F456434

General Info

Members Datasets Scaffolds Average Seq Length
505 218 505 138

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_102820_c1|nmdc:mga0k408_102820_c1_570_998
Length 142
Sequence VNDAAPQEAALPLCHSAALEEKGRAVVWDVMEWRRPARAFALRYDGQVRAYMNRCLHVPTEMDWQPGEFLDLDKRVILCSIHGASYEPTSGQCVGGPCGRGRLAAIRTEERDGQVYWYPSRDIQPVDFDPPAPGTSPASSFT

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
70 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
208 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
209 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
210 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 5.74
Rhizosphere 89.5
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002399 3300002773 Bacteria 7164
2 JGI25150J39212_1015235 3300002774 Bacteria 1287
3 JGI25153J46596_10000448 3300003215 Bacteria 26516
4 Ga0055526_1001528 3300003771 Bacteria 16371
5 Ga0065707_10162173 3300005295 Bacteria 1554
6 Ga0070658_10038745 3300005327 Bacteria 3843
7 Ga0070676_10011226 3300005328 Bacteria 4871
8 Ga0070676_10017824 3300005328 Bacteria 3931
9 Ga0070683_100030662 3300005329 Bacteria 4884
10 Ga0070683_100277505 3300005329 Bacteria 1594
11 Ga0070690_100147016 3300005330 Bacteria 1604
12 Ga0070690_100648741 3300005330 Bacteria 806
13 Ga0070670_100031224 3300005331 Bacteria 4587
14 Ga0070670_100159071 3300005331 Bacteria 1957
15 Ga0070670_100170357 3300005331 Bacteria 1888
16 Ga0070670_100236337 3300005331 Bacteria 1591
17 Ga0070670_100259898 3300005331 Bacteria 1513
18 Ga0070670_100356007 3300005331 Bacteria 1286
19 Ga0070670_101028991 3300005331 Bacteria 749
20 Ga0070677_10003535 3300005333 Bacteria 5040
21 Ga0070677_10005471 3300005333 Bacteria 4186
22 Ga0070677_10087685 3300005333 Bacteria 1347
23 Ga0070677_10168040 3300005333 Bacteria 1034
24 Ga0068869_100001022 3300005334 Bacteria 16269
25 Ga0070666_10220545 3300005335 Bacteria 1337
26 Ga0070666_11017141 3300005335 Bacteria 615
27 Ga0070666_11352849 3300005335 Bacteria 532
28 Ga0070682_100036970 3300005337 Bacteria 2987
29 Ga0068868_100144617 3300005338 Bacteria 1954
30 Ga0068868_100473716 3300005338 Bacteria 1093
31 Ga0068868_100839259 3300005338 Bacteria 831
32 Ga0068868_101214735 3300005338 Bacteria 697
33 Ga0070660_101109870 3300005339 Bacteria 670
34 Ga0070689_100627706 3300005340 Bacteria 933
35 Ga0070689_101644466 3300005340 Bacteria 584
36 Ga0070687_100229945 3300005343 Bacteria 1141
37 Ga0070661_100098688 3300005344 Bacteria 2169
38 Ga0070661_100115960 3300005344 Bacteria 2003
39 Ga0070661_100550156 3300005344 Bacteria 928
40 Ga0070692_10146618 3300005345 Bacteria 1341
41 Ga0070668_100020179 3300005347 Bacteria 5025
42 Ga0070668_100184515 3300005347 Bacteria 1706
43 Ga0070668_100392406 3300005347 Bacteria 1183
44 Ga0070669_100013909 3300005353 Bacteria 5723
45 Ga0070669_100059049 3300005353 Bacteria 2816
46 Ga0070669_100165516 3300005353 Bacteria 1721
47 Ga0070669_100198374 3300005353 Bacteria 1578
48 Ga0070669_100694805 3300005353 Bacteria 858
49 Ga0070675_100008605 3300005354 Bacteria 7924
50 Ga0070675_100023561 3300005354 Bacteria 4924
51 Ga0070675_100027175 3300005354 Bacteria 4596
52 Ga0070675_100051376 3300005354 Bacteria 3387
53 Ga0070671_100020819 3300005355 Bacteria 5350
54 Ga0070671_100362886 3300005355 Bacteria 1237
55 Ga0070671_100572607 3300005355 Bacteria 975
56 Ga0070671_100759819 3300005355 Bacteria 843
57 Ga0070671_100802319 3300005355 Bacteria 820
58 Ga0070671_101549658 3300005355 Unclassified 587
59 Ga0070674_100014769 3300005356 Bacteria 4860
60 Ga0070674_100284204 3300005356 Bacteria 1312
61 Ga0070674_100729366 3300005356 Bacteria 850
62 Ga0070674_101379358 3300005356 Bacteria 630
63 Ga0070673_100028726 3300005364 Bacteria 4139
64 Ga0070659_100015447 3300005366 Bacteria 5719
65 Ga0070659_100142814 3300005366 Bacteria 1949
66 Ga0070659_100328522 3300005366 Bacteria 1279
67 Ga0070659_100332115 3300005366 Bacteria 1272
68 Ga0070659_101466054 3300005366 Bacteria 607
69 Ga0070667_100000945 3300005367 Bacteria 26692
70 Ga0070667_100019842 3300005367 Bacteria 5577
71 Ga0070667_100685408 3300005367 Bacteria 947
72 Ga0070700_100212462 3300005441 Bacteria 1366
73 Ga0070700_100473928 3300005441 Bacteria 957
74 Ga0070663_100159862 3300005455 Bacteria 1733
75 Ga0070663_100199860 3300005455 Bacteria 1559
76 Ga0070663_100829226 3300005455 Bacteria 795
77 Ga0070678_100021132 3300005456 Bacteria 4285
78 Ga0070678_100179138 3300005456 Bacteria 1733
79 Ga0070678_100198400 3300005456 Bacteria 1655
80 Ga0070678_100215151 3300005456 Bacteria 1594
81 Ga0070678_100225899 3300005456 Bacteria 1558
82 Ga0070662_100198013 3300005457 Bacteria 1592
83 Ga0070662_100249065 3300005457 Bacteria 1427
84 Ga0070662_100438441 3300005457 Bacteria 1083
85 Ga0070662_100445064 3300005457 Bacteria 1075
86 Ga0068867_100017097 3300005459 Bacteria 5152
87 Ga0068867_100070723 3300005459 Bacteria 2609
88 Ga0068867_100076999 3300005459 Bacteria 2505
89 Ga0068867_100094239 3300005459 Bacteria 2276
90 Ga0068867_100254617 3300005459 Bacteria 1429
91 Ga0068867_100450299 3300005459 Bacteria 1097
92 Ga0068867_100814910 3300005459 Bacteria 833
93 Ga0070684_100094951 3300005535 Bacteria 2657
94 Ga0070684_100209033 3300005535 Bacteria 1778
95 Ga0068853_100045677 3300005539 Bacteria 3753
96 Ga0068853_100121254 3300005539 Bacteria 2333
97 Ga0068853_100172184 3300005539 Bacteria 1959
98 Ga0068853_100216711 3300005539 Bacteria 1747
99 Ga0068853_101505079 3300005539 Bacteria 652
100 Ga0070672_100027232 3300005543 Bacteria 4262
101 Ga0070672_100060582 3300005543 Bacteria 2980
102 Ga0070672_100070201 3300005543 Bacteria 2783
103 Ga0070672_100167919 3300005543 Bacteria 1823
104 Ga0070672_100190207 3300005543 Bacteria 1713
105 Ga0070672_100364638 3300005543 Bacteria 1233
106 Ga0070672_100389311 3300005543 Unclassified 1193
107 Ga0070672_100465182 3300005543 Bacteria 1091
108 Ga0070686_100177623 3300005544 Bacteria 1511
109 Ga0070693_100058687 3300005547 Bacteria 2228
110 Ga0070693_100171658 3300005547 Bacteria 1389
111 Ga0070693_100719388 3300005547 Bacteria 733
112 Ga0070665_100146105 3300005548 Bacteria 2367
113 Ga0070665_100514509 3300005548 Bacteria 1208
114 Ga0068855_100159699 3300005563 Bacteria 2559
115 Ga0068855_100725355 3300005563 Bacteria 1062
116 Ga0070664_100100044 3300005564 Bacteria 2520
117 Ga0070664_100257528 3300005564 Bacteria 1569
118 Ga0070664_100354463 3300005564 Bacteria 1335
119 Ga0070664_100439410 3300005564 Bacteria 1197
120 Ga0070664_100861494 3300005564 Bacteria 849
121 Ga0070664_101132209 3300005564 Bacteria 737
122 Ga0068857_100092959 3300005577 Bacteria 2701
123 Ga0068857_100373161 3300005577 Bacteria 1324
124 Ga0068854_100006289 3300005578 Bacteria 7550
125 Ga0068854_100532872 3300005578 Bacteria 993
126 Ga0068854_100568689 3300005578 Bacteria 964
127 Ga0068854_100956616 3300005578 Bacteria 756
128 Ga0068856_100066064 3300005614 Bacteria 3574
129 Ga0068852_100085720 3300005616 Bacteria 2806
130 Ga0068852_100187831 3300005616 Bacteria 1947
131 Ga0068852_100309042 3300005616 Bacteria 1532
132 Ga0068852_100785771 3300005616 Bacteria 965
133 Ga0068852_100882911 3300005616 Bacteria 911
