253552 | 132 |
| 248 | 3300005564 | Ga0070664_100100044 | Ga0070664_1001000443 | 132 |
| 249 | 3300005564 | Ga0070664_100257528 | Ga0070664_1002575283 | 132 |
| 250 | 3300005564 | Ga0070664_100354463 | Ga0070664_1003544632 | 132 |
| 251 | 3300005564 | Ga0070664_100861494 | Ga0070664_1008614942 | 132 |
| 252 | 3300005564 | Ga0070664_101132209 | Ga0070664_1011322092 | 132 |
| 253 | 3300005577 | Ga0068857_100092959 | Ga0068857_1000929592 | 132 |
| 254 | 3300005577 | Ga0068857_100373161 | Ga0068857_1003731613 | 132 |
| 255 | 3300005578 | Ga0068854_100006289 | Ga0068854_1000062892 | 132 |
| 256 | 3300005578 | Ga0068854_100532872 | Ga0068854_1005328722 | 132 |
| 257 | 3300005578 | Ga0068854_100568689 | Ga0068854_1005686892 | 132 |
| 258 | 3300005578 | Ga0068854_100956616 | Ga0068854_1009566162 | 132 |
| 259 | 3300005614 | Ga0068856_100066064 | Ga0068856_1000660644 | 132 |
| 260 | 3300005616 | Ga0068852_100085720 | Ga0068852_1000857203 | 132 |
| 261 | 3300005616 | Ga0068852_100187831 | Ga0068852_1001878312 | 132 |
| 262 | 3300005616 | Ga0068852_100309042 | Ga0068852_1003090422 | 132 |
| 263 | 3300005616 | Ga0068852_100785771 | Ga0068852_1007857711 | 132 |
| 264 | 3300005616 | Ga0068852_101103630 | Ga0068852_1011036302 | 132 |
| 265 | 3300005617 | Ga0068859_100051551 | Ga0068859_1000515513 | 132 |
| 266 | 3300005617 | Ga0068859_100118968 | Ga0068859_1001189682 | 132 |
| 267 | 3300005618 | Ga0068864_100024428 | Ga0068864_1000244286 | 132 |
| 268 | 3300005618 | Ga0068864_100055519 | Ga0068864_1000555192 | 132 |
| 269 | 3300005618 | Ga0068864_100201737 | Ga0068864_1002017372 | 132 |
| 270 | 3300005718 | Ga0068866_10015851 | Ga0068866_100158513 | 132 |
| 271 | 3300005718 | Ga0068866_10333167 | Ga0068866_103331671 | 132 |
| 272 | 3300005719 | Ga0068861_100001754 | Ga0068861_10000175414 | 132 |
| 273 | 3300005719 | Ga0068861_100003902 | Ga0068861_1000039024 | 132 |
| 274 | 3300005719 | Ga0068861_100039958 | Ga0068861_1000399582 | 132 |
| 275 | 3300005834 | Ga0068851_10351520 | Ga0068851_103515202 | 132 |
| 276 | 3300005841 | Ga0068863_100129436 | Ga0068863_1001294363 | 132 |
| 277 | 3300005841 | Ga0068863_100318849 | Ga0068863_1003188492 | 132 |
| 278 | 3300005841 | Ga0068863_101088131 | Ga0068863_1010881312 | 132 |
| 279 | 3300005842 | Ga0068858_100155351 | Ga0068858_1001553512 | 132 |
| 280 | 3300005843 | Ga0068860_100021348 | Ga0068860_1000213484 | 132 |
| 281 | 3300005843 | Ga0068860_100030852 | Ga0068860_1000308525 | 132 |
| 282 | 3300005843 | Ga0068860_102625336 | Ga0068860_1026253361 | 132 |
| 283 | 3300005844 | Ga0068862_100018761 | Ga0068862_1000187614 | 132 |
| 284 | 3300005844 | Ga0068862_100273897 | Ga0068862_1002738972 | 132 |
| 285 | 3300006237 | Ga0097621_100173814 | Ga0097621_1001738142 | 132 |
| 286 | 3300006237 | Ga0097621_100192556 | Ga0097621_1001925563 | 132 |
| 287 | 3300006237 | Ga0097621_100860512 | Ga0097621_1008605122 | 132 |