134 Ga0068852_101103630 3300005616 Bacteria 814
135 Ga0068859_100051551 3300005617 Bacteria 4136
136 Ga0068859_100118968 3300005617 Bacteria 2708
137 Ga0068864_100024428 3300005618 Bacteria 5084
138 Ga0068864_100055519 3300005618 Bacteria 3420
139 Ga0068864_100201737 3300005618 Bacteria 1827
140 Ga0068866_10015851 3300005718 Bacteria 3357
141 Ga0068866_10333167 3300005718 Bacteria 959
142 Ga0068861_100001754 3300005719 Bacteria 13938
143 Ga0068861_100003902 3300005719 Bacteria 9971
144 Ga0068861_100039958 3300005719 Bacteria 3505
145 Ga0068861_100149255 3300005719 Bacteria 1916
146 Ga0068851_10123322 3300005834 Bacteria 1394
147 Ga0068851_10233557 3300005834 Bacteria 1037
148 Ga0068851_10351520 3300005834 Bacteria 858
149 Ga0068863_100129436 3300005841 Bacteria 2409
150 Ga0068863_100170181 3300005841 Bacteria 2089
151 Ga0068863_100318849 3300005841 Bacteria 1509
152 Ga0068863_101088131 3300005841 Bacteria 804
153 Ga0068858_100155351 3300005842 Bacteria 2152
154 Ga0068860_100021348 3300005843 Bacteria 6269
155 Ga0068860_100030852 3300005843 Bacteria 5153
156 Ga0068860_100048804 3300005843 Bacteria 4034
157 Ga0068860_102625336 3300005843 Bacteria 523
158 Ga0068862_100018761 3300005844 Bacteria 5764
159 Ga0068862_100273897 3300005844 Bacteria 1545
160 Ga0097621_100173814 3300006237 Bacteria 1858
161 Ga0097621_100192556 3300006237 Bacteria 1766
162 Ga0097621_100860512 3300006237 Bacteria 843
163 Ga0068871_100342416 3300006358 Bacteria 1321
164 Ga0068871_100527906 3300006358 Bacteria 1067
165 Ga0068871_101074969 3300006358 Bacteria 752
166 Ga0075429_100002479 3300006880 Bacteria 15530
167 Ga0068865_100612024 3300006881 Bacteria 922
168 Ga0075436_100716567 3300006914 Bacteria 742
169 Ga0097620_100051554 3300006931 Bacteria 4136
170 Ga0097620_100118966 3300006931 Bacteria 2708
171 Ga0105245_10334264 3300009098 Bacteria 1496
172 Ga0105245_10588124 3300009098 Bacteria 1138
173 Ga0105243_10022500 3300009148 Bacteria 4792
174 Ga0105243_10077444 3300009148 Bacteria 2704
175 Ga0105243_10762819 3300009148 Bacteria 949
176 Ga0105243_10811107 3300009148 Bacteria 923
177 Ga0105241_10307230 3300009174 Bacteria 1363
178 Ga0105242_10036764 3300009176 Bacteria 3930
179 Ga0105248_10000563 3300009177 Bacteria 42070
180 Ga0105248_10061862 3300009177 Bacteria 4204
181 Ga0105248_10112888 3300009177 Bacteria 3065
182 Ga0105248_10230062 3300009177 Bacteria 2087
183 Ga0105248_10262338 3300009177 Bacteria 1945
184 Ga0105248_10545004 3300009177 Bacteria 1309
185 Ga0105238_10068984 3300009551 Bacteria 3536
186 Ga0105238_10523269 3300009551 Bacteria 1189
187 Ga0105238_10880377 3300009551 Bacteria 913
188 Ga0105249_10103684 3300009553 Bacteria 2679
189 Ga0105239_10350672 3300010375 Bacteria 1666
190 Ga0157346_1033995 3300012480 Unclassified 509
191 Ga0157315_1035471 3300012508 Unclassified 607
192 Ga0157373_10016057 3300013100 Bacteria 5465
193 Ga0157371_10083250 3300013102 Bacteria 2265
194 Ga0157370_11615178 3300013104 Bacteria 582
195 Ga0157369_10034527 3300013105 Bacteria 5550
196 Ga0157374_10028577 3300013296 Bacteria 5039
197 Ga0157374_10078403 3300013296 Bacteria 3128
198 Ga0157374_10182368 3300013296 Bacteria 2051
199 Ga0157374_10956398 3300013296 Bacteria 875
200 Ga0157374_12564838 3300013296 Bacteria 537
201 Ga0157378_11208962 3300013297 Bacteria 795
202 Ga0163162_10026890 3300013306 Bacteria 5690
203 Ga0163162_10135885 3300013306 Bacteria 2569
204 Ga0163162_10253188 3300013306 Bacteria 1893
205 Ga0163162_10280693 3300013306 Bacteria 1798
206 Ga0163162_10766616 3300013306 Bacteria 1083
207 Ga0163162_11589422 3300013306 Bacteria 746
208 Ga0157372_10007404 3300013307 Bacteria 11674
209 Ga0157372_10127441 3300013307 Bacteria 2927
210 Ga0157372_10812655 3300013307 Bacteria 1086
211 Ga0157375_10025412 3300013308 Bacteria 5502
212 Ga0157375_10030347 3300013308 Bacteria 5096
213 Ga0157375_10174358 3300013308 Bacteria 2299
214 Ga0157375_10545251 3300013308 Bacteria 1322
215 Ga0157375_10688908 3300013308 Bacteria 1176
216 Ga0157375_11700437 3300013308 Unclassified 747
217 Ga0163163_10289797 3300014325 Bacteria 1689
218 Ga0163163_10321469 3300014325 Bacteria 1601
219 Ga0163163_10913146 3300014325 Bacteria 941
220 Ga0157380_10012299 3300014326 Bacteria 6205
221 Ga0157380_10056684 3300014326 Bacteria 3118
222 Ga0157380_10124631 3300014326 Bacteria 2188
223 Ga0157380_10233378 3300014326 Bacteria 1654
224 Ga0157380_10386750 3300014326 Bacteria 1322
225 Ga0157380_10677578 3300014326 Bacteria 1033
226 Ga0182008_10353665 3300014497 Bacteria 780
227 Ga0157377_10013110 3300014745 Bacteria 4187
228 Ga0157379_10010986 3300014968 Bacteria 7896
229 Ga0157379_10040167 3300014968 Bacteria 4174
230 Ga0157379_10254321 3300014968 Bacteria 1595
231 Ga0157379_11266461 3300014968 Unclassified 711
232 Ga0157376_10070834 3300014969 Bacteria 2961
233 Ga0157376_10219775 3300014969 Bacteria 1759
234 Ga0157376_10506212 3300014969 Bacteria 1188
235 Ga0157376_10855342 3300014969 Bacteria 925
236 Ga0157376_11071034 3300014969 Bacteria 831
237 Ga0157376_12804174 3300014969 Bacteria 527
238 Ga0163161_10016186 3300017792 Bacteria 5204
239 Ga0163161_10217261 3300017792 Bacteria 1479
240 Ga0163161_10269217 3300017792 Bacteria 1333
241 Ga0163161_10763585 3300017792 Bacteria 810
242 Ga0213876_10009528 3300021384 Bacteria 5226
243 Ga0207425_1000619 3300025245 Bacteria 20305
244 Ga0209129_1000062 3300025258 Bacteria 240655
245 Ga0209673_1021175 3300025273 Bacteria 2282
246 Ga0209564_1000176 3300025295 Bacteria 152363
247 Ga0209758_1000129 3300025297 Bacteria 185022
248 Ga0209256_1026172 3300025299 Bacteria 1685
249 Ga0207697_10033816 3300025315 Bacteria 2093
250 Ga0207656_10033342 3300025321 Bacteria 2144
251 Ga0207656_10054993 3300025321 Bacteria 1731
252 Ga0207656_10062587 3300025321 Bacteria 1636
253 Ga0207656_10168308 3300025321 Bacteria 1046
254 Ga0207682_10004786 3300025893 Bacteria 5609
255 Ga0207682_10006106 3300025893 Bacteria 4870
256 Ga0207682_10034028 3300025893 Bacteria 2053
257 Ga0207682_10056855 3300025893 Bacteria 1629
258 Ga0207642_10027250 3300025899 Bacteria 2337
259 Ga0207642_10322616 3300025899 Bacteria 902
260 Ga0207642_10821108 3300025899 Bacteria 592
261 Ga0207688_10052552 3300025901 Bacteria 2283
262 Ga0207688_10272269 3300025901 Bacteria 1030
263 Ga0207688_10310506 3300025901 Bacteria 966
264 Ga0207680_10148338 3300025903 Bacteria 1561
265 Ga0207645_10010005 3300025907 Bacteria 6530
266 Ga0207645_10085787 3300025907 Bacteria 2022
267 Ga0207705_10027820 3300025909 Bacteria 4032
268 Ga0207705_10467647 3300025909 Bacteria 978
269 Ga0207662_10046762 3300025918 Bacteria 2561
270 Ga0207662_10704386 3300025918 Bacteria 708
271 Ga0207657_10083566 3300025919 Bacteria 2678
272 Ga0207657_10365358 3300025919 Bacteria 1137
273 Ga0207649_10016004 3300025920 Bacteria 4222
274 Ga0207649_10178352 3300025920 Bacteria 1485
275 Ga0207649_11003120 3300025920 Bacteria 657
276 Ga0207681_10007361 3300025923 Bacteria 6744
277 Ga0207681_10631388 3300025923 Bacteria 887
278 Ga0207681_10908535 3300025923 Bacteria 737
279 Ga0207650_10157416 3300025925 Bacteria 1797
280 Ga0207650_10175936 3300025925 Bacteria 1703