| 288 | 3300006358 | Ga0068871_100342416 | Ga0068871_1003424162 | 132 |
| 289 | 3300006358 | Ga0068871_100527906 | Ga0068871_1005279062 | 132 |
| 290 | 3300006358 | Ga0068871_101074969 | Ga0068871_1010749692 | 132 |
| 291 | 3300006881 | Ga0068865_100612024 | Ga0068865_1006120242 | 132 |
| 292 | 3300006931 | Ga0097620_100051554 | Ga0097620_1000515543 | 132 |
| 293 | 3300006931 | Ga0097620_100118966 | Ga0097620_1001189662 | 132 |
| 294 | 3300009098 | Ga0105245_10334264 | Ga0105245_103342642 | 132 |
| 295 | 3300009098 | Ga0105245_10588124 | Ga0105245_105881242 | 132 |
| 296 | 3300009148 | Ga0105243_10022500 | Ga0105243_100225003 | 132 |
| 297 | 3300009148 | Ga0105243_10762819 | Ga0105243_107628191 | 132 |
| 298 | 3300009148 | Ga0105243_10811107 | Ga0105243_108111072 | 132 |
| 299 | 3300009174 | Ga0105241_10307230 | Ga0105241_103072302 | 132 |
| 300 | 3300009176 | Ga0105242_10036764 | Ga0105242_100367643 | 132 |
| 301 | 3300009177 | Ga0105248_10061862 | Ga0105248_100618622 | 132 |
| 302 | 3300009177 | Ga0105248_10112888 | Ga0105248_101128883 | 132 |
| 303 | 3300009177 | Ga0105248_10230062 | Ga0105248_102300622 | 132 |
| 304 | 3300009177 | Ga0105248_10262338 | Ga0105248_102623383 | 132 |
| 305 | 3300009177 | Ga0105248_10545004 | Ga0105248_105450042 | 132 |
| 306 | 3300009551 | Ga0105238_10068984 | Ga0105238_100689843 | 132 |
| 307 | 3300009551 | Ga0105238_10523269 | Ga0105238_105232692 | 132 |
| 308 | 3300009551 | Ga0105238_10880377 | Ga0105238_108803772 | 132 |
| 309 | 3300009553 | Ga0105249_10103684 | Ga0105249_101036842 | 132 |
| 310 | 3300010375 | Ga0105239_10350672 | Ga0105239_103506722 | 132 |
| 311 | 3300012508 | Ga0157315_1035471 | Ga0157315_10354712 | 132 |
| 312 | 3300013100 | Ga0157373_10016057 | Ga0157373_100160575 | 132 |
| 313 | 3300013102 | Ga0157371_10083250 | Ga0157371_100832504 | 132 |
| 314 | 3300013104 | Ga0157370_11615178 | Ga0157370_116151782 | 132 |
| 315 | 3300013105 | Ga0157369_10034527 | Ga0157369_100345273 | 132 |
| 316 | 3300013296 | Ga0157374_10028577 | Ga0157374_100285775 | 132 |
| 317 | 3300013296 | Ga0157374_10078403 | Ga0157374_100784032 | 132 |
| 318 | 3300013296 | Ga0157374_10182368 | Ga0157374_101823683 | 132 |
| 319 | 3300013296 | Ga0157374_10956398 | Ga0157374_109563982 | 132 |
| 320 | 3300013296 | Ga0157374_12564838 | Ga0157374_125648381 | 132 |
| 321 | 3300013297 | Ga0157378_11208962 | Ga0157378_112089622 | 132 |
| 322 | 3300013306 | Ga0163162_10026890 | Ga0163162_100268902 | 132 |
| 323 | 3300013306 | Ga0163162_10135885 | Ga0163162_101358852 | 132 |
| 324 | 3300013306 | Ga0163162_10253188 | Ga0163162_102531882 | 132 |
| 325 | 3300013306 | Ga0163162_11589422 | Ga0163162_115894221 | 132 |
| 326 | 3300013307 | Ga0157372_10007404 | Ga0157372_100074044 | 132 |
| 327 | 3300013307 | Ga0157372_10127441 | Ga0157372_101274412 | 132 |
| 328 | 3300013307 | Ga0157372_10812655 | Ga0157372_108126551 | 132 |