281 Ga0207650_10230625 3300025925 Bacteria 1493
282 Ga0207650_10421550 3300025925 Bacteria 1107
283 Ga0207650_10447590 3300025925 Bacteria 1074
284 Ga0207650_10506619 3300025925 Bacteria 1009
285 Ga0207659_10017664 3300025926 Bacteria 4662
286 Ga0207659_10170517 3300025926 Bacteria 1717
287 Ga0207659_10354386 3300025926 Bacteria 1218
288 Ga0207659_10451218 3300025926 Bacteria 1083
289 Ga0207687_10384784 3300025927 Bacteria 1150
290 Ga0207644_10014818 3300025931 Bacteria 5226
291 Ga0207644_10637303 3300025931 Bacteria 886
292 Ga0207644_10773989 3300025931 Bacteria 802
293 Ga0207690_10010745 3300025932 Bacteria 5455
294 Ga0207690_11271290 3300025932 Bacteria 615
295 Ga0207706_10004316 3300025933 Bacteria 13357
296 Ga0207706_10124501 3300025933 Bacteria 2268
297 Ga0207706_10134501 3300025933 Bacteria 2175
298 Ga0207706_10586205 3300025933 Bacteria 958
299 Ga0207686_10024275 3300025934 Bacteria 3511
300 Ga0207709_10176624 3300025935 Bacteria 1504
301 Ga0207670_10282082 3300025936 Bacteria 1295
302 Ga0207669_10010461 3300025937 Bacteria 4468
303 Ga0207669_10067425 3300025937 Bacteria 2230
304 Ga0207669_10208823 3300025937 Bacteria 1423
305 Ga0207669_10227951 3300025937 Bacteria 1372
306 Ga0207669_10578067 3300025937 Bacteria 910
307 Ga0207704_10004534 3300025938 Bacteria 6354
308 Ga0207704_10227929 3300025938 Bacteria 1383
309 Ga0207704_10260189 3300025938 Bacteria 1308
310 Ga0207665_10051322 3300025939 Bacteria 2775
311 Ga0207691_10041873 3300025940 Bacteria 4225
312 Ga0207691_10076128 3300025940 Bacteria 3024
313 Ga0207691_10089565 3300025940 Bacteria 2759
314 Ga0207691_10153127 3300025940 Bacteria 2026
315 Ga0207691_10168050 3300025940 Bacteria 1921
316 Ga0207691_10172930 3300025940 Bacteria 1891
317 Ga0207691_10182868 3300025940 Bacteria 1831
318 Ga0207691_11217388 3300025940 Bacteria 624
319 Ga0207711_10022818 3300025941 Bacteria 5237
320 Ga0207711_10023435 3300025941 Bacteria 5167
321 Ga0207711_10028987 3300025941 Bacteria 4665
322 Ga0207711_10082885 3300025941 Bacteria 2804
323 Ga0207711_10256622 3300025941 Bacteria 1606
324 Ga0207711_10534600 3300025941 Bacteria 1093
325 Ga0207711_10654217 3300025941 Bacteria 980
326 Ga0207689_10029321 3300025942 Bacteria 4596
327 Ga0207689_10029707 3300025942 Bacteria 4560
328 Ga0207679_10011347 3300025945 Bacteria 5765
329 Ga0207679_10285796 3300025945 Bacteria 1416
330 Ga0207679_10613843 3300025945 Bacteria 981
331 Ga0207679_10729120 3300025945 Bacteria 901
332 Ga0207679_11867448 3300025945 Bacteria 548
333 Ga0207667_10038311 3300025949 Bacteria 5121
334 Ga0207667_11276437 3300025949 Bacteria 711
335 Ga0207651_10066938 3300025960 Bacteria 2526
336 Ga0207651_10377985 3300025960 Bacteria 1200
337 Ga0207651_10406793 3300025960 Bacteria 1159
338 Ga0207651_10898977 3300025960 Bacteria 788
339 Ga0207712_10017376 3300025961 Bacteria 4670
340 Ga0207712_10035127 3300025961 Bacteria 3402
341 Ga0207668_10155183 3300025972 Bacteria 1777
342 Ga0207668_10282383 3300025972 Bacteria 1362
343 Ga0207668_10716960 3300025972 Bacteria 880
344 Ga0207640_10006478 3300025981 Bacteria 6428
345 Ga0207658_10003655 3300025986 Bacteria 10853
346 Ga0207658_10023479 3300025986 Bacteria 4305
347 Ga0207658_10834597 3300025986 Bacteria 838
348 Ga0207677_10114297 3300026023 Bacteria 2017
349 Ga0207677_10173637 3300026023 Bacteria 1688
350 Ga0207703_10003934 3300026035 Bacteria 12326
351 Ga0207703_10004035 3300026035 Bacteria 12135
352 Ga0207639_10076089 3300026041 Bacteria 2642
353 Ga0207639_10122155 3300026041 Bacteria 2141
354 Ga0207639_10297980 3300026041 Bacteria 1424
355 Ga0207678_10026960 3300026067 Bacteria 5011
356 Ga0207678_10539800 3300026067 Bacteria 1019
357 Ga0207678_10742517 3300026067 Bacteria 865
358 Ga0207678_11781460 3300026067 Bacteria 539
359 Ga0207708_10030068 3300026075 Bacteria 4120
360 Ga0207702_10036629 3300026078 Bacteria 4104
361 Ga0207641_10111324 3300026088 Bacteria 2427
362 Ga0207641_10145388 3300026088 Bacteria 2143
363 Ga0207641_10172837 3300026088 Bacteria 1973
364 Ga0207641_12047070 3300026088 Bacteria 574
365 Ga0207648_10024843 3300026089 Bacteria 5344
366 Ga0207648_10030038 3300026089 Bacteria 4818
367 Ga0207648_10220809 3300026089 Bacteria 1684
368 Ga0207648_10326830 3300026089 Bacteria 1379
369 Ga0207676_10027724 3300026095 Bacteria 4222
370 Ga0207676_10029078 3300026095 Bacteria 4134
371 Ga0207676_10029474 3300026095 Bacteria 4110
372 Ga0207674_10211929 3300026116 Bacteria 1886
373 Ga0207674_10451525 3300026116 Bacteria 1242
374 Ga0207674_11535989 3300026116 Bacteria 635
375 Ga0207675_100003935 3300026118 Bacteria 14420
376 Ga0207675_100004056 3300026118 Bacteria 14185
377 Ga0207683_10032105 3300026121 Bacteria 4560
378 Ga0207683_10174615 3300026121 Bacteria 1947
379 Ga0207683_10187078 3300026121 Bacteria 1879
380 Ga0207683_10271798 3300026121 Bacteria 1548
381 Ga0207683_10290091 3300026121 Bacteria 1496
382 Ga0207683_10305389 3300026121 Bacteria 1456
383 Ga0207683_10861201 3300026121 Bacteria 841
384 Ga0207683_11002762 3300026121 Bacteria 775
385 Ga0207698_10017120 3300026142 Bacteria 4908
386 Ga0207698_10064789 3300026142 Bacteria 2866
387 Ga0207698_10530800 3300026142 Bacteria 1150
388 Ga0207698_11132905 3300026142 Bacteria 796
389 Ga0207698_11271409 3300026142 Unclassified 750
390 Ga0209974_10002346 3300027876 Bacteria 6865
391 Ga0268266_11040874 3300028379 Unclassified 792
392 Ga0268265_10016243 3300028380 Bacteria 5110
393 Ga0268265_10184241 3300028380 Bacteria 1797
394 Ga0268264_10010699 3300028381 Bacteria 7579
395 Ga0268264_10013122 3300028381 Bacteria 6814
396 Ga0268264_10288824 3300028381 Bacteria 1539
397 Ga0307515_10000180 3300028794 Bacteria 156173
398 Ga0307515_10042426 3300028794 Bacteria 7117
399 Ga0307513_10002929 3300031456 Bacteria 23340
400 Ga0307513_10012866 3300031456 Bacteria 10297
401 Ga0307513_10044700 3300031456 Bacteria 4849
402 Ga0307408_100091977 3300031548 Bacteria 2292
403 Ga0307408_100519641 3300031548 Bacteria 1045
404 Ga0307408_100683156 3300031548 Bacteria 921
405 Ga0307405_10015992 3300031731 Bacteria 4080
406 Ga0307405_10020439 3300031731 Bacteria 3699
407 Ga0307405_10474979 3300031731 Bacteria 997
408 Ga0307413_10171456 3300031824 Bacteria 1536
409 Ga0307410_10140622 3300031852 Bacteria 1785
410 Ga0307410_10580254 3300031852 Bacteria 933
411 Ga0307406_10052176 3300031901 Bacteria 2600
412 Ga0307407_10211853 3300031903 Unclassified 1305
413 Ga0307412_10010436 3300031911 Bacteria 5349
414 Ga0307412_10264077 3300031911 Bacteria 1344
415 Ga0307412_10618239 3300031911 Bacteria 920
416 Ga0307409_100011848 3300031995 Bacteria 5522
417 Ga0307409_100024026 3300031995 Bacteria 4240
418 Ga0307416_100013171 3300032002 Bacteria 5612
419 Ga0307416_100072217 3300032002 Bacteria 2871
420 Ga0307416_100972404 3300032002 Bacteria 951
421 Ga0307414_10068026 3300032004 Bacteria 2554
422 Ga0307414_11291135 3300032004 Bacteria 677
423 Ga0307411_10001517 3300032005 Bacteria 9564
424 Ga0307411_10039177 3300032005 Bacteria 2996
425 Ga0307411_10293668 3300032005 Bacteria 1300
426 Ga0307415_100029538 3300032126 Bacteria 3505
427 Ga0307415_100032049 3300032126 Bacteria 3394
428 Ga0373934_0426945 3300035086 Unclassified 555
429 Ga0373945_0161915 3300035116 Bacteria 912
430 Ga0373953_0157870 3300035117 Bacteria 974
431 Ga0373946_0149689 3300035171 Bacteria 1088
432 Ga0373927_0350577 3300035695 Bacteria 973
433 Ga0373947_0106128 3300035725 Bacteria 1770
434 Ga0373947_0171315 3300035725 Bacteria 1409
435 Ga0373937_0211522 3300036401 Bacteria 1825
436 Ga0373925_0549227 3300037068 Bacteria 950
437 Ga0395898_1742760 3300037466 Bacteria 545
438 Ga0395905_0023657 3300037471 Bacteria 5801
439 Ga0395905_0084526 3300037471 Bacteria 2973
440 Ga0395905_0209837 3300037471 Bacteria 1825
441 Ga0395905_1663098 3300037471 Bacteria 543
442 Ga0436365_0518101 3300039437 Bacteria 4489
443 Ga0436360_0074551 3300039438 Unclassified 509
444 Ga0451789_0791032 3300041443 Unclassified 513
445 Ga0451793_1933739 3300041452 Unclassified 549
446 Ga0451800_1396471 3300041459 Unclassified 595
447 Ga0451807_1063648 3300041486 Bacteria 1729
448 Ga0451839_1161710 3300041496 Unclassified 580
449 Ga0451841_0744158 3300041498 Bacteria 514
450 Ga0451853_3252086 3300041512 Bacteria 793
451 Ga0451577_0025469 3300042876 Bacteria 5366
452 Ga0466966_0018064 3300044684 Bacteria 4655
453 Ga0466970_0044935 3300044765 Bacteria 2352
454 Ga0466959_0002529 3300045049 Bacteria 11728
455 Ga0451576_0541456 3300045051 Bacteria 1223
456 Ga0495580_0089481 3300046472 Bacteria 2143
457 Ga0495664_0656099 3300046477 Unclassified 622
458 Ga0495586_0458683 3300046535 Unclassified 735
459 Ga0495645_0123148 3300046543 Bacteria 1824
460 Ga0495667_0348144 3300046559 Bacteria 936
461 Ga0495623_0546834 3300046679 Unclassified 607
462 Ga0495647_0158192 3300046681 Bacteria 975
463 Ga0495658_0099451 3300046683 Bacteria 1734
464 Ga0495658_0129362 3300046683 Bacteria 1535
465 Ga0495613_0603417 3300046689 Unclassified 730
466 Ga0495670_0296599 3300046691 Bacteria 866
467 Ga0495681_0135035 3300047470 Bacteria 1047
468 Ga0496100_0232257 3300048903 Bacteria 1358
469 Ga0496100_0479088 3300048903 Bacteria 957
470 Ga0496101_1295719 3300048904 Bacteria 570
471 Ga0496104_0024119 3300048907 Bacteria 5598
472 Ga0496104_0047976 3300048907 Bacteria 4026
473 Ga0496105_0055992 3300048908 Bacteria 3256
474 Ga0496105_0131973 3300048908 Bacteria 2059
475 Ga0496105_0364256 3300048908 Bacteria 1153
476 Ga0496105_0503194 3300048908 Bacteria 951
477 Ga0496106_0966220 3300048909 Bacteria 671
478 Ga0496107_0575538 3300048910 Bacteria 833
479 Ga0496108_0533507 3300048911 Bacteria 1024
480 Ga0496108_0791234 3300048911 Bacteria 819
481 Ga0496109_0415238 3300048912 Bacteria 1271
482 Ga0496109_0618475 3300048912 Bacteria 1020
483 Ga0496109_1161279 3300048912 Bacteria 709
484 Ga0496111_0233843 3300048914 Bacteria 1365
485 Ga0496112_0024162 3300048915 Bacteria 5816
486 Ga0496112_0246800 3300048915 Bacteria 1737
487 Ga0496112_1282999 3300048915 Bacteria 648
488 Ga0496113_0218601 3300048916 Bacteria 1518
489 Ga0496114_0218998 3300048917 Bacteria 1671
490 Ga0496114_0852770 3300048917 Bacteria 791
491 Ga0496114_1071296 3300048917 Bacteria 690
492 Ga0496115_0145115 3300048918 Bacteria 1959
493 Ga0501301_017020 3300049524 Bacteria 664
494 Ga0501239_016593 3300049672 Bacteria 871
495 Ga0501262_002942 3300049759 Bacteria 1936
496 Ga0501265_007314 3300049762 Bacteria 1298
497 Ga0501035_0103460 3300049822 Bacteria 2498
498 nmdc:mga0k408_102820_c1 3300050493 Bacteria 1685
499 nmdc:mga0k408_542868_c1 3300050493 Bacteria 687
500 nmdc:mga09592_2859_c1 3300050508 Bacteria 14008
501 Ga0495601_0194498 3300053077 Bacteria 1325
502 Ga0495612_0160579 3300053078 Bacteria 981
503 Ga0495595_0301461 3300053084 Unclassified 806
504 Ga0500593_006916 3300053117 Bacteria 4573
505 Ga0500636_0482569 3300053177 Bacteria 552

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10000180 Ga0307515_1000018052 121
2 3300005457 Ga0070662_100438441 Ga0070662_1004384412 122
3 3300053177 Ga0500636_0482569 Ga0500636_0482569_124_522 122
4 3300005331 Ga0070670_100031224 Ga0070670_1000312242 124
5 3300005354 Ga0070675_100023561 Ga0070675_1000235612 124
6 3300005834 Ga0068851_10233557 Ga0068851_102335572 124
7 3300005841 Ga0068863_100170181 Ga0068863_1001701812 124
8 3300013306 Ga0163162_10766616 Ga0163162_107666162 124
9 3300014325 Ga0163163_10289797 Ga0163163_102897973 124
10 3300017792 Ga0163161_10763585 Ga0163161_107635852 124
11 3300025321 Ga0207656_10168308 Ga0207656_101683082 124
12 3300025925 Ga0207650_10157416 Ga0207650_101574162 124
13 3300025926 Ga0207659_10354386 Ga0207659_103543862 124
14 3300041496 Ga0451839_1161710 Ga0451839_1161710_161_553 124
15 3300048911 Ga0496108_0791234 Ga0496108_0791234_367_789 124
16 3300013308 Ga0157375_11700437 Ga0157375_117004372 125
17 3300014969 Ga0157376_10855342 Ga0157376_108553422 125
18 3300031731 Ga0307405_10020439 Ga0307405_100204393 126
19 3300031824 Ga0307413_10171456 Ga0307413_101714562 126
20 3300031852 Ga0307410_10140622 Ga0307410_101406223 126
21 3300031903 Ga0307407_10211853 Ga0307407_102118532 126
22 3300031911 Ga0307412_10010436 Ga0307412_100104363 126
23 3300031995 Ga0307409_100024026 Ga0307409_1000240263 126
24 3300032002 Ga0307416_100013171 Ga0307416_1000131712 126
25 3300032004 Ga0307414_10068026 Ga0307414_100680263 126
26 3300032005 Ga0307411_10001517 Ga0307411_1000151710 126
27 3300032126 Ga0307415_100032049 Ga0307415_1000320493 126
28 3300037471 Ga0395905_0084526 Ga0395905_0084526_177_587 126
29 3300041486 Ga0451807_1063648 Ga0451807_1063648_1332_1712 126
30 3300005295 Ga0065707_10162173 Ga0065707_101621731 127
31 3300005539 Ga0068853_101505079 Ga0068853_1015050791 127
32 3300014326 Ga0157380_10233378 Ga0157380_102333782 127
33 3300028381 Ga0268264_10288824 Ga0268264_102888242 127
34 3300031456 Ga0307513_10002929 Ga0307513_100029295 127
35 3300041498 Ga0451841_0744158 Ga0451841_0744158_19_447 127
36 3300050493 nmdc:mga0k408_102820_c1 nmdc:mga0k408_102820_c1_570_998 127
37 3300005335 Ga0070666_11017141 Ga0070666_110171412 128
38 3300005353 Ga0070669_100198374 Ga0070669_1001983743 128
39 3300005355 Ga0070671_101549658 Ga0070671_1015496581 128
40 3300005457 Ga0070662_100445064 Ga0070662_1004450642 128
41 3300005459 Ga0068867_100070723 Ga0068867_1000707231 128
42 3300005459 Ga0068867_100254617 Ga0068867_1002546172 128
43 3300005616 Ga0068852_100882911 Ga0068852_1008829112 128
44 3300014326 Ga0157380_10677578 Ga0157380_106775782 128
45 3300014969 Ga0157376_12804174 Ga0157376_128041741 128
46 3300025940 Ga0207691_10076128 Ga0207691_100761284 128
47 3300025960 Ga0207651_10406793 Ga0207651_104067931 128
48 3300025986 Ga0207658_10834597 Ga0207658_108345972 128
49 3300026088 Ga0207641_12047070 Ga0207641_120470701 128
50 3300026121 Ga0207683_10305389 Ga0207683_103053892 128
51 3300026121 Ga0207683_11002762 Ga0207683_110027622 128
52 3300028794 Ga0307515_10042426 Ga0307515_100424264 128
53 3300031548 Ga0307408_100519641 Ga0307408_1005196412 128
54 3300032005 Ga0307411_10293668 Ga0307411_102936682 128
55 3300037466 Ga0395898_1742760 Ga0395898_1742760_28_444 128
56 3300049524 Ga0501301_017020 Ga0501301_017020_206_592 128
57 3300049672 Ga0501239_016593 Ga0501239_016593_43_429 128