| 329 | 3300013308 | Ga0157375_10025412 | Ga0157375_100254124 | 132 |
| 330 | 3300013308 | Ga0157375_10030347 | Ga0157375_100303472 | 132 |
| 331 | 3300013308 | Ga0157375_10545251 | Ga0157375_105452512 | 132 |
| 332 | 3300013308 | Ga0157375_10688908 | Ga0157375_106889082 | 132 |
| 333 | 3300014325 | Ga0163163_10321469 | Ga0163163_103214692 | 132 |
| 334 | 3300014325 | Ga0163163_10913146 | Ga0163163_109131462 | 132 |
| 335 | 3300014326 | Ga0157380_10012299 | Ga0157380_100122996 | 132 |
| 336 | 3300014326 | Ga0157380_10124631 | Ga0157380_101246314 | 132 |
| 337 | 3300014326 | Ga0157380_10386750 | Ga0157380_103867502 | 132 |
| 338 | 3300014497 | Ga0182008_10353665 | Ga0182008_103536652 | 132 |
| 339 | 3300014745 | Ga0157377_10013110 | Ga0157377_100131105 | 132 |
| 340 | 3300014968 | Ga0157379_10010986 | Ga0157379_100109864 | 132 |
| 341 | 3300014968 | Ga0157379_10040167 | Ga0157379_100401675 | 132 |
| 342 | 3300014968 | Ga0157379_10254321 | Ga0157379_102543212 | 132 |
| 343 | 3300014968 | Ga0157379_11266461 | Ga0157379_112664612 | 132 |
| 344 | 3300014969 | Ga0157376_10219775 | Ga0157376_102197752 | 132 |
| 345 | 3300014969 | Ga0157376_10506212 | Ga0157376_105062122 | 132 |
| 346 | 3300014969 | Ga0157376_11071034 | Ga0157376_110710342 | 132 |
| 347 | 3300017792 | Ga0163161_10016186 | Ga0163161_100161863 | 132 |
| 348 | 3300017792 | Ga0163161_10217261 | Ga0163161_102172612 | 132 |
| 349 | 3300017792 | Ga0163161_10269217 | Ga0163161_102692172 | 132 |
| 350 | 3300021384 | Ga0213876_10009528 | Ga0213876_100095282 | 132 |
| 351 | 3300025245 | Ga0207425_1000619 | Ga0207425_10006194 | 132 |
| 352 | 3300025258 | Ga0209129_1000062 | Ga0209129_100006287 | 132 |
| 353 | 3300025273 | Ga0209673_1021175 | Ga0209673_10211753 | 132 |
| 354 | 3300025295 | Ga0209564_1000176 | Ga0209564_10001767 | 132 |
| 355 | 3300025297 | Ga0209758_1000129 | Ga0209758_100012982 | 132 |
| 356 | 3300025299 | Ga0209256_1026172 | Ga0209256_10261723 | 132 |
| 357 | 3300025315 | Ga0207697_10033816 | Ga0207697_100338162 | 132 |
| 358 | 3300025321 | Ga0207656_10033342 | Ga0207656_100333422 | 132 |
| 359 | 3300025321 | Ga0207656_10054993 | Ga0207656_100549932 | 132 |
| 360 | 3300025893 | Ga0207682_10004786 | Ga0207682_100047866 | 132 |
| 361 | 3300025893 | Ga0207682_10006106 | Ga0207682_100061063 | 132 |
| 362 | 3300025893 | Ga0207682_10056855 | Ga0207682_100568552 | 132 |
| 363 | 3300025899 | Ga0207642_10027250 | Ga0207642_100272504 | 132 |
| 364 | 3300025899 | Ga0207642_10821108 | Ga0207642_108211082 | 132 |
| 365 | 3300025901 | Ga0207688_10052552 | Ga0207688_100525523 | 132 |
| 366 | 3300025901 | Ga0207688_10310506 | Ga0207688_103105062 | 132 |
| 367 | 3300025903 | Ga0207680_10148338 | Ga0207680_101483382 | 132 |
| 368 | 3300025907 | Ga0207645_10010005 | Ga0207645_100100057 | 132 |
| 369 | 3300025907 | Ga0207645_10085787 | Ga0207645_100857873 | 132 |
| 370 | 3300025909 | Ga0207705_10027820 | Ga0207705_100278205 | 132 |
| 371 | 3300025909 | Ga0207705_10467647 | Ga0207705_104676472 | 132 |
| 372 | 3300025918 | Ga0207662_10046762 | Ga0207662_100467623 | 132 |
| 373 | 3300025918 | Ga0207662_10704386 | Ga0207662_107043861 | 132 |
| 374 | 3300025919 | Ga0207657_10083566 | Ga0207657_100835662 | 132 |
| 375 | 3300025919 | Ga0207657_10365358 | Ga0207657_103653582 | 132 |
| 376 | 3300025920 | Ga0207649_10016004 | Ga0207649_100160044 | 132 |
| 377 | 3300025920 | Ga0207649_10178352 | Ga0207649_101783521 | 132 |
| 378 | 3300025920 | Ga0207649_11003120 | Ga0207649_110031201 | 132 |
| 379 | 3300025923 | Ga0207681_10007361 | Ga0207681_100073615 | 132 |
| 380 | 3300025923 | Ga0207681_10631388 | Ga0207681_106313882 | 132 |
| 381 | 3300025923 | Ga0207681_10908535 | Ga0207681_109085352 | 132 |
| 382 | 3300025925 | Ga0207650_10175936 | Ga0207650_101759363 | 132 |
| 383 | 3300025925 | Ga0207650_10447590 | Ga0207650_104475902 | 132 |
| 384 | 3300025925 | Ga0207650_10506619 | Ga0207650_105066191 | 132 |
| 385 | 3300025926 | Ga0207659_10017664 | Ga0207659_100176645 | 132 |
| 386 | 3300025926 | Ga0207659_10451218 | Ga0207659_104512182 | 132 |
| 387 | 3300025927 | Ga0207687_10384784 | Ga0207687_103847842 | 132 |
| 388 | 3300025931 | Ga0207644_10014818 | Ga0207644_100148182 | 132 |
| 389 | 3300025931 | Ga0207644_10637303 | Ga0207644_106373032 | 132 |
| 390 | 3300025931 | Ga0207644_10773989 | Ga0207644_107739891 | 132 |
| 391 | 3300025932 | Ga0207690_10010745 | Ga0207690_100107456 | 132 |
| 392 | 3300025932 | Ga0207690_11271290 | Ga0207690_112712902 | 132 |
| 393 | 3300025933 | Ga0207706_10004316 | Ga0207706_1000431614 | 132 |
| 394 | 3300025933 | Ga0207706_10134501 | Ga0207706_101345013 | 132 |
| 395 | 3300025933 | Ga0207706_10586205 | Ga0207706_105862052 | 132 |
| 396 | 3300025934 | Ga0207686_10024275 | Ga0207686_100242753 | 132 |
| 397 | 3300025936 | Ga0207670_10282082 | Ga0207670_102820822 | 132 |
| 398 | 3300025937 | Ga0207669_10010461 | Ga0207669_100104616 | 132 |
| 399 | 3300025937 | Ga0207669_10208823 | Ga0207669_102088232 | 132 |
| 400 | 3300025937 | Ga0207669_10227951 | Ga0207669_102279511 | 132 |
| 401 | 3300025937 | Ga0207669_10578067 | Ga0207669_105780672 | 132 |
| 402 | 3300025938 | Ga0207704_10004534 | Ga0207704_100045342 | 132 |
| 403 | 3300025938 | Ga0207704_10260189 | Ga0207704_102601892 | 132 |
| 404 | 3300025940 | Ga0207691_10041873 | Ga0207691_100418733 | 132 |
| 405 | 3300025940 | Ga0207691_10089565 | Ga0207691_100895654 | 132 |
| 406 | 3300025940 | Ga0207691_10168050 | Ga0207691_101680502 | 132 |
| 407 | 3300025940 | Ga0207691_10172930 | Ga0207691_101729302 | 132 |
| 408 | 3300025940 | Ga0207691_10182868 | Ga0207691_101828683 | 132 |
| 409 | 3300025941 | Ga0207711_10023435 | Ga0207711_100234352 | 132 |
| 410 | 3300025941 | Ga0207711_10028987 | Ga0207711_100289873 | 132 |