58 3300049759 Ga0501262_002942 Ga0501262_002942_579_965 128
59 3300049762 Ga0501265_007314 Ga0501265_007314_283_669 128
60 3300049822 Ga0501035_0103460 Ga0501035_0103460_1210_1638 128
61 3300050493 nmdc:mga0k408_542868_c1 nmdc:mga0k408_542868_c1_54_440 128
62 3300005843 Ga0068860_100048804 Ga0068860_1000488044 129
63 3300006880 Ga0075429_100002479 Ga0075429_1000024794 129
64 3300006914 Ga0075436_100716567 Ga0075436_1007165672 129
65 3300027876 Ga0209974_10002346 Ga0209974_100023464 129
66 3300031456 Ga0307513_10012866 Ga0307513_100128665 129
67 3300031548 Ga0307408_100683156 Ga0307408_1006831562 129
68 3300031731 Ga0307405_10474979 Ga0307405_104749791 129
69 3300031911 Ga0307412_10618239 Ga0307412_106182392 129
70 3300032002 Ga0307416_100972404 Ga0307416_1009724041 129
71 3300032005 Ga0307411_10039177 Ga0307411_100391773 129
72 3300037471 Ga0395905_0023657 Ga0395905_0023657_4972_5397 129
73 3300037471 Ga0395905_0209837 Ga0395905_0209837_774_1193 129
74 3300037471 Ga0395905_1663098 Ga0395905_1663098_54_473 129
75 3300042876 Ga0451577_0025469 Ga0451577_0025469_1272_1685 129
76 3300044684 Ga0466966_0018064 Ga0466966_0018064_2918_3352 129
77 3300044765 Ga0466970_0044935 Ga0466970_0044935_1279_1713 129
78 3300045049 Ga0466959_0002529 Ga0466959_0002529_419_853 129
79 3300050508 nmdc:mga09592_2859_c1 nmdc:mga09592_2859_c1_3358_3750 129
80 3300053078 Ga0495612_0160579 Ga0495612_0160579_389_790 129
81 3300005356 Ga0070674_100284204 Ga0070674_1002842042 130
82 3300005459 Ga0068867_100450299 Ga0068867_1004502992 130
83 3300009177 Ga0105248_10000563 Ga0105248_1000056323 130
84 3300025926 Ga0207659_10170517 Ga0207659_101705171 130
85 3300025941 Ga0207711_10022818 Ga0207711_100228185 130
86 3300026089 Ga0207648_10220809 Ga0207648_102208092 130
87 3300036401 Ga0373937_0211522 Ga0373937_0211522_1080_1478 130
88 3300048907 Ga0496104_0024119 Ga0496104_0024119_2696_3127 130
89 3300048908 Ga0496105_0055992 Ga0496105_0055992_2493_2924 130
90 3300048912 Ga0496109_1161279 Ga0496109_1161279_142_573 130
91 3300048915 Ga0496112_0024162 Ga0496112_0024162_4974_5405 130
92 3300048916 Ga0496113_0218601 Ga0496113_0218601_1034_1465 130
93 3300053117 Ga0500593_006916 Ga0500593_006916_1329_1721 130
94 3300005331 Ga0070670_100159071 Ga0070670_1001590712 131
95 3300005331 Ga0070670_100259898 Ga0070670_1002598982 131
96 3300005333 Ga0070677_10168040 Ga0070677_101680401 131
97 3300005340 Ga0070689_100627706 Ga0070689_1006277062 131
98 3300005340 Ga0070689_101644466 Ga0070689_1016444662 131
99 3300005347 Ga0070668_100020179 Ga0070668_1000201794 131
100 3300005353 Ga0070669_100059049 Ga0070669_1000590493 131
101 3300005354 Ga0070675_100051376 Ga0070675_1000513763 131
102 3300005355 Ga0070671_100572607 Ga0070671_1005726072 131
103 3300005355 Ga0070671_100759819 Ga0070671_1007598192 131
104 3300005356 Ga0070674_101379358 Ga0070674_1013793582 131
105 3300005366 Ga0070659_100328522 Ga0070659_1003285221 131
106 3300005441 Ga0070700_100473928 Ga0070700_1004739282 131
107 3300005455 Ga0070663_100829226 Ga0070663_1008292262 131
108 3300005456 Ga0070678_100215151 Ga0070678_1002151513 131
109 3300005459 Ga0068867_100076999 Ga0068867_1000769992 131
110 3300005543 Ga0070672_100070201 Ga0070672_1000702012 131
111 3300005543 Ga0070672_100389311 Ga0070672_1003893112 131
112 3300005564 Ga0070664_100439410 Ga0070664_1004394102 131
113 3300005719 Ga0068861_100149255 Ga0068861_1001492552 131
114 3300005834 Ga0068851_10123322 Ga0068851_101233222 131
115 3300009148 Ga0105243_10077444 Ga0105243_100774443 131
116 3300012480 Ga0157346_1033995 Ga0157346_10339951 131
117 3300013306 Ga0163162_10280693 Ga0163162_102806933 131
118 3300013308 Ga0157375_10174358 Ga0157375_101743583 131
119 3300014326 Ga0157380_10056684 Ga0157380_100566843 131
120 3300014969 Ga0157376_10070834 Ga0157376_100708343 131
121 3300025321 Ga0207656_10062587 Ga0207656_100625872 131
122 3300025893 Ga0207682_10034028 Ga0207682_100340282 131
123 3300025899 Ga0207642_10322616 Ga0207642_103226162 131
124 3300025901 Ga0207688_10272269 Ga0207688_102722692 131
125 3300025925 Ga0207650_10230625 Ga0207650_102306252 131
126 3300025925 Ga0207650_10421550 Ga0207650_104215502 131
127 3300025933 Ga0207706_10124501 Ga0207706_101245013 131
128 3300025935 Ga0207709_10176624 Ga0207709_101766242 131
129 3300025937 Ga0207669_10067425 Ga0207669_100674252 131
130 3300025938 Ga0207704_10227929 Ga0207704_102279292 131
131 3300025939 Ga0207665_10051322 Ga0207665_100513222 131
132 3300025940 Ga0207691_10153127 Ga0207691_101531272 131
133 3300025940 Ga0207691_11217388 Ga0207691_112173882 131
134 3300025945 Ga0207679_10729120 Ga0207679_107291202 131
135 3300025960 Ga0207651_10377985 Ga0207651_103779852 131
136 3300025961 Ga0207712_10017376 Ga0207712_100173764 131
137 3300026067 Ga0207678_10742517 Ga0207678_107425172 131
138 3300026089 Ga0207648_10326830 Ga0207648_103268302 131
139 3300026121 Ga0207683_10174615 Ga0207683_101746153 131
140 3300035086 Ga0373934_0426945 Ga0373934_0426945_36_452 131
141 3300035116 Ga0373945_0161915 Ga0373945_0161915_178_591 131
142 3300035117 Ga0373953_0157870 Ga0373953_0157870_288_704 131
143 3300035725 Ga0373947_0106128 Ga0373947_0106128_62_478 131
144 3300035725 Ga0373947_0171315 Ga0373947_0171315_291_704 131
145 3300041452 Ga0451793_1933739 Ga0451793_1933739_54_470 131
146 3300041459 Ga0451800_1396471 Ga0451800_1396471_63_479 131
147 3300041512 Ga0451853_3252086 Ga0451853_3252086_339_755 131
148 3300046477 Ga0495664_0656099 Ga0495664_0656099_156_572 131
149 3300046535 Ga0495586_0458683 Ga0495586_0458683_68_484 131
150 3300046543 Ga0495645_0123148 Ga0495645_0123148_708_1124 131
151 3300046559 Ga0495667_0348144 Ga0495667_0348144_139_555 131
152 3300046679 Ga0495623_0546834 Ga0495623_0546834_144_560 131
153 3300046681 Ga0495647_0158192 Ga0495647_0158192_356_772 131
154 3300046683 Ga0495658_0099451 Ga0495658_0099451_109_525 131
155 3300046689 Ga0495613_0603417 Ga0495613_0603417_81_497 131
156 3300048903 Ga0496100_0232257 Ga0496100_0232257_201_614 131
157 3300048904 Ga0496101_1295719 Ga0496101_1295719_50_463 131
158 3300048907 Ga0496104_0047976 Ga0496104_0047976_1829_2242 131
159 3300048908 Ga0496105_0131973 Ga0496105_0131973_408_821 131
160 3300048908 Ga0496105_0503194 Ga0496105_0503194_420_836 131
161 3300048917 Ga0496114_0852770 Ga0496114_0852770_205_618 131
162 3300053077 Ga0495601_0194498 Ga0495601_0194498_432_848 131
163 3300053084 Ga0495595_0301461 Ga0495595_0301461_286_702 131
164 3300002773 JGI25152J39213_1002399 JGI25152J39213_10023994 132
165 3300002774 JGI25150J39212_1015235 JGI25150J39212_10152352 132
166 3300003215 JGI25153J46596_10000448 JGI25153J46596_1000044822 132
167 3300003771 Ga0055526_1001528 Ga0055526_10015287 132
168 3300005327 Ga0070658_10038745 Ga0070658_100387454 132
169 3300005328 Ga0070676_10011226 Ga0070676_100112263 132
170 3300005328 Ga0070676_10017824 Ga0070676_100178243 132
171 3300005329 Ga0070683_100030662 Ga0070683_1000306624 132
172 3300005329 Ga0070683_100277505 Ga0070683_1002775052 132
173 3300005330 Ga0070690_100147016 Ga0070690_1001470161 132
174 3300005330 Ga0070690_100648741 Ga0070690_1006487412 132
175 3300005331 Ga0070670_100170357 Ga0070670_1001703572 132
176 3300005331 Ga0070670_100236337 Ga0070670_1002363373 132
177 3300005331 Ga0070670_100356007 Ga0070670_1003560072 132
178 3300005331 Ga0070670_101028991 Ga0070670_1010289912 132
179 3300005333 Ga0070677_10003535 Ga0070677_100035356 132
180 3300005333 Ga0070677_10005471 Ga0070677_100054715 132
181 3300005333 Ga0070677_10087685 Ga0070677_100876852 132
182 3300005334 Ga0068869_100001022 Ga0068869_1000010226 132
183 3300005335 Ga0070666_10220545 Ga0070666_102205452 132
184 3300005335 Ga0070666_11352849 Ga0070666_113528491 132
185 3300005337 Ga0070682_100036970 Ga0070682_1000369704 132
186 3300005338 Ga0068868_100144617 Ga0068868_1001446172 132
187 3300005338 Ga0068868_100473716 Ga0068868_1004737162 132
188 3300005338 Ga0068868_100839259 Ga0068868_1008392592 132
189 3300005338 Ga0068868_101214735 Ga0068868_1012147351 132
190 3300005339 Ga0070660_101109870 Ga0070660_1011098701 132
191 3300005343 Ga0070687_100229945 Ga0070687_1002299451 132
192 3300005344 Ga0070661_100098688 Ga0070661_1000986884 132
193 3300005344 Ga0070661_100115960 Ga0070661_1001159602 132
194 3300005344 Ga0070661_100550156 Ga0070661_1005501562 132
195 3300005345 Ga0070692_10146618 Ga0070692_101466182 132
196 3300005347 Ga0070668_100184515 Ga0070668_1001845153 132
197 3300005347 Ga0070668_100392406 Ga0070668_1003924062 132
198 3300005353 Ga0070669_100013909 Ga0070669_1000139096 132
199 3300005353 Ga0070669_100165516 Ga0070669_1001655161 132
200 3300005353 Ga0070669_100694805 Ga0070669_1006948052 132
201 3300005354 Ga0070675_100008605 Ga0070675_1000086052 132
202 3300005354 Ga0070675_100027175 Ga0070675_1000271752 132
203 3300005355 Ga0070671_100020819 Ga0070671_1000208192 132
204 3300005355 Ga0070671_100362886 Ga0070671_1003628861 132
205 3300005355 Ga0070671_100802319 Ga0070671_1008023191 132
206 3300005356 Ga0070674_100014769 Ga0070674_1000147692 132
207 3300005356 Ga0070674_100729366 Ga0070674_1007293662 132
208 3300005364 Ga0070673_100028726 Ga0070673_1000287262 132
209 3300005366 Ga0070659_100015447 Ga0070659_1000154475 132
210 3300005366 Ga0070659_100142814 Ga0070659_1001428142 132
211 3300005366 Ga0070659_100332115 Ga0070659_1003321151 132
212 3300005366 Ga0070659_101466054 Ga0070659_1014660542 132
213 3300005367 Ga0070667_100000945 Ga0070667_1000009456 132
214 3300005367 Ga0070667_100019842 Ga0070667_1000198425 132
215 3300005367 Ga0070667_100685408 Ga0070667_1006854081 132
216 3300005441 Ga0070700_100212462 Ga0070700_1002124622 132
217 3300005455 Ga0070663_100159862 Ga0070663_1001598622 132
218 3300005455 Ga0070663_100199860 Ga0070663_1001998602 132
219 3300005456 Ga0070678_100021132 Ga0070678_1000211325 132
220 3300005456 Ga0070678_100179138 Ga0070678_1001791382 132
221 3300005456 Ga0070678_100198400 Ga0070678_1001984002 132
222 3300005456 Ga0070678_100225899 Ga0070678_1002258992 132
223 3300005457 Ga0070662_100198013 Ga0070662_1001980132 132
224 3300005457 Ga0070662_100249065 Ga0070662_1002490652 132
225 3300005459 Ga0068867_100017097 Ga0068867_1000170976 132
226 3300005459 Ga0068867_100094239 Ga0068867_1000942392 132
227 3300005459 Ga0068867_100814910 Ga0068867_1008149101 132
228 3300005535 Ga0070684_100094951 Ga0070684_1000949514 132
229 3300005535 Ga0070684_100209033 Ga0070684_1002090332 132
230 3300005539 Ga0068853_100045677 Ga0068853_1000456774 132
231 3300005539 Ga0068853_100121254 Ga0068853_1001212542 132
232 3300005539 Ga0068853_100172184 Ga0068853_1001721843 132
233 3300005539 Ga0068853_100216711 Ga0068853_1002167112 132
234 3300005543 Ga0070672_100027232 Ga0070672_1000272325 132
235 3300005543 Ga0070672_100060582 Ga0070672_1000605823 132
236 3300005543 Ga0070672_100167919 Ga0070672_1001679192 132
237 3300005543 Ga0070672_100190207 Ga0070672_1001902072 132
238 3300005543 Ga0070672_100364638 Ga0070672_1003646382 132
239 3300005543 Ga0070672_100465182 Ga0070672_1004651822 132
240 3300005544 Ga0070686_100177623 Ga0070686_1001776232 132
241 3300005547 Ga0070693_100058687 Ga0070693_1000586872 132
242 3300005547 Ga0070693_100171658 Ga0070693_1001716582 132
243 3300005547 Ga0070693_100719388 Ga0070693_1007193881 132
244 3300005548 Ga0070665_100146105 Ga0070665_1001461053 132
245 3300005548 Ga0070665_100514509 Ga0070665_1005145091 132
246 3300005563 Ga0068855_100159699 Ga0068855_1001596994 132
247 3300005563 Ga0068855_100725355 Ga0068855_1007253552 132
248 3300005564 Ga0070664_100100044 Ga0070664_1001000443 132
249 3300005564 Ga0070664_100257528 Ga0070664_1002575283 132
250 3300005564 Ga0070664_100354463 Ga0070664_1003544632 132
251 3300005564 Ga0070664_100861494 Ga0070664_1008614942 132
252 3300005564 Ga0070664_101132209 Ga0070664_1011322092 132
253 3300005577 Ga0068857_100092959 Ga0068857_1000929592 132
254 3300005577 Ga0068857_100373161 Ga0068857_1003731613 132
255 3300005578 Ga0068854_100006289 Ga0068854_1000062892 132
256 3300005578 Ga0068854_100532872 Ga0068854_1005328722 132
257 3300005578 Ga0068854_100568689 Ga0068854_1005686892 132
258 3300005578 Ga0068854_100956616 Ga0068854_1009566162 132
259 3300005614 Ga0068856_100066064 Ga0068856_1000660644 132
260 3300005616 Ga0068852_100085720 Ga0068852_1000857203 132
261 3300005616 Ga0068852_100187831 Ga0068852_1001878312 132
262 3300005616 Ga0068852_100309042 Ga0068852_1003090422 132
263 3300005616 Ga0068852_100785771 Ga0068852_1007857711 132
264 3300005616 Ga0068852_101103630 Ga0068852_1011036302 132
265 3300005617 Ga0068859_100051551 Ga0068859_1000515513 132
266 3300005617 Ga0068859_100118968 Ga0068859_1001189682 132
267 3300005618 Ga0068864_100024428 Ga0068864_1000244286 132
268 3300005618 Ga0068864_100055519 Ga0068864_1000555192 132
269 3300005618 Ga0068864_100201737 Ga0068864_1002017372 132
270 3300005718 Ga0068866_10015851 Ga0068866_100158513 132
271 3300005718 Ga0068866_10333167 Ga0068866_103331671 132
272 3300005719 Ga0068861_100001754 Ga0068861_10000175414 132
273 3300005719 Ga0068861_100003902 Ga0068861_1000039024 132
274 3300005719 Ga0068861_100039958 Ga0068861_1000399582 132
275 3300005834 Ga0068851_10351520 Ga0068851_103515202 132
276 3300005841 Ga0068863_100129436 Ga0068863_1001294363 132
277 3300005841 Ga0068863_100318849 Ga0068863_1003188492 132
278 3300005841 Ga0068863_101088131 Ga0068863_1010881312 132
279 3300005842 Ga0068858_100155351 Ga0068858_1001553512 132
280 3300005843 Ga0068860_100021348 Ga0068860_1000213484 132
281 3300005843 Ga0068860_100030852 Ga0068860_1000308525 132
282 3300005843 Ga0068860_102625336 Ga0068860_1026253361 132
283 3300005844 Ga0068862_100018761 Ga0068862_1000187614 132
284 3300005844 Ga0068862_100273897 Ga0068862_1002738972 132
285 3300006237 Ga0097621_100173814 Ga0097621_1001738142 132
286 3300006237 Ga0097621_100192556 Ga0097621_1001925563 132
287 3300006237 Ga0097621_100860512 Ga0097621_1008605122 132
288 3300006358 Ga0068871_100342416 Ga0068871_1003424162 132
289 3300006358 Ga0068871_100527906 Ga0068871_1005279062 132
290 3300006358 Ga0068871_101074969 Ga0068871_1010749692 132
291 3300006881 Ga0068865_100612024 Ga0068865_1006120242 132
292 3300006931 Ga0097620_100051554 Ga0097620_1000515543 132
293 3300006931 Ga0097620_100118966 Ga0097620_1001189662 132
294 3300009098 Ga0105245_10334264 Ga0105245_103342642 132
295 3300009098 Ga0105245_10588124 Ga0105245_105881242 132
296 3300009148 Ga0105243_10022500 Ga0105243_100225003 132
297 3300009148 Ga0105243_10762819 Ga0105243_107628191 132
298 3300009148 Ga0105243_10811107 Ga0105243_108111072 132
299 3300009174 Ga0105241_10307230 Ga0105241_103072302 132
300 3300009176 Ga0105242_10036764 Ga0105242_100367643 132
301 3300009177 Ga0105248_10061862 Ga0105248_100618622 132
302 3300009177 Ga0105248_10112888 Ga0105248_101128883 132
303 3300009177 Ga0105248_10230062 Ga0105248_102300622 132
304 3300009177 Ga0105248_10262338 Ga0105248_102623383 132
305 3300009177 Ga0105248_10545004 Ga0105248_105450042 132
306 3300009551 Ga0105238_10068984 Ga0105238_100689843 132
307 3300009551 Ga0105238_10523269 Ga0105238_105232692 132
308 3300009551 Ga0105238_10880377 Ga0105238_108803772 132
309 3300009553 Ga0105249_10103684 Ga0105249_101036842 132
310 3300010375 Ga0105239_10350672 Ga0105239_103506722 132
311 3300012508 Ga0157315_1035471 Ga0157315_10354712 132
312 3300013100 Ga0157373_10016057 Ga0157373_100160575 132
313 3300013102 Ga0157371_10083250 Ga0157371_100832504 132
314 3300013104 Ga0157370_11615178 Ga0157370_116151782 132
315 3300013105 Ga0157369_10034527 Ga0157369_100345273 132
316 3300013296 Ga0157374_10028577 Ga0157374_100285775 132
317 3300013296 Ga0157374_10078403 Ga0157374_100784032 132
318 3300013296 Ga0157374_10182368 Ga0157374_101823683 132
319 3300013296 Ga0157374_10956398 Ga0157374_109563982 132
320 3300013296 Ga0157374_12564838 Ga0157374_125648381 132
321 3300013297 Ga0157378_11208962 Ga0157378_112089622 132
322 3300013306 Ga0163162_10026890 Ga0163162_100268902 132
323 3300013306 Ga0163162_10135885 Ga0163162_101358852 132
324 3300013306 Ga0163162_10253188 Ga0163162_102531882 132
325 3300013306 Ga0163162_11589422 Ga0163162_115894221 132
326 3300013307 Ga0157372_10007404 Ga0157372_100074044 132
327 3300013307 Ga0157372_10127441 Ga0157372_101274412 132
328 3300013307 Ga0157372_10812655 Ga0157372_108126551 132
329 3300013308 Ga0157375_10025412 Ga0157375_100254124 132
330 3300013308 Ga0157375_10030347 Ga0157375_100303472 132
331 3300013308 Ga0157375_10545251 Ga0157375_105452512 132
332 3300013308 Ga0157375_10688908 Ga0157375_106889082 132
333 3300014325 Ga0163163_10321469 Ga0163163_103214692 132
334 3300014325 Ga0163163_10913146 Ga0163163_109131462 132
335 3300014326 Ga0157380_10012299 Ga0157380_100122996 132
336 3300014326 Ga0157380_10124631 Ga0157380_101246314 132
337 3300014326 Ga0157380_10386750 Ga0157380_103867502 132
338 3300014497 Ga0182008_10353665 Ga0182008_103536652 132
339 3300014745 Ga0157377_10013110 Ga0157377_100131105 132
340 3300014968 Ga0157379_10010986 Ga0157379_100109864 132
341 3300014968 Ga0157379_10040167 Ga0157379_100401675 132
342 3300014968 Ga0157379_10254321 Ga0157379_102543212 132
343 3300014968 Ga0157379_11266461 Ga0157379_112664612 132
344 3300014969 Ga0157376_10219775 Ga0157376_102197752 132
345 3300014969 Ga0157376_10506212 Ga0157376_105062122 132
346 3300014969 Ga0157376_11071034 Ga0157376_110710342 132
347 3300017792 Ga0163161_10016186 Ga0163161_100161863 132
348 3300017792 Ga0163161_10217261 Ga0163161_102172612 132
349 3300017792 Ga0163161_10269217 Ga0163161_102692172 132
350 3300021384 Ga0213876_10009528 Ga0213876_100095282 132
351 3300025245 Ga0207425_1000619 Ga0207425_10006194 132
352 3300025258 Ga0209129_1000062 Ga0209129_100006287 132
353 3300025273 Ga0209673_1021175 Ga0209673_10211753 132
354 3300025295 Ga0209564_1000176 Ga0209564_10001767 132
355 3300025297 Ga0209758_1000129 Ga0209758_100012982 132
356 3300025299 Ga0209256_1026172 Ga0209256_10261723 132
357 3300025315 Ga0207697_10033816 Ga0207697_100338162 132
358 3300025321 Ga0207656_10033342 Ga0207656_100333422 132
359 3300025321 Ga0207656_10054993 Ga0207656_100549932 132
360 3300025893 Ga0207682_10004786 Ga0207682_100047866 132
361 3300025893 Ga0207682_10006106 Ga0207682_100061063 132
362 3300025893 Ga0207682_10056855 Ga0207682_100568552 132
363 3300025899 Ga0207642_10027250 Ga0207642_100272504 132
364 3300025899 Ga0207642_10821108 Ga0207642_108211082 132
365 3300025901 Ga0207688_10052552 Ga0207688_100525523 132
366 3300025901 Ga0207688_10310506 Ga0207688_103105062 132
367 3300025903 Ga0207680_10148338 Ga0207680_101483382 132
368 3300025907 Ga0207645_10010005 Ga0207645_100100057 132
369 3300025907 Ga0207645_10085787 Ga0207645_100857873 132
370 3300025909 Ga0207705_10027820 Ga0207705_100278205 132
371 3300025909 Ga0207705_10467647 Ga0207705_104676472 132
372 3300025918 Ga0207662_10046762 Ga0207662_100467623 132
373 3300025918 Ga0207662_10704386 Ga0207662_107043861 132
374 3300025919 Ga0207657_10083566 Ga0207657_100835662 132
375 3300025919 Ga0207657_10365358 Ga0207657_103653582 132
376 3300025920 Ga0207649_10016004 Ga0207649_100160044 132
377 3300025920 Ga0207649_10178352 Ga0207649_101783521 132
378 3300025920 Ga0207649_11003120 Ga0207649_110031201 132
379 3300025923 Ga0207681_10007361 Ga0207681_100073615 132
380 3300025923 Ga0207681_10631388 Ga0207681_106313882 132
381 3300025923 Ga0207681_10908535 Ga0207681_109085352 132
382 3300025925 Ga0207650_10175936 Ga0207650_101759363 132
383 3300025925 Ga0207650_10447590 Ga0207650_104475902 132
384 3300025925 Ga0207650_10506619 Ga0207650_105066191 132
385 3300025926 Ga0207659_10017664 Ga0207659_100176645 132
386 3300025926 Ga0207659_10451218 Ga0207659_104512182 132
387 3300025927 Ga0207687_10384784 Ga0207687_103847842 132
388 3300025931 Ga0207644_10014818 Ga0207644_100148182 132
389 3300025931 Ga0207644_10637303 Ga0207644_106373032 132
390 3300025931 Ga0207644_10773989 Ga0207644_107739891 132
391 3300025932 Ga0207690_10010745 Ga0207690_100107456 132
392 3300025932 Ga0207690_11271290 Ga0207690_112712902 132
393 3300025933 Ga0207706_10004316 Ga0207706_1000431614 132
394 3300025933 Ga0207706_10134501 Ga0207706_101345013 132
395 3300025933 Ga0207706_10586205 Ga0207706_105862052 132
396 3300025934 Ga0207686_10024275 Ga0207686_100242753 132
397 3300025936 Ga0207670_10282082 Ga0207670_102820822 132
398 3300025937 Ga0207669_10010461 Ga0207669_100104616 132
399 3300025937 Ga0207669_10208823 Ga0207669_102088232 132
400 3300025937 Ga0207669_10227951 Ga0207669_102279511 132
401 3300025937 Ga0207669_10578067 Ga0207669_105780672 132
402 3300025938 Ga0207704_10004534 Ga0207704_100045342 132
403 3300025938 Ga0207704_10260189 Ga0207704_102601892 132
404 3300025940 Ga0207691_10041873 Ga0207691_100418733 132
405 3300025940 Ga0207691_10089565 Ga0207691_100895654 132
406 3300025940 Ga0207691_10168050 Ga0207691_101680502 132
407 3300025940 Ga0207691_10172930 Ga0207691_101729302 132
408 3300025940 Ga0207691_10182868 Ga0207691_101828683 132
409 3300025941 Ga0207711_10023435 Ga0207711_100234352 132
410 3300025941 Ga0207711_10028987 Ga0207711_100289873 132
411 3300025941 Ga0207711_10082885 Ga0207711_100828852 132
412 3300025941 Ga0207711_10256622 Ga0207711_102566221 132
413 3300025941 Ga0207711_10534600 Ga0207711_105346002 132
414 3300025941 Ga0207711_10654217 Ga0207711_106542172 132