| 411 | 3300025941 | Ga0207711_10082885 | Ga0207711_100828852 | 132 |
| 412 | 3300025941 | Ga0207711_10256622 | Ga0207711_102566221 | 132 |
| 413 | 3300025941 | Ga0207711_10534600 | Ga0207711_105346002 | 132 |
| 414 | 3300025941 | Ga0207711_10654217 | Ga0207711_106542172 | 132 |
| 415 | 3300025942 | Ga0207689_10029321 | Ga0207689_100293215 | 132 |
| 416 | 3300025942 | Ga0207689_10029707 | Ga0207689_100297073 | 132 |
| 417 | 3300025945 | Ga0207679_10011347 | Ga0207679_100113474 | 132 |
| 418 | 3300025945 | Ga0207679_10285796 | Ga0207679_102857962 | 132 |
| 419 | 3300025945 | Ga0207679_10613843 | Ga0207679_106138432 | 132 |
| 420 | 3300025945 | Ga0207679_11867448 | Ga0207679_118674481 | 132 |
| 421 | 3300025949 | Ga0207667_10038311 | Ga0207667_100383112 | 132 |
| 422 | 3300025949 | Ga0207667_11276437 | Ga0207667_112764372 | 132 |
| 423 | 3300025960 | Ga0207651_10066938 | Ga0207651_100669381 | 132 |
| 424 | 3300025960 | Ga0207651_10898977 | Ga0207651_108989771 | 132 |
| 425 | 3300025961 | Ga0207712_10035127 | Ga0207712_100351272 | 132 |
| 426 | 3300025972 | Ga0207668_10155183 | Ga0207668_101551832 | 132 |
| 427 | 3300025972 | Ga0207668_10282383 | Ga0207668_102823831 | 132 |
| 428 | 3300025972 | Ga0207668_10716960 | Ga0207668_107169601 | 132 |
| 429 | 3300025981 | Ga0207640_10006478 | Ga0207640_100064787 | 132 |
| 430 | 3300025986 | Ga0207658_10003655 | Ga0207658_100036558 | 132 |
| 431 | 3300025986 | Ga0207658_10023479 | Ga0207658_100234792 | 132 |
| 432 | 3300026023 | Ga0207677_10114297 | Ga0207677_101142972 | 132 |
| 433 | 3300026023 | Ga0207677_10173637 | Ga0207677_101736372 | 132 |
| 434 | 3300026035 | Ga0207703_10003934 | Ga0207703_1000393411 | 132 |
| 435 | 3300026035 | Ga0207703_10004035 | Ga0207703_100040359 | 132 |
| 436 | 3300026041 | Ga0207639_10076089 | Ga0207639_100760894 | 132 |
| 437 | 3300026041 | Ga0207639_10122155 | Ga0207639_101221552 | 132 |
| 438 | 3300026041 | Ga0207639_10297980 | Ga0207639_102979802 | 132 |
| 439 | 3300026067 | Ga0207678_10026960 | Ga0207678_100269603 | 132 |
| 440 | 3300026067 | Ga0207678_10539800 | Ga0207678_105398002 | 132 |
| 441 | 3300026067 | Ga0207678_11781460 | Ga0207678_117814602 | 132 |
| 442 | 3300026075 | Ga0207708_10030068 | Ga0207708_100300683 | 132 |
| 443 | 3300026078 | Ga0207702_10036629 | Ga0207702_100366293 | 132 |
| 444 | 3300026088 | Ga0207641_10111324 | Ga0207641_101113243 | 132 |
| 445 | 3300026088 | Ga0207641_10145388 | Ga0207641_101453883 | 132 |
| 446 | 3300026088 | Ga0207641_10172837 | Ga0207641_101728373 | 132 |
| 447 | 3300026089 | Ga0207648_10024843 | Ga0207648_100248435 | 132 |
| 448 | 3300026089 | Ga0207648_10030038 | Ga0207648_100300385 | 132 |
| 449 | 3300026095 | Ga0207676_10027724 | Ga0207676_100277242 | 132 |
| 450 | 3300026095 | Ga0207676_10029078 | Ga0207676_100290782 | 132 |
| 451 | 3300026095 | Ga0207676_10029474 | Ga0207676_100294742 | 132 |