415 3300025942 Ga0207689_10029321 Ga0207689_100293215 132
416 3300025942 Ga0207689_10029707 Ga0207689_100297073 132
417 3300025945 Ga0207679_10011347 Ga0207679_100113474 132
418 3300025945 Ga0207679_10285796 Ga0207679_102857962 132
419 3300025945 Ga0207679_10613843 Ga0207679_106138432 132
420 3300025945 Ga0207679_11867448 Ga0207679_118674481 132
421 3300025949 Ga0207667_10038311 Ga0207667_100383112 132
422 3300025949 Ga0207667_11276437 Ga0207667_112764372 132
423 3300025960 Ga0207651_10066938 Ga0207651_100669381 132
424 3300025960 Ga0207651_10898977 Ga0207651_108989771 132
425 3300025961 Ga0207712_10035127 Ga0207712_100351272 132
426 3300025972 Ga0207668_10155183 Ga0207668_101551832 132
427 3300025972 Ga0207668_10282383 Ga0207668_102823831 132
428 3300025972 Ga0207668_10716960 Ga0207668_107169601 132
429 3300025981 Ga0207640_10006478 Ga0207640_100064787 132
430 3300025986 Ga0207658_10003655 Ga0207658_100036558 132
431 3300025986 Ga0207658_10023479 Ga0207658_100234792 132
432 3300026023 Ga0207677_10114297 Ga0207677_101142972 132
433 3300026023 Ga0207677_10173637 Ga0207677_101736372 132
434 3300026035 Ga0207703_10003934 Ga0207703_1000393411 132
435 3300026035 Ga0207703_10004035 Ga0207703_100040359 132
436 3300026041 Ga0207639_10076089 Ga0207639_100760894 132
437 3300026041 Ga0207639_10122155 Ga0207639_101221552 132
438 3300026041 Ga0207639_10297980 Ga0207639_102979802 132
439 3300026067 Ga0207678_10026960 Ga0207678_100269603 132
440 3300026067 Ga0207678_10539800 Ga0207678_105398002 132
441 3300026067 Ga0207678_11781460 Ga0207678_117814602 132
442 3300026075 Ga0207708_10030068 Ga0207708_100300683 132
443 3300026078 Ga0207702_10036629 Ga0207702_100366293 132
444 3300026088 Ga0207641_10111324 Ga0207641_101113243 132
445 3300026088 Ga0207641_10145388 Ga0207641_101453883 132
446 3300026088 Ga0207641_10172837 Ga0207641_101728373 132
447 3300026089 Ga0207648_10024843 Ga0207648_100248435 132
448 3300026089 Ga0207648_10030038 Ga0207648_100300385 132
449 3300026095 Ga0207676_10027724 Ga0207676_100277242 132
450 3300026095 Ga0207676_10029078 Ga0207676_100290782 132
451 3300026095 Ga0207676_10029474 Ga0207676_100294742 132
452 3300026116 Ga0207674_10211929 Ga0207674_102119293 132
453 3300026116 Ga0207674_10451525 Ga0207674_104515251 132
454 3300026116 Ga0207674_11535989 Ga0207674_115359891 132
455 3300026118 Ga0207675_100003935 Ga0207675_1000039357 132
456 3300026118 Ga0207675_100004056 Ga0207675_10000405614 132
457 3300026121 Ga0207683_10032105 Ga0207683_100321052 132
458 3300026121 Ga0207683_10187078 Ga0207683_101870782 132
459 3300026121 Ga0207683_10271798 Ga0207683_102717982 132
460 3300026121 Ga0207683_10290091 Ga0207683_102900912 132
461 3300026121 Ga0207683_10861201 Ga0207683_108612012 132
462 3300026142 Ga0207698_10017120 Ga0207698_100171205 132
463 3300026142 Ga0207698_10064789 Ga0207698_100647892 132
464 3300026142 Ga0207698_10530800 Ga0207698_105308002 132
465 3300026142 Ga0207698_11132905 Ga0207698_111329051 132
466 3300026142 Ga0207698_11271409 Ga0207698_112714092 132
467 3300028379 Ga0268266_11040874 Ga0268266_110408742 132
468 3300028380 Ga0268265_10016243 Ga0268265_100162433 132
469 3300028380 Ga0268265_10184241 Ga0268265_101842412 132
470 3300028381 Ga0268264_10010699 Ga0268264_100106992 132
471 3300028381 Ga0268264_10013122 Ga0268264_100131223 132
472 3300031456 Ga0307513_10044700 Ga0307513_100447004 132
473 3300031548 Ga0307408_100091977 Ga0307408_1000919774 132
474 3300031731 Ga0307405_10015992 Ga0307405_100159925 132
475 3300031852 Ga0307410_10580254 Ga0307410_105802542 132
476 3300031901 Ga0307406_10052176 Ga0307406_100521764 132
477 3300031911 Ga0307412_10264077 Ga0307412_102640772 132
478 3300031995 Ga0307409_100011848 Ga0307409_1000118485 132
479 3300032002 Ga0307416_100072217 Ga0307416_1000722172 132
480 3300032004 Ga0307414_11291135 Ga0307414_112911351 132
481 3300032126 Ga0307415_100029538 Ga0307415_1000295382 132
482 3300035171 Ga0373946_0149689 Ga0373946_0149689_447_866 132
483 3300035695 Ga0373927_0350577 Ga0373927_0350577_119_538 132
484 3300037068 Ga0373925_0549227 Ga0373925_0549227_519_938 132
485 3300039437 Ga0436365_0518101 Ga0436365_0518101_3152_3568 132
486 3300039438 Ga0436360_0074551 Ga0436360_0074551_38_454 132
487 3300041443 Ga0451789_0791032 Ga0451789_0791032_69_488 132
488 3300045051 Ga0451576_0541456 Ga0451576_0541456_53_475 132
489 3300046472 Ga0495580_0089481 Ga0495580_0089481_574_984 132
490 3300046683 Ga0495658_0129362 Ga0495658_0129362_368_787 132
491 3300046691 Ga0495670_0296599 Ga0495670_0296599_146_565 132
492 3300047470 Ga0495681_0135035 Ga0495681_0135035_543_965 132
493 3300048903 Ga0496100_0479088 Ga0496100_0479088_71_487 132
494 3300048908 Ga0496105_0364256 Ga0496105_0364256_675_1091 132
495 3300048909 Ga0496106_0966220 Ga0496106_0966220_59_475 132
496 3300048910 Ga0496107_0575538 Ga0496107_0575538_318_734 132
497 3300048911 Ga0496108_0533507 Ga0496108_0533507_469_891 132
498 3300048912 Ga0496109_0415238 Ga0496109_0415238_376_792 132
499 3300048912 Ga0496109_0618475 Ga0496109_0618475_352_771 132
500 3300048914 Ga0496111_0233843 Ga0496111_0233843_767_1183 132
501 3300048915 Ga0496112_0246800 Ga0496112_0246800_679_1095 132
502 3300048915 Ga0496112_1282999 Ga0496112_1282999_138_554 132
503 3300048917 Ga0496114_0218998 Ga0496114_0218998_663_1079 132
504 3300048917 Ga0496114_1071296 Ga0496114_1071296_196_615 132
505 3300048918 Ga0496115_0145115 Ga0496115_0145115_393_809 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

9

119

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.7581 13 123
2ptx-assembly1.cif.gz_A crystal structure of the t. brucei enolase complexed with sulphate in closed conformation 0.7515 26 58
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.7389 13 123
7bui-assembly1.cif.gz_E complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.7364 13 121
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.7315 12 129
ID Description Score Start End Superfamily
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7586 13 123 2.20.25.680
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7581 13 123 2.102.10.10
1z01A02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7521 13 125 2.20.25.680
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7496 12 120 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7389 13 123 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A6L6PMR7-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9139 12 129 GO:0046872
GO:0051537
AF-A0A1M5JSY9-F1-model_v4 Ferredoxin subunit of nitrite reductase or a ring-hydroxylating dioxygenase 0.9139 12 131 GO:0046872
GO:0051213
GO:0051537
AF-A0A7S7P8J7-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9123 15 132 GO:0046872
GO:0051537
AF-A0A1H7SRP1-F1-model_v4 Ferredoxin subunit of nitrite reductase or a ring-hydroxylating dioxygenase 0.9113 11 129 GO:0046872
GO:0051213
GO:0051537
AF-A0A850QMX4-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9099 15 128 GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
88.37 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map