| 452 | 3300026116 | Ga0207674_10211929 | Ga0207674_102119293 | 132 |
| 453 | 3300026116 | Ga0207674_10451525 | Ga0207674_104515251 | 132 |
| 454 | 3300026116 | Ga0207674_11535989 | Ga0207674_115359891 | 132 |
| 455 | 3300026118 | Ga0207675_100003935 | Ga0207675_1000039357 | 132 |
| 456 | 3300026118 | Ga0207675_100004056 | Ga0207675_10000405614 | 132 |
| 457 | 3300026121 | Ga0207683_10032105 | Ga0207683_100321052 | 132 |
| 458 | 3300026121 | Ga0207683_10187078 | Ga0207683_101870782 | 132 |
| 459 | 3300026121 | Ga0207683_10271798 | Ga0207683_102717982 | 132 |
| 460 | 3300026121 | Ga0207683_10290091 | Ga0207683_102900912 | 132 |
| 461 | 3300026121 | Ga0207683_10861201 | Ga0207683_108612012 | 132 |
| 462 | 3300026142 | Ga0207698_10017120 | Ga0207698_100171205 | 132 |
| 463 | 3300026142 | Ga0207698_10064789 | Ga0207698_100647892 | 132 |
| 464 | 3300026142 | Ga0207698_10530800 | Ga0207698_105308002 | 132 |
| 465 | 3300026142 | Ga0207698_11132905 | Ga0207698_111329051 | 132 |
| 466 | 3300026142 | Ga0207698_11271409 | Ga0207698_112714092 | 132 |
| 467 | 3300028379 | Ga0268266_11040874 | Ga0268266_110408742 | 132 |
| 468 | 3300028380 | Ga0268265_10016243 | Ga0268265_100162433 | 132 |
| 469 | 3300028380 | Ga0268265_10184241 | Ga0268265_101842412 | 132 |
| 470 | 3300028381 | Ga0268264_10010699 | Ga0268264_100106992 | 132 |
| 471 | 3300028381 | Ga0268264_10013122 | Ga0268264_100131223 | 132 |
| 472 | 3300031456 | Ga0307513_10044700 | Ga0307513_100447004 | 132 |
| 473 | 3300031548 | Ga0307408_100091977 | Ga0307408_1000919774 | 132 |
| 474 | 3300031731 | Ga0307405_10015992 | Ga0307405_100159925 | 132 |
| 475 | 3300031852 | Ga0307410_10580254 | Ga0307410_105802542 | 132 |
| 476 | 3300031901 | Ga0307406_10052176 | Ga0307406_100521764 | 132 |
| 477 | 3300031911 | Ga0307412_10264077 | Ga0307412_102640772 | 132 |
| 478 | 3300031995 | Ga0307409_100011848 | Ga0307409_1000118485 | 132 |
| 479 | 3300032002 | Ga0307416_100072217 | Ga0307416_1000722172 | 132 |
| 480 | 3300032004 | Ga0307414_11291135 | Ga0307414_112911351 | 132 |
| 481 | 3300032126 | Ga0307415_100029538 | Ga0307415_1000295382 | 132 |
| 482 | 3300035171 | Ga0373946_0149689 | Ga0373946_0149689_447_866 | 132 |
| 483 | 3300035695 | Ga0373927_0350577 | Ga0373927_0350577_119_538 | 132 |
| 484 | 3300037068 | Ga0373925_0549227 | Ga0373925_0549227_519_938 | 132 |
| 485 | 3300039437 | Ga0436365_0518101 | Ga0436365_0518101_3152_3568 | 132 |
| 486 | 3300039438 | Ga0436360_0074551 | Ga0436360_0074551_38_454 | 132 |
| 487 | 3300041443 | Ga0451789_0791032 | Ga0451789_0791032_69_488 | 132 |
| 488 | 3300045051 | Ga0451576_0541456 | Ga0451576_0541456_53_475 | 132 |
| 489 | 3300046472 | Ga0495580_0089481 | Ga0495580_0089481_574_984 | 132 |
| 490 | 3300046683 | Ga0495658_0129362 | Ga0495658_0129362_368_787 | 132 |
| 491 | 3300046691 | Ga0495670_0296599 | Ga0495670_0296599_146_565 | 132 |
| 492 | 3300047470 | Ga0495681_0135035 | Ga0495681_0135035_543_965 | 132 |
| 493 | 3300048903 | Ga0496100_0479088 | Ga0496100_0479088_71_487 | 132 |
| 494 | 3300048908 | Ga0496105_0364256 | Ga0496105_0364256_675_1091 | 132 |
| 495 | 3300048909 | Ga0496106_0966220 | Ga0496106_0966220_59_475 | 132 |
| 496 | 3300048910 | Ga0496107_0575538 | Ga0496107_0575538_318_734 | 132 |
| 497 | 3300048911 | Ga0496108_0533507 | Ga0496108_0533507_469_891 | 132 |
| 498 | 3300048912 | Ga0496109_0415238 | Ga0496109_0415238_376_792 | 132 |
| 499 | 3300048912 | Ga0496109_0618475 | Ga0496109_0618475_352_771 | 132 |
| 500 | 3300048914 | Ga0496111_0233843 | Ga0496111_0233843_767_1183 | 132 |
| 501 | 3300048915 | Ga0496112_0246800 | Ga0496112_0246800_679_1095 | 132 |
| 502 | 3300048915 | Ga0496112_1282999 | Ga0496112_1282999_138_554 | 132 |
| 503 | 3300048917 | Ga0496114_0218998 | Ga0496114_0218998_663_1079 | 132 |
| 504 | 3300048917 | Ga0496114_1071296 | Ga0496114_1071296_196_615 | 132 |
| 505 | 3300048918 | Ga0496115_0145115 | Ga0496115_0145115_393_809 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gce-assembly1.cif.gz_A | ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 | 0.7581 | 13 | 123 |
| 2ptx-assembly1.cif.gz_A | crystal structure of the t. brucei enolase complexed with sulphate in closed conformation | 0.7515 | 26 | 58 |
| 3gce-assembly1.cif.gz_A | ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 | 0.7389 | 13 | 123 |
| 7bui-assembly1.cif.gz_E | complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase | 0.7364 | 13 | 121 |
| 8hn2-assembly1.cif.gz_B | selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum | 0.7315 | 12 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gkqC02 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.7586 | 13 | 123 | 2.20.25.680 |
| 3gceA00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.7581 | 13 | 123 | 2.102.10.10 |
| 1z01A02 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.7521 | 13 | 125 | 2.20.25.680 |
| 3dqyA00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.7496 | 12 | 120 | 2.102.10.10 |
| 3gceA00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.7389 | 13 | 123 | 2.102.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6PMR7-F1-model_v4 | Rieske 2Fe-2S domain-containing protein | 0.9139 | 12 | 129 |
GO:0046872
GO:0051537 |
| AF-A0A1M5JSY9-F1-model_v4 | Ferredoxin subunit of nitrite reductase or a ring-hydroxylating dioxygenase | 0.9139 | 12 | 131 |
GO:0046872
GO:0051213 GO:0051537 |
| AF-A0A7S7P8J7-F1-model_v4 | Rieske 2Fe-2S domain-containing protein | 0.9123 | 15 | 132 |
GO:0046872
GO:0051537 |
| AF-A0A1H7SRP1-F1-model_v4 | Ferredoxin subunit of nitrite reductase or a ring-hydroxylating dioxygenase | 0.9113 | 11 | 129 |
GO:0046872
GO:0051213 GO:0051537 |
| AF-A0A850QMX4-F1-model_v4 | Rieske 2Fe-2S domain-containing protein | 0.9099 | 15 | 128 |
GO:0046872
GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar