F456381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 505 | 269 | 504 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_101923630|Ga0307416_1019236301 |
| Length | 108 |
| Sequence | MRAGLGAARRSARTPLMRYVSLALIVLLGLVHAELWFGKGGVPRMLELRGKLGEQQVANQADRARNAQLVAEVSDLKEGLEMVEEKARYELGMVKPDEILVQISTPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 80 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 175 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 176 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 179 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 180 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 181 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 182 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 183 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 184 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 185 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 234 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 255 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 262 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 263 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 264 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 265 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 266 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 268 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 269 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.89 |
| Nodule | 0 |
| Rhizoplane | 2.77 |
| Rhizosphere | 80.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10118798 | 3300002067 | Bacteria | 761 |
| 2 | JGI24744J21845_10016073 | 3300002077 | Bacteria | 1491 |
| 3 | rootH1_10054985 | 3300003316 | Bacteria | 5321 |
| 4 | rootL2_10072117 | 3300003322 | Bacteria | 1328 |
| 5 | Ga0065712_10331152 | 3300005290 | Bacteria | 814 |
| 6 | Ga0070658_10994249 | 3300005327 | Bacteria | 730 |
| 7 | Ga0070676_10013248 | 3300005328 | Bacteria | 4517 |
| 8 | Ga0070676_10108703 | 3300005328 | Bacteria | 1724 |
| 9 | Ga0070676_10109878 | 3300005328 | Bacteria | 1715 |
| 10 | Ga0070670_100016116 | 3300005331 | Bacteria | 6414 |
| 11 | Ga0070670_100097990 | 3300005331 | Bacteria | 2522 |
| 12 | Ga0070670_100407023 | 3300005331 | Bacteria | 1202 |
| 13 | Ga0070670_100615502 | 3300005331 | Bacteria | 972 |
| 14 | Ga0070670_101911403 | 3300005331 | Bacteria | 547 |
| 15 | Ga0070677_10001548 | 3300005333 | Bacteria | 7279 |
| 16 | Ga0070677_10034968 | 3300005333 | Bacteria | 1944 |
| 17 | Ga0070677_10859805 | 3300005333 | Bacteria | 522 |
| 18 | Ga0068869_100013561 | 3300005334 | Bacteria | 5424 |
| 19 | Ga0068869_100027665 | 3300005334 | Bacteria | 3956 |
| 20 | Ga0068869_100227886 | 3300005334 | Bacteria | 1480 |
| 21 | Ga0070666_10079225 | 3300005335 | Bacteria | 2244 |
| 22 | Ga0070666_10381535 | 3300005335 | Bacteria | 1012 |
| 23 | Ga0070666_11447756 | 3300005335 | Bacteria | 513 |
| 24 | Ga0068868_100081103 | 3300005338 | Bacteria | 2600 |
| 25 | Ga0068868_100097025 | 3300005338 | Bacteria | 2381 |
| 26 | Ga0068868_100308469 | 3300005338 | Bacteria | 1346 |
| 27 | Ga0068868_100553922 | 3300005338 | Bacteria | 1014 |
| 28 | Ga0070689_100034512 | 3300005340 | Bacteria | 3860 |
| 29 | Ga0070687_100848806 | 3300005343 | Bacteria | 651 |
| 30 | Ga0070661_100778719 | 3300005344 | Bacteria | 784 |
| 31 | Ga0070668_101611612 | 3300005347 | Bacteria | 595 |
| 32 | Ga0070669_100006105 | 3300005353 | Bacteria | 8694 |
| 33 | Ga0070669_100518398 | 3300005353 | Bacteria | 991 |
| 34 | Ga0070675_100005184 | 3300005354 | Bacteria | 9937 |
| 35 | Ga0070675_100019867 | 3300005354 | Bacteria | 5359 |
| 36 | Ga0070675_100047712 | 3300005354 | Bacteria | 3510 |
| 37 | Ga0070671_100021133 | 3300005355 | Bacteria | 5314 |
| 38 | Ga0070671_100040868 | 3300005355 | Bacteria | 3853 |
| 39 | Ga0070671_100081753 | 3300005355 | Bacteria | 2701 |
| 40 | Ga0070671_100479630 | 3300005355 | Bacteria | 1068 |
| 41 | Ga0070674_100008300 | 3300005356 | Bacteria | 6178 |
| 42 | Ga0070674_100030634 | 3300005356 | Bacteria | 3558 |
| 43 | Ga0070674_100820464 | 3300005356 | Bacteria | 805 |
| 44 | Ga0070673_100005136 | 3300005364 | Bacteria | 8348 |
| 45 | Ga0070673_100072711 | 3300005364 | Bacteria | 2766 |
| 46 | Ga0070673_100261577 | 3300005364 | Bacteria | 1512 |
| 47 | Ga0070673_101164537 | 3300005364 | Bacteria | 722 |
| 48 | Ga0070673_101919759 | 3300005364 | Bacteria | 562 |
| 49 | Ga0070673_102138282 | 3300005364 | Bacteria | 532 |
| 50 | Ga0070673_102162897 | 3300005364 | Bacteria | 529 |
| 51 | Ga0070688_100068326 | 3300005365 | Bacteria | 2265 |
| 52 | Ga0070688_100771805 | 3300005365 | Bacteria | 750 |
| 53 | Ga0070659_101073669 | 3300005366 | Bacteria | 709 |
| 54 | Ga0070659_101784626 | 3300005366 | Bacteria | 551 |
| 55 | Ga0070667_100001171 | 3300005367 | Bacteria | 23847 |
| 56 | Ga0070667_100043049 | 3300005367 | Bacteria | 3789 |
| 57 | Ga0070667_100089205 | 3300005367 | Bacteria | 2648 |
| 58 | Ga0070667_100218662 | 3300005367 | Bacteria | 1695 |
| 59 | Ga0070667_100799424 | 3300005367 | Bacteria | 876 |
| 60 | Ga0070701_10978897 | 3300005438 | Bacteria | 589 |
| 61 | Ga0070700_101650069 | 3300005441 | Bacteria | 549 |
| 62 | Ga0070700_101941073 | 3300005441 | Bacteria | 510 |
| 63 | Ga0070708_100148628 | 3300005445 | Bacteria | 2178 |
| 64 | Ga0070663_100562612 | 3300005455 | Bacteria | 954 |
| 65 | Ga0070663_101018736 | 3300005455 | Bacteria | 721 |
| 66 | Ga0070678_100001334 | 3300005456 | Bacteria | 13117 |
| 67 | Ga0070678_100009607 | 3300005456 | Bacteria | 5871 |
| 68 | Ga0070678_102108049 | 3300005456 | Bacteria | 534 |
| 69 | Ga0070662_100082775 | 3300005457 | Bacteria | 2393 |
| 70 | Ga0070662_100612187 | 3300005457 | Bacteria | 917 |
| 71 | Ga0068867_100000815 | 3300005459 | Bacteria | 21046 |
| 72 | Ga0068867_100002841 | 3300005459 | Bacteria | 12176 |
| 73 | Ga0068867_100002971 | 3300005459 | Bacteria | 11946 |
| 74 | Ga0068867_100032757 | 3300005459 | Bacteria | 3760 |
| 75 | Ga0068867_100139769 | 3300005459 | Bacteria | 1892 |
| 76 | Ga0068867_100814912 | 3300005459 | Bacteria | 833 |
| 77 | Ga0070698_101658556 | 3300005471 | Bacteria | 592 |
| 78 | Ga0068853_102166775 | 3300005539 | Bacteria | 539 |
| 79 | Ga0070672_100002062 | 3300005543 | Bacteria | 12665 |
| 80 | Ga0070672_100010713 | 3300005543 | Bacteria | 6369 |
| 81 | Ga0070672_100062465 | 3300005543 | Bacteria | 2939 |
| 82 | Ga0070672_100205866 | 3300005543 | Bacteria | 1647 |
| 83 | Ga0070693_100527632 | 3300005547 | Bacteria | 842 |
| 84 | Ga0070665_100129996 | 3300005548 | Bacteria | 2520 |
| 85 | Ga0070665_100471710 | 3300005548 | Bacteria | 1266 |
| 86 | Ga0070664_100502390 | 3300005564 | Bacteria | 1118 |
| 87 | Ga0070664_100817428 | 3300005564 | Bacteria | 872 |
| 88 | Ga0068857_100025437 | 3300005577 | Bacteria | 5212 |
| 89 | Ga0068854_100143833 | 3300005578 | Bacteria | 1833 |
| 90 | Ga0068854_100192091 | 3300005578 | Bacteria | 1600 |
| 91 | Ga0068856_100059001 | 3300005614 | Bacteria | 3790 |
| 92 | Ga0070702_101028629 | 3300005615 | Bacteria | 654 |
| 93 | Ga0070702_101164237 | 3300005615 | Bacteria | 619 |
| 94 | Ga0068852_100138634 | 3300005616 | Bacteria | 2249 |
| 95 | Ga0068852_100601482 | 3300005616 | Bacteria | 1104 |
| 96 | Ga0068852_101263879 | 3300005616 | Bacteria | 760 |
| 97 | Ga0068852_101659834 | 3300005616 | Bacteria | 661 |
| 98 | Ga0068859_100002636 | 3300005617 | Bacteria | 18245 |
| 99 | Ga0068864_100020879 | 3300005618 | Bacteria | 5482 |
| 100 | Ga0068864_100987047 | 3300005618 | Bacteria | 835 |
| 101 | Ga0068864_101195822 | 3300005618 | Bacteria | 759 |
| 102 | Ga0068866_10119073 | 3300005718 | Bacteria | 1485 |
| 103 | Ga0068866_10695891 | 3300005718 | Bacteria | 697 |
| 104 | Ga0068866_11402184 | 3300005718 | Bacteria | 511 |
| 105 | Ga0068861_100467466 | 3300005719 | Bacteria | 1133 |
| 106 | Ga0068851_10104658 | 3300005834 | Bacteria | 1505 |
| 107 | Ga0068870_10042666 | 3300005840 | Bacteria | 2362 |
| 108 | Ga0068870_10261700 | 3300005840 | Bacteria | 1077 |
| 109 | Ga0068863_100147201 | 3300005841 | Bacteria | 2253 |
| 110 | Ga0068863_100326675 | 3300005841 | Bacteria | 1491 |
| 111 | Ga0068858_100054908 | 3300005842 | Bacteria | 3683 |
| 112 | Ga0068860_100478813 | 3300005843 | Bacteria | 1241 |
| 113 | Ga0068860_100536719 | 3300005843 | Bacteria | 1171 |
| 114 | Ga0075365_10253693 | 3300006038 | Bacteria | 1236 |
| 115 | Ga0075368_10024067 | 3300006042 | Bacteria | 2330 |
| 116 | Ga0075368_10223723 | 3300006042 | Bacteria | 800 |
| 117 | Ga0075363_100187176 | 3300006048 | Bacteria | 1180 |
| 118 | Ga0075364_10322521 | 3300006051 | Bacteria | 1052 |
| 119 | Ga0070715_10062786 | 3300006163 | Bacteria | 1636 |
| 120 | Ga0075362_10037524 | 3300006177 | Bacteria | 2125 |
| 121 | Ga0075362_10088534 | 3300006177 | Bacteria | 1434 |
| 122 | Ga0075362_10359198 | 3300006177 | Bacteria | 730 |
| 123 | Ga0075367_10224977 | 3300006178 | Bacteria | 1174 |
| 124 | Ga0075369_10010341 | 3300006186 | Bacteria | 3647 |
| 125 | Ga0075366_10010236 | 3300006195 | Bacteria | 5261 |
| 126 | Ga0075366_10015142 | 3300006195 | Bacteria | 4414 |
| 127 | Ga0075366_10020898 | 3300006195 | Bacteria | 3802 |
| 128 | Ga0075366_10028358 | 3300006195 | Bacteria | 3286 |
| 129 | Ga0075366_10059108 | 3300006195 | Bacteria | 2277 |
| 130 | Ga0075366_10120695 | 3300006195 | Bacteria | 1579 |
| 131 | Ga0075366_10299438 | 3300006195 | Bacteria | 984 |
| 132 | Ga0075366_10425129 | 3300006195 | Bacteria | 818 |
| 133 | Ga0097621_100083076 | 3300006237 | Bacteria | 2668 |
| 134 | Ga0097621_101813521 | 3300006237 | Bacteria | 582 |
| 135 | Ga0075370_10006318 | 3300006353 | Bacteria | 5951 |
| 136 | Ga0075370_10037650 | 3300006353 | Bacteria | 2720 |
| 137 | Ga0075370_10152705 | 3300006353 | Bacteria | 1353 |
| 138 | Ga0075370_10578672 | 3300006353 | Bacteria | 680 |
| 139 | Ga0068871_100040812 | 3300006358 | Bacteria | 3718 |
| 140 | Ga0068871_100141677 | 3300006358 | Bacteria | 2045 |
| 141 | Ga0068871_100769809 | 3300006358 | Bacteria | 886 |
| 142 | Ga0075433_11596371 | 3300006852 | Bacteria | 563 |
| 143 | Ga0068865_100335970 | 3300006881 | Bacteria | 1220 |
| 144 | Ga0068865_100493325 | 3300006881 | Bacteria | 1020 |
| 145 | Ga0068865_100644583 | 3300006881 | Bacteria | 900 |
| 146 | Ga0097620_100002636 | 3300006931 | Bacteria | 18245 |
| 147 | Ga0105240_10038063 | 3300009093 | Bacteria | 6174 |
| 148 | Ga0111539_10282788 | 3300009094 | Bacteria | 1930 |
| 149 | Ga0105245_10122662 | 3300009098 | Bacteria | 2429 |
| 150 | Ga0105245_10256066 | 3300009098 | Bacteria | 1702 |
| 151 | Ga0105245_11718666 | 3300009098 | Bacteria | 680 |
| 152 | Ga0105243_10039925 | 3300009148 | Bacteria | 3662 |
| 153 | Ga0105243_10187471 | 3300009148 | Bacteria | 1804 |
| 154 | Ga0105243_12768758 | 3300009148 | Bacteria | 531 |
| 155 | Ga0105242_10513252 | 3300009176 | Bacteria | 1142 |
| 156 | Ga0105242_11260373 | 3300009176 | Bacteria | 761 |
| 157 | Ga0105248_10138031 | 3300009177 | Bacteria | 2751 |
| 158 | Ga0105248_11033921 | 3300009177 | Bacteria | 928 |
| 159 | Ga0105248_11782569 | 3300009177 | Bacteria | 698 |
| 160 | Ga0105237_10003466 | 3300009545 | Bacteria | 18708 |
| 161 | Ga0105238_10007665 | 3300009551 | Bacteria | 10803 |
| 162 | Ga0105249_13423643 | 3300009553 | Bacteria | 511 |
| 163 | Ga0105239_10003789 | 3300010375 | Bacteria | 18406 |
| 164 | Ga0105246_11142978 | 3300011119 | Bacteria | 713 |
| 165 | Ga0157328_1020915 | 3300012478 | Bacteria | 552 |
| 166 | Ga0157326_1044290 | 3300012513 | Bacteria | 634 |
| 167 | Ga0157374_10121407 | 3300013296 | Bacteria | 2522 |
| 168 | Ga0157374_10538658 | 3300013296 | Bacteria | 1174 |
| 169 | Ga0157378_10078498 | 3300013297 | Bacteria | 2978 |
| 170 | Ga0157378_10574474 | 3300013297 | Bacteria | 1136 |
| 171 | Ga0157378_10625617 | 3300013297 | Bacteria | 1090 |
| 172 | Ga0163162_10028472 | 3300013306 | Bacteria | 5529 |
| 173 | Ga0163162_10052435 | 3300013306 | Bacteria | 4097 |
| 174 | Ga0163162_12172092 | 3300013306 | Bacteria | 637 |
| 175 | Ga0157372_10114235 | 3300013307 | Bacteria | 3095 |
| 176 | Ga0157375_10039345 | 3300013308 | Bacteria | 4551 |
| 177 | Ga0157375_10056327 | 3300013308 | Bacteria | 3881 |
| 178 | Ga0157375_10237311 | 3300013308 | Bacteria | 1983 |
| 179 | Ga0157375_11101949 | 3300013308 | Bacteria | 929 |
| 180 | Ga0163163_10083873 | 3300014325 | Bacteria | 3192 |
| 181 | Ga0163163_11303849 | 3300014325 | Bacteria | 788 |
| 182 | Ga0157380_12317556 | 3300014326 | Bacteria | 601 |
| 183 | Ga0157377_10000382 | 3300014745 | Bacteria | 19272 |
| 184 | Ga0157377_10260105 | 3300014745 | Bacteria | 1129 |
| 185 | Ga0157379_10013894 | 3300014968 | Bacteria | 7057 |
| 186 | Ga0157379_10016805 | 3300014968 | Bacteria | 6440 |
| 187 | Ga0157376_10051337 | 3300014969 | Bacteria | 3425 |
| 188 | Ga0157376_10327596 | 3300014969 | Bacteria | 1458 |
| 189 | Ga0157376_10361085 | 3300014969 | Bacteria | 1393 |
| 190 | Ga0157376_10745023 | 3300014969 | Bacteria | 988 |
| 191 | Ga0157376_12148946 | 3300014969 | Bacteria | 597 |
| 192 | Ga0163161_10051865 | 3300017792 | Bacteria | 2973 |
| 193 | Ga0163161_10589238 | 3300017792 | Bacteria | 915 |
| 194 | Ga0213876_10361896 | 3300021384 | Bacteria | 772 |
| 195 | Ga0207673_1018564 | 3300025290 | Bacteria | 931 |
| 196 | Ga0207697_10019486 | 3300025315 | Bacteria | 2779 |
| 197 | Ga0207656_10111072 | 3300025321 | Bacteria | 1267 |
| 198 | Ga0207682_10001523 | 3300025893 | Bacteria | 10677 |
| 199 | Ga0207682_10060765 | 3300025893 | Bacteria | 1581 |
| 200 | Ga0207682_10152401 | 3300025893 | Bacteria | 1043 |
| 201 | Ga0207642_10051757 | 3300025899 | Bacteria | 1860 |
| 202 | Ga0207680_10325724 | 3300025903 | Bacteria | 1075 |
| 203 | Ga0207680_10809214 | 3300025903 | Bacteria | 672 |
| 204 | Ga0207680_10936756 | 3300025903 | Bacteria | 621 |
| 205 | Ga0207685_10243966 | 3300025905 | Bacteria | 866 |
| 206 | Ga0207645_10012119 | 3300025907 | Bacteria | 5857 |
| 207 | Ga0207645_10388407 | 3300025907 | Bacteria | 938 |
| 208 | Ga0207643_10049838 | 3300025908 | Bacteria | 2374 |
| 209 | Ga0207643_10057915 | 3300025908 | Bacteria | 2207 |
| 210 | Ga0207705_11075391 | 3300025909 | Bacteria | 620 |
| 211 | Ga0207695_10031173 | 3300025913 | Bacteria | 5854 |
| 212 | Ga0207671_10005697 | 3300025914 | Bacteria | 11382 |
| 213 | Ga0207662_10460817 | 3300025918 | Bacteria | 870 |
| 214 | Ga0207649_10192674 | 3300025920 | Bacteria | 1435 |
| 215 | Ga0207652_10994093 | 3300025921 | Bacteria | 738 |
| 216 | Ga0207681_10049977 | 3300025923 | Bacteria | 2828 |
| 217 | Ga0207681_10409725 | 3300025923 | Bacteria | 1096 |
| 218 | Ga0207694_10024013 | 3300025924 | Bacteria | 4630 |
| 219 | Ga0207650_10002460 | 3300025925 | Bacteria | 12887 |
| 220 | Ga0207650_10290755 | 3300025925 | Bacteria | 1332 |
| 221 | Ga0207650_11402653 | 3300025925 | Bacteria | 594 |
| 222 | Ga0207650_11911347 | 3300025925 | Bacteria | 501 |
| 223 | Ga0207659_10006295 | 3300025926 | Bacteria | 7260 |
| 224 | Ga0207659_10009925 | 3300025926 | Bacteria | 5958 |
| 225 | Ga0207659_10049091 | 3300025926 | Bacteria | 2992 |
| 226 | Ga0207687_10053973 | 3300025927 | Bacteria | 2810 |
| 227 | Ga0207687_10075296 | 3300025927 | Bacteria | 2422 |
| 228 | Ga0207644_10020354 | 3300025931 | Bacteria | 4511 |
| 229 | Ga0207644_10042428 | 3300025931 | Bacteria | 3224 |
| 230 | Ga0207644_10049561 | 3300025931 | Bacteria | 3007 |
| 231 | Ga0207644_10219693 | 3300025931 | Bacteria | 1506 |
| 232 | Ga0207690_10915932 | 3300025932 | Bacteria | 727 |
| 233 | Ga0207690_11051311 | 3300025932 | Bacteria | 678 |
| 234 | Ga0207706_10069481 | 3300025933 | Bacteria | 3098 |
| 235 | Ga0207706_10495191 | 3300025933 | Bacteria | 1055 |
| 236 | Ga0207706_11312454 | 3300025933 | Bacteria | 597 |
| 237 | Ga0207686_10530889 | 3300025934 | Bacteria | 917 |
| 238 | Ga0207709_10011879 | 3300025935 | Bacteria | 4804 |
| 239 | Ga0207709_10831846 | 3300025935 | Bacteria | 747 |
| 240 | Ga0207670_10035459 | 3300025936 | Bacteria | 3234 |
| 241 | Ga0207669_10014898 | 3300025937 | Bacteria | 3909 |
| 242 | Ga0207669_10115308 | 3300025937 | Bacteria | 1810 |
| 243 | Ga0207669_11367081 | 3300025937 | Bacteria | 602 |
| 244 | Ga0207704_10153063 | 3300025938 | Bacteria | 1630 |
| 245 | Ga0207704_10279301 | 3300025938 | Bacteria | 1269 |
| 246 | Ga0207691_10006082 | 3300025940 | Bacteria | 11664 |
| 247 | Ga0207691_10007915 | 3300025940 | Bacteria | 10231 |
| 248 | Ga0207691_10106713 | 3300025940 | Bacteria | 2494 |
| 249 | Ga0207691_10157816 | 3300025940 | Bacteria | 1991 |
| 250 | Ga0207711_10304445 | 3300025941 | Bacteria | 1470 |
| 251 | Ga0207711_10349411 | 3300025941 | Bacteria | 1369 |
| 252 | Ga0207689_10014824 | 3300025942 | Bacteria | 6617 |
| 253 | Ga0207689_10315909 | 3300025942 | Bacteria | 1296 |
| 254 | Ga0207689_10830249 | 3300025942 | Bacteria | 780 |
| 255 | Ga0207689_11328193 | 3300025942 | Bacteria | 604 |
| 256 | Ga0207679_10274408 | 3300025945 | Bacteria | 1443 |
| 257 | Ga0207679_10816817 | 3300025945 | Bacteria | 850 |
| 258 | Ga0207651_10006687 | 3300025960 | Bacteria | 6069 |
| 259 | Ga0207651_10022563 | 3300025960 | Bacteria | 3851 |
| 260 | Ga0207651_10037495 | 3300025960 | Bacteria | 3176 |
| 261 | Ga0207668_11106709 | 3300025972 | Bacteria | 710 |
| 262 | Ga0207668_11329276 | 3300025972 | Bacteria | 647 |
| 263 | Ga0207640_10082009 | 3300025981 | Bacteria | 2207 |
| 264 | Ga0207640_11658197 | 3300025981 | Bacteria | 577 |
| 265 | Ga0207658_10000959 | 3300025986 | Bacteria | 23778 |
| 266 | Ga0207658_10034313 | 3300025986 | Bacteria | 3626 |
| 267 | Ga0207658_10087064 | 3300025986 | Bacteria | 2411 |
| 268 | Ga0207658_10403408 | 3300025986 | Bacteria | 1202 |
| 269 | Ga0207677_10072104 | 3300026023 | Bacteria | 2440 |
| 270 | Ga0207677_10092228 | 3300026023 | Bacteria | 2205 |
| 271 | Ga0207677_10219121 | 3300026023 | Bacteria | 1525 |
| 272 | Ga0207677_10823507 | 3300026023 | Bacteria | 832 |
| 273 | Ga0207703_10206014 | 3300026035 | Bacteria | 1750 |
| 274 | Ga0207678_10014055 | 3300026067 | Bacteria | 7040 |
| 275 | Ga0207678_10133793 | 3300026067 | Bacteria | 2115 |
| 276 | Ga0207678_10670291 | 3300026067 | Bacteria | 912 |
| 277 | Ga0207678_11489161 | 3300026067 | Bacteria | 597 |
| 278 | Ga0207708_10496898 | 3300026075 | Bacteria | 1022 |
| 279 | Ga0207708_10870744 | 3300026075 | Bacteria | 778 |
| 280 | Ga0207702_10241988 | 3300026078 | Bacteria | 1691 |
| 281 | Ga0207641_10049902 | 3300026088 | Bacteria | 3538 |
| 282 | Ga0207641_10112479 | 3300026088 | Bacteria | 2416 |
| 283 | Ga0207641_10377263 | 3300026088 | Bacteria | 1357 |
| 284 | Ga0207648_10002629 | 3300026089 | Bacteria | 19224 |
| 285 | Ga0207648_10002848 | 3300026089 | Bacteria | 18311 |
| 286 | Ga0207648_10010781 | 3300026089 | Bacteria | 8636 |
| 287 | Ga0207648_10097960 | 3300026089 | Bacteria | 2567 |
| 288 | Ga0207648_10105316 | 3300026089 | Bacteria | 2474 |
| 289 | Ga0207648_10823793 | 3300026089 | Bacteria | 865 |
| 290 | Ga0207676_10015099 | 3300026095 | Bacteria | 5569 |
| 291 | Ga0207676_10026609 | 3300026095 | Bacteria | 4302 |
| 292 | Ga0207674_10008218 | 3300026116 | Bacteria | 12093 |
| 293 | Ga0207674_10372743 | 3300026116 | Bacteria | 1380 |
| 294 | Ga0207674_11187737 | 3300026116 | Bacteria | 732 |
| 295 | Ga0207674_12264397 | 3300026116 | Bacteria | 506 |
| 296 | Ga0207675_101100613 | 3300026118 | Bacteria | 814 |
| 297 | Ga0207675_101882346 | 3300026118 | Bacteria | 617 |
| 298 | Ga0207683_10006663 | 3300026121 | Bacteria | 9879 |
| 299 | Ga0207683_10013159 | 3300026121 | Bacteria | 7059 |
| 300 | Ga0207683_10052477 | 3300026121 | Bacteria | 3573 |
| 301 | Ga0207698_10461291 | 3300026142 | Bacteria | 1229 |
| 302 | Ga0207698_10540123 | 3300026142 | Bacteria | 1141 |
| 303 | Ga0207698_11415505 | 3300026142 | Bacteria | 710 |
| 304 | Ga0207698_12081265 | 3300026142 | Bacteria | 581 |
| 305 | Ga0209983_1007828 | 3300027665 | Bacteria | 2186 |
| 306 | Ga0209813_10024011 | 3300027866 | Bacteria | 1739 |
| 307 | Ga0209813_10153977 | 3300027866 | Bacteria | 825 |
| 308 | Ga0268266_10338942 | 3300028379 | Bacteria | 1411 |
| 309 | Ga0268266_10848140 | 3300028379 | Bacteria | 883 |
| 310 | Ga0268266_11109401 | 3300028379 | Bacteria | 765 |
| 311 | Ga0268264_10092858 | 3300028381 | Bacteria | 2606 |
| 312 | Ga0268264_10238395 | 3300028381 | Bacteria | 1684 |
| 313 | Ga0307517_10001871 | 3300028786 | Bacteria | 34464 |
| 314 | Ga0307517_10083410 | 3300028786 | Bacteria | 2702 |
| 315 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 316 | Ga0307515_10036978 | 3300028794 | Bacteria | 7871 |
| 317 | Ga0307515_10038740 | 3300028794 | Bacteria | 7610 |
| 318 | Ga0307512_10276590 | 3300030522 | Bacteria | 807 |
| 319 | Ga0307513_10116867 | 3300031456 | Bacteria | 2645 |
| 320 | Ga0307513_10119691 | 3300031456 | Bacteria | 2604 |
| 321 | Ga0307513_10197218 | 3300031456 | Bacteria | 1858 |
| 322 | Ga0307509_10453799 | 3300031507 | Bacteria | 975 |
| 323 | Ga0307408_100000030 | 3300031548 | Bacteria | 223389 |
| 324 | Ga0307408_100529608 | 3300031548 | Bacteria | 1036 |
| 325 | Ga0307408_102289692 | 3300031548 | Bacteria | 523 |
| 326 | Ga0307508_10038562 | 3300031616 | Bacteria | 4293 |
| 327 | Ga0307516_10000312 | 3300031730 | Bacteria | 62905 |
| 328 | Ga0307516_10014242 | 3300031730 | Bacteria | 8424 |
| 329 | Ga0307516_10299808 | 3300031730 | Bacteria | 1283 |
| 330 | Ga0307516_10350336 | 3300031730 | Bacteria | 1142 |
| 331 | Ga0307516_10992027 | 3300031730 | Bacteria | 512 |
| 332 | Ga0307405_10006547 | 3300031731 | Bacteria | 5739 |
| 333 | Ga0307405_11045951 | 3300031731 | Bacteria | 699 |
| 334 | Ga0307405_11719481 | 3300031731 | Bacteria | 556 |
| 335 | Ga0307405_11790130 | 3300031731 | Bacteria | 546 |
| 336 | Ga0307413_10094755 | 3300031824 | Bacteria | 1955 |
| 337 | Ga0307413_10893459 | 3300031824 | Bacteria | 754 |
| 338 | Ga0307410_10009817 | 3300031852 | Bacteria | 5391 |
| 339 | Ga0307406_10034996 | 3300031901 | Bacteria | 3085 |
| 340 | Ga0307406_10130243 | 3300031901 | Bacteria | 1765 |
| 341 | Ga0307407_11442634 | 3300031903 | Bacteria | 543 |
| 342 | Ga0307407_11519413 | 3300031903 | Bacteria | 530 |
| 343 | Ga0307412_10018914 | 3300031911 | Bacteria | 4158 |
| 344 | Ga0307412_11811467 | 3300031911 | Bacteria | 562 |
| 345 | Ga0307409_100094217 | 3300031995 | Bacteria | 2463 |
| 346 | Ga0307409_100255757 | 3300031995 | Bacteria | 1604 |
| 347 | Ga0307409_100974702 | 3300031995 | Unclassified | 865 |
| 348 | Ga0307409_102068661 | 3300031995 | Bacteria | 599 |
| 349 | Ga0307416_100088088 | 3300032002 | Bacteria | 2653 |
| 350 | Ga0307416_100289497 | 3300032002 | Bacteria | 1621 |
| 351 | Ga0307416_100596078 | 3300032002 | Bacteria | 1184 |
| 352 | Ga0307416_101923630 | 3300032002 | Bacteria | 695 |
| 353 | Ga0307414_10332404 | 3300032004 | Bacteria | 1298 |
| 354 | Ga0307414_10772426 | 3300032004 | Bacteria | 875 |
| 355 | Ga0307411_10048663 | 3300032005 | Bacteria | 2749 |
| 356 | Ga0307510_10026627 | 3300033180 | Bacteria | 6642 |
| 357 | Ga0373949_0045977 | 3300035090 | Bacteria | 1087 |
| 358 | Ga0373943_0031464 | 3300035170 | Bacteria | 2518 |
| 359 | Ga0373937_0956821 | 3300036401 | Bacteria | 805 |
| 360 | Ga0373925_0533137 | 3300037068 | Bacteria | 965 |
| 361 | Ga0395900_0854249 | 3300037418 | Bacteria | 835 |
| 362 | Ga0395898_0060715 | 3300037466 | Bacteria | 3673 |
| 363 | Ga0395898_1309763 | 3300037466 | Bacteria | 654 |
| 364 | Ga0395905_0005832 | 3300037471 | Bacteria | 12515 |
| 365 | Ga0395905_0013446 | 3300037471 | Bacteria | 7843 |
| 366 | Ga0395905_0016819 | 3300037471 | Bacteria | 6948 |
| 367 | Ga0395905_0022443 | 3300037471 | Bacteria | 5968 |
| 368 | Ga0395905_0059190 | 3300037471 | Bacteria | 3581 |
| 369 | Ga0395905_0153068 | 3300037471 | Bacteria | 2169 |
| 370 | Ga0395905_0738319 | 3300037471 | Bacteria | 887 |
| 371 | Ga0395901_0182741 | 3300038443 | Bacteria | 2199 |
| 372 | Ga0395901_0321737 | 3300038443 | Bacteria | 1600 |
| 373 | Ga0395901_0601977 | 3300038443 | Bacteria | 1108 |
| 374 | Ga0436365_0896739 | 3300039437 | Bacteria | 681 |
| 375 | Ga0436361_0433203 | 3300039447 | Bacteria | 1008 |
| 376 | Ga0439436_0257052 | 3300041404 | Bacteria | 508 |
| 377 | Ga0439447_053273 | 3300041407 | Bacteria | 962 |
| 378 | Ga0439453_0062415 | 3300041408 | Bacteria | 774 |
| 379 | Ga0451807_0498778 | 3300041486 | Bacteria | 741 |
| 380 | Ga0439433_0036043 | 3300041999 | Bacteria | 1142 |
| 381 | Ga0439450_201726 | 3300042008 | Bacteria | 532 |
| 382 | Ga0439462_0176408 | 3300042015 | Bacteria | 605 |
| 383 | Ga0450896_040334 | 3300042133 | Bacteria | 726 |
| 384 | Ga0450896_056146 | 3300042133 | Bacteria | 635 |
| 385 | Ga0450898_010021 | 3300042134 | Bacteria | 1528 |
| 386 | Ga0450899_035447 | 3300042135 | Bacteria | 615 |
| 387 | Ga0439464_0173908 | 3300042439 | Bacteria | 680 |
| 388 | Ga0439460_0298363 | 3300042461 | Bacteria | 563 |
| 389 | Ga0451577_0002119 | 3300042876 | Bacteria | 24405 |
| 390 | Ga0451577_0010535 | 3300042876 | Bacteria | 8822 |
| 391 | Ga0451577_0403684 | 3300042876 | Bacteria | 1240 |
| 392 | Ga0451577_0673217 | 3300042876 | Bacteria | 938 |
| 393 | Ga0466972_0183983 | 3300044658 | Bacteria | 979 |
| 394 | Ga0453683_0089346 | 3300044673 | Bacteria | 1931 |
| 395 | Ga0453683_0283795 | 3300044673 | Bacteria | 1058 |
| 396 | Ga0466965_0090831 | 3300044683 | Bacteria | 1553 |
| 397 | Ga0466961_0319434 | 3300044693 | Bacteria | 947 |
| 398 | Ga0453684_0005559 | 3300044712 | Bacteria | 24865 |
| 399 | Ga0453684_0157014 | 3300044712 | Bacteria | 2695 |
| 400 | Ga0466968_0014664 | 3300044735 | Bacteria | 3099 |
| 401 | Ga0466968_0578974 | 3300044735 | Bacteria | 565 |
| 402 | Ga0466957_0497146 | 3300044842 | Bacteria | 845 |
| 403 | Ga0466957_0532457 | 3300044842 | Unclassified | 817 |
| 404 | Ga0466960_0936628 | 3300044901 | Bacteria | 530 |
| 405 | Ga0451576_0003324 | 3300045051 | Bacteria | 22289 |
| 406 | Ga0451576_0114403 | 3300045051 | Bacteria | 2808 |
| 407 | Ga0451576_0234298 | 3300045051 | Bacteria | 1917 |
| 408 | Ga0451576_0543133 | 3300045051 | Bacteria | 1221 |
| 409 | Ga0466958_0439793 | 3300045836 | Bacteria | 844 |
| 410 | Ga0495592_0651314 | 3300046454 | Bacteria | 638 |
| 411 | Ga0495629_0821257 | 3300046459 | Bacteria | 612 |
| 412 | Ga0495638_0530940 | 3300046460 | Bacteria | 588 |
| 413 | Ga0495641_0246597 | 3300046461 | Bacteria | 803 |
| 414 | Ga0495650_0060529 | 3300046471 | Bacteria | 1520 |
| 415 | Ga0495580_0807912 | 3300046472 | Bacteria | 608 |
| 416 | Ga0495583_0184829 | 3300046506 | Bacteria | 852 |
| 417 | Ga0495606_0243764 | 3300046507 | Bacteria | 1001 |
| 418 | Ga0495610_0200309 | 3300046512 | Bacteria | 818 |
| 419 | Ga0495616_0090863 | 3300046513 | Bacteria | 1446 |
| 420 | Ga0495620_0095232 | 3300046515 | Bacteria | 1191 |
| 421 | Ga0495632_0007745 | 3300046519 | Bacteria | 6701 |
| 422 | Ga0495632_0333567 | 3300046519 | Bacteria | 668 |
| 423 | Ga0495642_0228548 | 3300046528 | Bacteria | 813 |
| 424 | Ga0495654_0393360 | 3300046530 | Bacteria | 551 |
| 425 | Ga0495621_0066745 | 3300046539 | Bacteria | 1317 |
| 426 | Ga0495621_0303791 | 3300046539 | Bacteria | 662 |
| 427 | Ga0495597_0062371 | 3300046542 | Bacteria | 1622 |
| 428 | Ga0495645_0859374 | 3300046543 | Bacteria | 541 |
| 429 | Ga0495625_0156033 | 3300046660 | Bacteria | 1532 |
| 430 | Ga0495646_0620580 | 3300046680 | Bacteria | 548 |
| 431 | Ga0495658_0145588 | 3300046683 | Bacteria | 1452 |
| 432 | Ga0495671_0207850 | 3300046692 | Bacteria | 949 |
| 433 | Ga0495671_0439485 | 3300046692 | Bacteria | 624 |
| 434 | Ga0495649_0004724 | 3300046694 | Bacteria | 8839 |
| 435 | Ga0495649_0163446 | 3300046694 | Bacteria | 1167 |
| 436 | Ga0495687_000594 | 3300047443 | Bacteria | 42250 |
| 437 | Ga0495687_005079 | 3300047443 | Bacteria | 8539 |
| 438 | Ga0495687_006945 | 3300047443 | Bacteria | 6806 |
| 439 | Ga0495675_0632002 | 3300047444 | Bacteria | 605 |
| 440 | Ga0495626_0026314 | 3300048091 | Bacteria | 2837 |
| 441 | Ga0496100_0340530 | 3300048903 | Bacteria | 1131 |
| 442 | Ga0496102_0989300 | 3300048905 | Bacteria | 762 |
| 443 | Ga0496104_0272846 | 3300048907 | Bacteria | 1604 |
| 444 | Ga0496104_0284257 | 3300048907 | Bacteria | 1567 |
| 445 | Ga0496105_0272040 | 3300048908 | Bacteria | 1368 |
| 446 | Ga0496106_0650073 | 3300048909 | Bacteria | 842 |
| 447 | Ga0496107_1278102 | 3300048910 | Bacteria | 525 |
| 448 | Ga0496108_0322469 | 3300048911 | Bacteria | 1347 |
| 449 | Ga0496108_0402422 | 3300048911 | Bacteria | 1196 |
| 450 | Ga0496109_0128519 | 3300048912 | Bacteria | 2364 |
| 451 | Ga0496109_1796616 | 3300048912 | Bacteria | 546 |
| 452 | Ga0496112_1044640 | 3300048915 | Bacteria | 736 |
| 453 | Ga0496113_0674018 | 3300048916 | Bacteria | 826 |
| 454 | Ga0496121_0026536 | 3300048924 | Bacteria | 5454 |
| 455 | Ga0496123_0466147 | 3300048926 | Bacteria | 559 |
| 456 | Ga0496124_0466928 | 3300048927 | Bacteria | 856 |
| 457 | Ga0496125_0564286 | 3300048928 | Bacteria | 628 |
| 458 | Ga0496126_0242250 | 3300048929 | Bacteria | 1506 |
| 459 | Ga0501031_1021239 | 3300049568 | Bacteria | 528 |
| 460 | Ga0501034_0580013 | 3300049571 | Bacteria | 1028 |
| 461 | Ga0501038_1202377 | 3300049574 | Bacteria | 550 |
| 462 | Ga0501039_0845381 | 3300049575 | Bacteria | 713 |
| 463 | Ga0501041_0861602 | 3300049577 | Bacteria | 582 |
| 464 | Ga0501043_0022740 | 3300049579 | Bacteria | 4917 |
| 465 | Ga0501046_0275162 | 3300049580 | Bacteria | 1234 |
| 466 | Ga0501073_0540358 | 3300049589 | Bacteria | 805 |
| 467 | Ga0501225_0065496 | 3300049705 | Bacteria | 1027 |
| 468 | Ga0501080_0093134 | 3300049742 | Bacteria | 2798 |
| 469 | Ga0501281_04327 | 3300049777 | Bacteria | 999 |
| 470 | Ga0501035_0207821 | 3300049822 | Bacteria | 1676 |
| 471 | Ga0501044_0074406 | 3300049823 | Bacteria | 3451 |
| 472 | nmdc:mga03683_488978_c1 | 3300050489 | Bacteria | 595 |
| 473 | nmdc:mga03683_9019_c1 | 3300050489 | Bacteria | 3529 |
| 474 | nmdc:mga03n38_208033_c1 | 3300050490 | Bacteria | 1016 |
| 475 | nmdc:mga00v17_319009_c1 | 3300050491 | Bacteria | 1010 |
| 476 | nmdc:mga0yw44_47259_c1 | 3300050492 | Bacteria | 2589 |
| 477 | nmdc:mga0k408_103026_c1 | 3300050493 | Bacteria | 1684 |
| 478 | nmdc:mga0k408_120188_c1 | 3300050493 | Bacteria | 1556 |
| 479 | nmdc:mga0k408_236051_c1 | 3300050493 | Bacteria | 1092 |
| 480 | nmdc:mga0k408_24186_c1 | 3300050493 | Bacteria | 2706 |
| 481 | nmdc:mga0k408_302552_c1 | 3300050493 | Bacteria | 954 |
| 482 | nmdc:mga0k408_362386_c1 | 3300050493 | Bacteria | 864 |
| 483 | nmdc:mga0k408_39853_c1 | 3300050493 | Bacteria | 2701 |
| 484 | nmdc:mga0k408_9344_c1 | 3300050493 | Bacteria | 5283 |
| 485 | nmdc:mga06z11_248091_c1 | 3300050494 | Bacteria | 1048 |
| 486 | nmdc:mga04h51_328945_c1 | 3300050495 | Bacteria | 628 |
| 487 | nmdc:mga04h51_70965_c1 | 3300050495 | Bacteria | 1216 |
| 488 | nmdc:mga07m45_14664_c2 | 3300050496 | Bacteria | 1700 |
| 489 | nmdc:mga07m45_172542_c1 | 3300050496 | Bacteria | 1257 |
| 490 | nmdc:mga07m45_2545_c1 | 3300050496 | Bacteria | 8561 |
| 491 | nmdc:mga07m45_544471_c1 | 3300050496 | Bacteria | 671 |
| 492 | nmdc:mga07m45_9585_c1 | 3300050496 | Bacteria | 5031 |
| 493 | nmdc:mga0sz30_3098_c1 | 3300050516 | Bacteria | 5961 |
| 494 | Ga0495601_0475858 | 3300053077 | Bacteria | 807 |
| 495 | Ga0495595_0260151 | 3300053084 | Bacteria | 870 |
| 496 | Ga0500578_0035984 | 3300053086 | Bacteria | 3181 |
| 497 | Ga0500647_0056143 | 3300053091 | Bacteria | 1894 |
| 498 | Ga0500583_0275119 | 3300053092 | Bacteria | 828 |
| 499 | Ga0500651_0701111 | 3300053093 | Bacteria | 541 |
| 500 | Ga0500652_179682 | 3300053131 | Bacteria | 867 |
| 501 | Ga0500658_0008541 | 3300053134 | Bacteria | 3783 |
| 502 | Ga0500568_0028846 | 3300053139 | Bacteria | 2310 |
| 503 | Ga0500590_020753 | 3300053148 | Bacteria | 3410 |
| 504 | Ga0500645_002406 | 3300053730 | Bacteria | 8396 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031730 | Ga0307516_10992027 | Ga0307516_109920271 | 79 |
| 2 | 3300006195 | Ga0075366_10120695 | Ga0075366_101206952 | 86 |
| 3 | 3300050489 | nmdc:mga03683_488978_c1 | nmdc:mga03683_488978_c1_39_317 | 86 |
| 4 | 3300050493 | nmdc:mga0k408_236051_c1 | nmdc:mga0k408_236051_c1_188_466 | 86 |
| 5 | 3300046507 | Ga0495606_0243764 | Ga0495606_0243764_21_353 | 87 |
| 6 | 3300053091 | Ga0500647_0056143 | Ga0500647_0056143_124_456 | 87 |
| 7 | 3300053131 | Ga0500652_179682 | Ga0500652_179682_65_397 | 87 |
| 8 | iso_pu_bacteria | 2643221654 | 2644304274 | 87 |
| 9 | 3300012478 | Ga0157328_1020915 | Ga0157328_10209151 | 88 |
| 10 | 3300048911 | Ga0496108_0322469 | Ga0496108_0322469_393_659 | 88 |
| 11 | 3300048912 | Ga0496109_1796616 | Ga0496109_1796616_192_458 | 88 |
| 12 | 3300049777 | Ga0501281_04327 | Ga0501281_04327_267_536 | 88 |
| 13 | 3300009148 | Ga0105243_12768758 | Ga0105243_127687582 | 89 |
| 14 | 3300014326 | Ga0157380_12317556 | Ga0157380_123175562 | 89 |
| 15 | 3300025935 | Ga0207709_10831846 | Ga0207709_108318462 | 89 |
| 16 | 3300031730 | Ga0307516_10014242 | Ga0307516_100142426 | 89 |
| 17 | 3300031730 | Ga0307516_10299808 | Ga0307516_102998082 | 89 |
| 18 | 3300031911 | Ga0307412_11811467 | Ga0307412_118114672 | 89 |
| 19 | 3300037418 | Ga0395900_0854249 | Ga0395900_0854249_167_442 | 89 |
| 20 | 3300037466 | Ga0395898_0060715 | Ga0395898_0060715_1891_2166 | 89 |
| 21 | 3300037466 | Ga0395898_1309763 | Ga0395898_1309763_238_513 | 89 |
| 22 | 3300037471 | Ga0395905_0022443 | Ga0395905_0022443_2003_2278 | 89 |
| 23 | 3300037471 | Ga0395905_0059190 | Ga0395905_0059190_1666_1941 | 89 |
| 24 | 3300038443 | Ga0395901_0182741 | Ga0395901_0182741_1651_1926 | 89 |
| 25 | 3300038443 | Ga0395901_0321737 | Ga0395901_0321737_92_367 | 89 |
| 26 | 3300038443 | Ga0395901_0601977 | Ga0395901_0601977_359_634 | 89 |
| 27 | 3300042876 | Ga0451577_0002119 | Ga0451577_0002119_21592_21867 | 89 |
| 28 | 3300042876 | Ga0451577_0010535 | Ga0451577_0010535_208_483 | 89 |
| 29 | 3300042876 | Ga0451577_0673217 | Ga0451577_0673217_491_766 | 89 |
| 30 | 3300044673 | Ga0453683_0089346 | Ga0453683_0089346_1422_1697 | 89 |
| 31 | 3300044693 | Ga0466961_0319434 | Ga0466961_0319434_299_574 | 89 |
| 32 | 3300044712 | Ga0453684_0157014 | Ga0453684_0157014_174_449 | 89 |
| 33 | 3300044735 | Ga0466968_0578974 | Ga0466968_0578974_53_328 | 89 |
| 34 | 3300044842 | Ga0466957_0497146 | Ga0466957_0497146_374_649 | 89 |
| 35 | 3300045051 | Ga0451576_0003324 | Ga0451576_0003324_3017_3292 | 89 |
| 36 | 3300045051 | Ga0451576_0543133 | Ga0451576_0543133_871_1146 | 89 |
| 37 | 3300045836 | Ga0466958_0439793 | Ga0466958_0439793_123_398 | 89 |
| 38 | 3300046515 | Ga0495620_0095232 | Ga0495620_0095232_345_638 | 89 |
| 39 | 3300048929 | Ga0496126_0242250 | Ga0496126_0242250_440_709 | 89 |
| 40 | 3300049568 | Ga0501031_1021239 | Ga0501031_1021239_177_452 | 89 |
| 41 | 3300049571 | Ga0501034_0580013 | Ga0501034_0580013_522_797 | 89 |
| 42 | 3300049574 | Ga0501038_1202377 | Ga0501038_1202377_182_457 | 89 |
| 43 | 3300049575 | Ga0501039_0845381 | Ga0501039_0845381_85_360 | 89 |
| 44 | 3300049579 | Ga0501043_0022740 | Ga0501043_0022740_144_419 | 89 |
| 45 | 3300049580 | Ga0501046_0275162 | Ga0501046_0275162_908_1183 | 89 |
| 46 | 3300049589 | Ga0501073_0540358 | Ga0501073_0540358_445_720 | 89 |
| 47 | 3300049742 | Ga0501080_0093134 | Ga0501080_0093134_2513_2788 | 89 |
| 48 | 3300049823 | Ga0501044_0074406 | Ga0501044_0074406_2960_3235 | 89 |
| 49 | 3300005328 | Ga0070676_10109878 | Ga0070676_101098781 | 90 |
| 50 | 3300005335 | Ga0070666_11447756 | Ga0070666_114477561 | 90 |
| 51 | 3300005364 | Ga0070673_101164537 | Ga0070673_1011645371 | 90 |
| 52 | 3300005367 | Ga0070667_100799424 | Ga0070667_1007994242 | 90 |
| 53 | 3300005438 | Ga0070701_10978897 | Ga0070701_109788971 | 90 |
| 54 | 3300005543 | Ga0070672_100205866 | Ga0070672_1002058662 | 90 |
| 55 | 3300005616 | Ga0068852_101263879 | Ga0068852_1012638792 | 90 |
| 56 | 3300005618 | Ga0068864_100987047 | Ga0068864_1009870472 | 90 |
| 57 | 3300005719 | Ga0068861_100467466 | Ga0068861_1004674662 | 90 |
| 58 | 3300009093 | Ga0105240_10038063 | Ga0105240_100380634 | 90 |
| 59 | 3300009545 | Ga0105237_10003466 | Ga0105237_1000346620 | 90 |
| 60 | 3300009551 | Ga0105238_10007665 | Ga0105238_100076654 | 90 |
| 61 | 3300010375 | Ga0105239_10003789 | Ga0105239_100037898 | 90 |
| 62 | 3300025893 | Ga0207682_10152401 | Ga0207682_101524012 | 90 |
| 63 | 3300025903 | Ga0207680_10809214 | Ga0207680_108092142 | 90 |
| 64 | 3300025913 | Ga0207695_10031173 | Ga0207695_100311736 | 90 |
| 65 | 3300025914 | Ga0207671_10005697 | Ga0207671_1000569713 | 90 |
| 66 | 3300025918 | Ga0207662_10460817 | Ga0207662_104608171 | 90 |
| 67 | 3300025924 | Ga0207694_10024013 | Ga0207694_100240135 | 90 |
| 68 | 3300025932 | Ga0207690_10915932 | Ga0207690_109159322 | 90 |
| 69 | 3300025933 | Ga0207706_11312454 | Ga0207706_113124542 | 90 |
| 70 | 3300025940 | Ga0207691_10157816 | Ga0207691_101578164 | 90 |
| 71 | 3300025942 | Ga0207689_11328193 | Ga0207689_113281932 | 90 |
| 72 | 3300026116 | Ga0207674_11187737 | Ga0207674_111877371 | 90 |
| 73 | 3300026118 | Ga0207675_101100613 | Ga0207675_1011006132 | 90 |
| 74 | 3300026121 | Ga0207683_10013159 | Ga0207683_100131599 | 90 |
| 75 | 3300026142 | Ga0207698_11415505 | Ga0207698_114155052 | 90 |
| 76 | 3300027665 | Ga0209983_1007828 | Ga0209983_10078283 | 90 |
| 77 | 3300028379 | Ga0268266_10338942 | Ga0268266_103389422 | 90 |
| 78 | 3300031548 | Ga0307408_102289692 | Ga0307408_1022896922 | 90 |
| 79 | 3300031903 | Ga0307407_11442634 | Ga0307407_114426342 | 90 |
| 80 | 3300037471 | Ga0395905_0013446 | Ga0395905_0013446_1989_2261 | 90 |
| 81 | 3300037471 | Ga0395905_0153068 | Ga0395905_0153068_361_633 | 90 |
| 82 | 3300039447 | Ga0436361_0433203 | Ga0436361_0433203_501_773 | 90 |
| 83 | 3300041404 | Ga0439436_0257052 | Ga0439436_0257052_37_309 | 90 |
| 84 | 3300041407 | Ga0439447_053273 | Ga0439447_053273_628_900 | 90 |
| 85 | 3300041408 | Ga0439453_0062415 | Ga0439453_0062415_460_732 | 90 |
| 86 | 3300041999 | Ga0439433_0036043 | Ga0439433_0036043_67_339 | 90 |
| 87 | 3300042008 | Ga0439450_201726 | Ga0439450_201726_221_493 | 90 |
| 88 | 3300042015 | Ga0439462_0176408 | Ga0439462_0176408_175_447 | 90 |
| 89 | 3300042133 | Ga0450896_040334 | Ga0450896_040334_64_336 | 90 |
| 90 | 3300042134 | Ga0450898_010021 | Ga0450898_010021_1146_1418 | 90 |
| 91 | 3300042135 | Ga0450899_035447 | Ga0450899_035447_184_456 | 90 |
| 92 | 3300042439 | Ga0439464_0173908 | Ga0439464_0173908_109_381 | 90 |
| 93 | 3300042461 | Ga0439460_0298363 | Ga0439460_0298363_255_527 | 90 |
| 94 | 3300002067 | JGI24735J21928_10118798 | JGI24735J21928_101187981 | 91 |
| 95 | 3300002077 | JGI24744J21845_10016073 | JGI24744J21845_100160732 | 91 |
| 96 | 3300003316 | rootH1_10054985 | rootH1_100549851 | 91 |
| 97 | 3300003322 | rootL2_10072117 | rootL2_100721173 | 91 |
| 98 | 3300005290 | Ga0065712_10331152 | Ga0065712_103311522 | 91 |
| 99 | 3300005327 | Ga0070658_10994249 | Ga0070658_109942492 | 91 |
| 100 | 3300005328 | Ga0070676_10013248 | Ga0070676_100132482 | 91 |
| 101 | 3300005328 | Ga0070676_10108703 | Ga0070676_101087032 | 91 |
| 102 | 3300005331 | Ga0070670_100016116 | Ga0070670_1000161164 | 91 |
| 103 | 3300005331 | Ga0070670_100097990 | Ga0070670_1000979902 | 91 |
| 104 | 3300005331 | Ga0070670_100407023 | Ga0070670_1004070232 | 91 |
| 105 | 3300005331 | Ga0070670_100615502 | Ga0070670_1006155022 | 91 |
| 106 | 3300005331 | Ga0070670_101911403 | Ga0070670_1019114032 | 91 |
| 107 | 3300005333 | Ga0070677_10001548 | Ga0070677_100015486 | 91 |
| 108 | 3300005333 | Ga0070677_10034968 | Ga0070677_100349682 | 91 |
| 109 | 3300005333 | Ga0070677_10859805 | Ga0070677_108598051 | 91 |
| 110 | 3300005334 | Ga0068869_100013561 | Ga0068869_1000135617 | 91 |
| 111 | 3300005334 | Ga0068869_100027665 | Ga0068869_1000276652 | 91 |
| 112 | 3300005334 | Ga0068869_100227886 | Ga0068869_1002278862 | 91 |
| 113 | 3300005335 | Ga0070666_10079225 | Ga0070666_100792252 | 91 |
| 114 | 3300005335 | Ga0070666_10381535 | Ga0070666_103815352 | 91 |
| 115 | 3300005338 | Ga0068868_100081103 | Ga0068868_1000811032 | 91 |
| 116 | 3300005338 | Ga0068868_100097025 | Ga0068868_1000970252 | 91 |
| 117 | 3300005338 | Ga0068868_100308469 | Ga0068868_1003084692 | 91 |
| 118 | 3300005338 | Ga0068868_100553922 | Ga0068868_1005539222 | 91 |
| 119 | 3300005340 | Ga0070689_100034512 | Ga0070689_1000345122 | 91 |
| 120 | 3300005343 | Ga0070687_100848806 | Ga0070687_1008488061 | 91 |
| 121 | 3300005344 | Ga0070661_100778719 | Ga0070661_1007787192 | 91 |
| 122 | 3300005347 | Ga0070668_101611612 | Ga0070668_1016116122 | 91 |
| 123 | 3300005353 | Ga0070669_100006105 | Ga0070669_1000061052 | 91 |
| 124 | 3300005353 | Ga0070669_100518398 | Ga0070669_1005183982 | 91 |
| 125 | 3300005354 | Ga0070675_100005184 | Ga0070675_1000051849 | 91 |
| 126 | 3300005354 | Ga0070675_100019867 | Ga0070675_1000198671 | 91 |
| 127 | 3300005354 | Ga0070675_100047712 | Ga0070675_1000477124 | 91 |
| 128 | 3300005355 | Ga0070671_100021133 | Ga0070671_1000211335 | 91 |
| 129 | 3300005355 | Ga0070671_100040868 | Ga0070671_1000408682 | 91 |
| 130 | 3300005355 | Ga0070671_100081753 | Ga0070671_1000817532 | 91 |
| 131 | 3300005355 | Ga0070671_100479630 | Ga0070671_1004796302 | 91 |
| 132 | 3300005356 | Ga0070674_100008300 | Ga0070674_1000083003 | 91 |
| 133 | 3300005356 | Ga0070674_100030634 | Ga0070674_1000306342 | 91 |
| 134 | 3300005356 | Ga0070674_100820464 | Ga0070674_1008204642 | 91 |
| 135 | 3300005364 | Ga0070673_100005136 | Ga0070673_1000051362 | 91 |
| 136 | 3300005364 | Ga0070673_100072711 | Ga0070673_1000727111 | 91 |
| 137 | 3300005364 | Ga0070673_100261577 | Ga0070673_1002615772 | 91 |
| 138 | 3300005364 | Ga0070673_101919759 | Ga0070673_1019197592 | 91 |
| 139 | 3300005364 | Ga0070673_102138282 | Ga0070673_1021382821 | 91 |
| 140 | 3300005364 | Ga0070673_102162897 | Ga0070673_1021628971 | 91 |
| 141 | 3300005365 | Ga0070688_100068326 | Ga0070688_1000683262 | 91 |
| 142 | 3300005365 | Ga0070688_100771805 | Ga0070688_1007718051 | 91 |
| 143 | 3300005366 | Ga0070659_101073669 | Ga0070659_1010736692 | 91 |
| 144 | 3300005366 | Ga0070659_101784626 | Ga0070659_1017846262 | 91 |
| 145 | 3300005367 | Ga0070667_100001171 | Ga0070667_1000011717 | 91 |
| 146 | 3300005367 | Ga0070667_100043049 | Ga0070667_1000430495 | 91 |
| 147 | 3300005367 | Ga0070667_100089205 | Ga0070667_1000892052 | 91 |
| 148 | 3300005367 | Ga0070667_100218662 | Ga0070667_1002186622 | 91 |
| 149 | 3300005441 | Ga0070700_101650069 | Ga0070700_1016500692 | 91 |
| 150 | 3300005441 | Ga0070700_101941073 | Ga0070700_1019410732 | 91 |
| 151 | 3300005445 | Ga0070708_100148628 | Ga0070708_1001486284 | 91 |
| 152 | 3300005455 | Ga0070663_100562612 | Ga0070663_1005626121 | 91 |
| 153 | 3300005455 | Ga0070663_101018736 | Ga0070663_1010187361 | 91 |
| 154 | 3300005456 | Ga0070678_100001334 | Ga0070678_1000013348 | 91 |
| 155 | 3300005456 | Ga0070678_100009607 | Ga0070678_1000096074 | 91 |
| 156 | 3300005456 | Ga0070678_102108049 | Ga0070678_1021080491 | 91 |
| 157 | 3300005457 | Ga0070662_100082775 | Ga0070662_1000827752 | 91 |
| 158 | 3300005457 | Ga0070662_100612187 | Ga0070662_1006121871 | 91 |
| 159 | 3300005459 | Ga0068867_100000815 | Ga0068867_1000008159 | 91 |
| 160 | 3300005459 | Ga0068867_100002841 | Ga0068867_10000284116 | 91 |
| 161 | 3300005459 | Ga0068867_100002971 | Ga0068867_1000029715 | 91 |
| 162 | 3300005459 | Ga0068867_100032757 | Ga0068867_1000327572 | 91 |
| 163 | 3300005459 | Ga0068867_100139769 | Ga0068867_1001397691 | 91 |
| 164 | 3300005459 | Ga0068867_100814912 | Ga0068867_1008149122 | 91 |
| 165 | 3300005471 | Ga0070698_101658556 | Ga0070698_1016585562 | 91 |
| 166 | 3300005539 | Ga0068853_102166775 | Ga0068853_1021667751 | 91 |
| 167 | 3300005543 | Ga0070672_100002062 | Ga0070672_1000020629 | 91 |
| 168 | 3300005543 | Ga0070672_100010713 | Ga0070672_1000107135 | 91 |
| 169 | 3300005543 | Ga0070672_100062465 | Ga0070672_1000624654 | 91 |
| 170 | 3300005547 | Ga0070693_100527632 | Ga0070693_1005276322 | 91 |
| 171 | 3300005548 | Ga0070665_100129996 | Ga0070665_1001299962 | 91 |
| 172 | 3300005548 | Ga0070665_100471710 | Ga0070665_1004717102 | 91 |
| 173 | 3300005564 | Ga0070664_100502390 | Ga0070664_1005023902 | 91 |
| 174 | 3300005564 | Ga0070664_100817428 | Ga0070664_1008174282 | 91 |
| 175 | 3300005577 | Ga0068857_100025437 | Ga0068857_1000254372 | 91 |
| 176 | 3300005578 | Ga0068854_100143833 | Ga0068854_1001438332 | 91 |
| 177 | 3300005578 | Ga0068854_100192091 | Ga0068854_1001920912 | 91 |
| 178 | 3300005614 | Ga0068856_100059001 | Ga0068856_1000590016 | 91 |
| 179 | 3300005615 | Ga0070702_101028629 | Ga0070702_1010286292 | 91 |
| 180 | 3300005615 | Ga0070702_101164237 | Ga0070702_1011642372 | 91 |
| 181 | 3300005616 | Ga0068852_100138634 | Ga0068852_1001386345 | 91 |
| 182 | 3300005616 | Ga0068852_100601482 | Ga0068852_1006014822 | 91 |
| 183 | 3300005616 | Ga0068852_101659834 | Ga0068852_1016598341 | 91 |
| 184 | 3300005617 | Ga0068859_100002636 | Ga0068859_1000026364 | 91 |
| 185 | 3300005618 | Ga0068864_100020879 | Ga0068864_1000208795 | 91 |
| 186 | 3300005618 | Ga0068864_101195822 | Ga0068864_1011958222 | 91 |
| 187 | 3300005718 | Ga0068866_10119073 | Ga0068866_101190733 | 91 |
| 188 | 3300005718 | Ga0068866_10695891 | Ga0068866_106958911 | 91 |
| 189 | 3300005718 | Ga0068866_11402184 | Ga0068866_114021842 | 91 |
| 190 | 3300005834 | Ga0068851_10104658 | Ga0068851_101046581 | 91 |
| 191 | 3300005840 | Ga0068870_10042666 | Ga0068870_100426662 | 91 |
| 192 | 3300005840 | Ga0068870_10261700 | Ga0068870_102617002 | 91 |
| 193 | 3300005841 | Ga0068863_100147201 | Ga0068863_1001472014 | 91 |
| 194 | 3300005841 | Ga0068863_100326675 | Ga0068863_1003266752 | 91 |
| 195 | 3300005842 | Ga0068858_100054908 | Ga0068858_1000549083 | 91 |
| 196 | 3300005843 | Ga0068860_100478813 | Ga0068860_1004788132 | 91 |
| 197 | 3300005843 | Ga0068860_100536719 | Ga0068860_1005367193 | 91 |
| 198 | 3300006038 | Ga0075365_10253693 | Ga0075365_102536932 | 91 |
| 199 | 3300006042 | Ga0075368_10024067 | Ga0075368_100240674 | 91 |
| 200 | 3300006042 | Ga0075368_10223723 | Ga0075368_102237232 | 91 |
| 201 | 3300006048 | Ga0075363_100187176 | Ga0075363_1001871762 | 91 |
| 202 | 3300006051 | Ga0075364_10322521 | Ga0075364_103225212 | 91 |
| 203 | 3300006163 | Ga0070715_10062786 | Ga0070715_100627862 | 91 |
| 204 | 3300006177 | Ga0075362_10037524 | Ga0075362_100375243 | 91 |
| 205 | 3300006177 | Ga0075362_10088534 | Ga0075362_100885342 | 91 |
| 206 | 3300006177 | Ga0075362_10359198 | Ga0075362_103591982 | 91 |
| 207 | 3300006178 | Ga0075367_10224977 | Ga0075367_102249772 | 91 |
| 208 | 3300006186 | Ga0075369_10010341 | Ga0075369_100103414 | 91 |
| 209 | 3300006195 | Ga0075366_10010236 | Ga0075366_100102364 | 91 |
| 210 | 3300006195 | Ga0075366_10015142 | Ga0075366_100151424 | 91 |
| 211 | 3300006195 | Ga0075366_10020898 | Ga0075366_100208982 | 91 |
| 212 | 3300006195 | Ga0075366_10028358 | Ga0075366_100283584 | 91 |
| 213 | 3300006195 | Ga0075366_10059108 | Ga0075366_100591084 | 91 |
| 214 | 3300006195 | Ga0075366_10299438 | Ga0075366_102994382 | 91 |
| 215 | 3300006195 | Ga0075366_10425129 | Ga0075366_104251292 | 91 |
| 216 | 3300006237 | Ga0097621_100083076 | Ga0097621_1000830762 | 91 |
| 217 | 3300006237 | Ga0097621_101813521 | Ga0097621_1018135212 | 91 |
| 218 | 3300006353 | Ga0075370_10006318 | Ga0075370_100063184 | 91 |
| 219 | 3300006353 | Ga0075370_10037650 | Ga0075370_100376503 | 91 |
| 220 | 3300006353 | Ga0075370_10152705 | Ga0075370_101527052 | 91 |
| 221 | 3300006353 | Ga0075370_10578672 | Ga0075370_105786722 | 91 |
| 222 | 3300006358 | Ga0068871_100040812 | Ga0068871_1000408123 | 91 |
| 223 | 3300006358 | Ga0068871_100141677 | Ga0068871_1001416773 | 91 |
| 224 | 3300006358 | Ga0068871_100769809 | Ga0068871_1007698091 | 91 |
| 225 | 3300006852 | Ga0075433_11596371 | Ga0075433_115963711 | 91 |
| 226 | 3300006881 | Ga0068865_100335970 | Ga0068865_1003359702 | 91 |
| 227 | 3300006881 | Ga0068865_100493325 | Ga0068865_1004933252 | 91 |
| 228 | 3300006881 | Ga0068865_100644583 | Ga0068865_1006445832 | 91 |
| 229 | 3300006931 | Ga0097620_100002636 | Ga0097620_1000026364 | 91 |
| 230 | 3300009094 | Ga0111539_10282788 | Ga0111539_102827882 | 91 |
| 231 | 3300009098 | Ga0105245_10122662 | Ga0105245_101226622 | 91 |
| 232 | 3300009098 | Ga0105245_10256066 | Ga0105245_102560661 | 91 |
| 233 | 3300009098 | Ga0105245_11718666 | Ga0105245_117186662 | 91 |
| 234 | 3300009148 | Ga0105243_10039925 | Ga0105243_100399255 | 91 |
| 235 | 3300009148 | Ga0105243_10187471 | Ga0105243_101874712 | 91 |
| 236 | 3300009176 | Ga0105242_10513252 | Ga0105242_105132522 | 91 |
| 237 | 3300009176 | Ga0105242_11260373 | Ga0105242_112603731 | 91 |
| 238 | 3300009177 | Ga0105248_10138031 | Ga0105248_101380314 | 91 |
| 239 | 3300009177 | Ga0105248_11033921 | Ga0105248_110339212 | 91 |
| 240 | 3300009177 | Ga0105248_11782569 | Ga0105248_117825692 | 91 |
| 241 | 3300009553 | Ga0105249_13423643 | Ga0105249_134236432 | 91 |
| 242 | 3300011119 | Ga0105246_11142978 | Ga0105246_111429781 | 91 |
| 243 | 3300012513 | Ga0157326_1044290 | Ga0157326_10442902 | 91 |
| 244 | 3300013296 | Ga0157374_10121407 | Ga0157374_101214072 | 91 |
| 245 | 3300013296 | Ga0157374_10538658 | Ga0157374_105386581 | 91 |
| 246 | 3300013297 | Ga0157378_10078498 | Ga0157378_100784981 | 91 |
| 247 | 3300013297 | Ga0157378_10574474 | Ga0157378_105744742 | 91 |
| 248 | 3300013297 | Ga0157378_10625617 | Ga0157378_106256172 | 91 |
| 249 | 3300013306 | Ga0163162_10028472 | Ga0163162_100284726 | 91 |
| 250 | 3300013306 | Ga0163162_10052435 | Ga0163162_100524355 | 91 |
| 251 | 3300013306 | Ga0163162_12172092 | Ga0163162_121720921 | 91 |
| 252 | 3300013307 | Ga0157372_10114235 | Ga0157372_101142352 | 91 |
| 253 | 3300013308 | Ga0157375_10039345 | Ga0157375_100393456 | 91 |
| 254 | 3300013308 | Ga0157375_10056327 | Ga0157375_100563272 | 91 |
| 255 | 3300013308 | Ga0157375_10237311 | Ga0157375_102373112 | 91 |
| 256 | 3300013308 | Ga0157375_11101949 | Ga0157375_111019492 | 91 |
| 257 | 3300014325 | Ga0163163_10083873 | Ga0163163_100838735 | 91 |
| 258 | 3300014325 | Ga0163163_11303849 | Ga0163163_113038491 | 91 |
| 259 | 3300014745 | Ga0157377_10000382 | Ga0157377_1000038215 | 91 |
| 260 | 3300014745 | Ga0157377_10260105 | Ga0157377_102601052 | 91 |
| 261 | 3300014968 | Ga0157379_10013894 | Ga0157379_100138946 | 91 |
| 262 | 3300014968 | Ga0157379_10016805 | Ga0157379_100168058 | 91 |
| 263 | 3300014969 | Ga0157376_10051337 | Ga0157376_100513375 | 91 |
| 264 | 3300014969 | Ga0157376_10327596 | Ga0157376_103275962 | 91 |
| 265 | 3300014969 | Ga0157376_10361085 | Ga0157376_103610852 | 91 |
| 266 | 3300014969 | Ga0157376_10745023 | Ga0157376_107450232 | 91 |
| 267 | 3300014969 | Ga0157376_12148946 | Ga0157376_121489462 | 91 |
| 268 | 3300017792 | Ga0163161_10051865 | Ga0163161_100518655 | 91 |
| 269 | 3300017792 | Ga0163161_10589238 | Ga0163161_105892382 | 91 |
| 270 | 3300021384 | Ga0213876_10361896 | Ga0213876_103618962 | 91 |
| 271 | 3300025290 | Ga0207673_1018564 | Ga0207673_10185642 | 91 |
| 272 | 3300025315 | Ga0207697_10019486 | Ga0207697_100194862 | 91 |
| 273 | 3300025321 | Ga0207656_10111072 | Ga0207656_101110723 | 91 |
| 274 | 3300025893 | Ga0207682_10001523 | Ga0207682_100015239 | 91 |
| 275 | 3300025893 | Ga0207682_10060765 | Ga0207682_100607652 | 91 |
| 276 | 3300025899 | Ga0207642_10051757 | Ga0207642_100517573 | 91 |
| 277 | 3300025903 | Ga0207680_10325724 | Ga0207680_103257243 | 91 |
| 278 | 3300025903 | Ga0207680_10936756 | Ga0207680_109367562 | 91 |
| 279 | 3300025905 | Ga0207685_10243966 | Ga0207685_102439662 | 91 |
| 280 | 3300025907 | Ga0207645_10012119 | Ga0207645_100121194 | 91 |
| 281 | 3300025907 | Ga0207645_10388407 | Ga0207645_103884072 | 91 |
| 282 | 3300025908 | Ga0207643_10049838 | Ga0207643_100498384 | 91 |
| 283 | 3300025908 | Ga0207643_10057915 | Ga0207643_100579152 | 91 |
| 284 | 3300025909 | Ga0207705_11075391 | Ga0207705_110753911 | 91 |
| 285 | 3300025920 | Ga0207649_10192674 | Ga0207649_101926742 | 91 |
| 286 | 3300025921 | Ga0207652_10994093 | Ga0207652_109940932 | 91 |
| 287 | 3300025923 | Ga0207681_10049977 | Ga0207681_100499774 | 91 |
| 288 | 3300025923 | Ga0207681_10409725 | Ga0207681_104097251 | 91 |
| 289 | 3300025925 | Ga0207650_10002460 | Ga0207650_100024605 | 91 |
| 290 | 3300025925 | Ga0207650_10290755 | Ga0207650_102907552 | 91 |
| 291 | 3300025925 | Ga0207650_11402653 | Ga0207650_114026532 | 91 |
| 292 | 3300025925 | Ga0207650_11911347 | Ga0207650_119113472 | 91 |
| 293 | 3300025926 | Ga0207659_10006295 | Ga0207659_100062959 | 91 |
| 294 | 3300025926 | Ga0207659_10009925 | Ga0207659_100099256 | 91 |
| 295 | 3300025926 | Ga0207659_10049091 | Ga0207659_100490913 | 91 |
| 296 | 3300025927 | Ga0207687_10053973 | Ga0207687_100539734 | 91 |
| 297 | 3300025927 | Ga0207687_10075296 | Ga0207687_100752962 | 91 |
| 298 | 3300025931 | Ga0207644_10020354 | Ga0207644_100203543 | 91 |
| 299 | 3300025931 | Ga0207644_10042428 | Ga0207644_100424283 | 91 |
| 300 | 3300025931 | Ga0207644_10049561 | Ga0207644_100495614 | 91 |
| 301 | 3300025931 | Ga0207644_10219693 | Ga0207644_102196933 | 91 |
| 302 | 3300025932 | Ga0207690_11051311 | Ga0207690_110513111 | 91 |
| 303 | 3300025933 | Ga0207706_10069481 | Ga0207706_100694812 | 91 |
| 304 | 3300025933 | Ga0207706_10495191 | Ga0207706_104951912 | 91 |
| 305 | 3300025934 | Ga0207686_10530889 | Ga0207686_105308892 | 91 |
| 306 | 3300025935 | Ga0207709_10011879 | Ga0207709_100118794 | 91 |
| 307 | 3300025936 | Ga0207670_10035459 | Ga0207670_100354594 | 91 |
| 308 | 3300025937 | Ga0207669_10014898 | Ga0207669_100148982 | 91 |
| 309 | 3300025937 | Ga0207669_10115308 | Ga0207669_101153081 | 91 |
| 310 | 3300025937 | Ga0207669_11367081 | Ga0207669_113670812 | 91 |
| 311 | 3300025938 | Ga0207704_10153063 | Ga0207704_101530632 | 91 |
| 312 | 3300025938 | Ga0207704_10279301 | Ga0207704_102793012 | 91 |
| 313 | 3300025940 | Ga0207691_10006082 | Ga0207691_100060825 | 91 |
| 314 | 3300025940 | Ga0207691_10007915 | Ga0207691_100079158 | 91 |
| 315 | 3300025940 | Ga0207691_10106713 | Ga0207691_101067133 | 91 |
| 316 | 3300025941 | Ga0207711_10304445 | Ga0207711_103044452 | 91 |
| 317 | 3300025941 | Ga0207711_10349411 | Ga0207711_103494112 | 91 |
| 318 | 3300025942 | Ga0207689_10014824 | Ga0207689_100148244 | 91 |
| 319 | 3300025942 | Ga0207689_10315909 | Ga0207689_103159093 | 91 |
| 320 | 3300025942 | Ga0207689_10830249 | Ga0207689_108302492 | 91 |
| 321 | 3300025945 | Ga0207679_10274408 | Ga0207679_102744082 | 91 |
| 322 | 3300025945 | Ga0207679_10816817 | Ga0207679_108168172 | 91 |
| 323 | 3300025960 | Ga0207651_10006687 | Ga0207651_100066872 | 91 |
| 324 | 3300025960 | Ga0207651_10022563 | Ga0207651_100225634 | 91 |
| 325 | 3300025960 | Ga0207651_10037495 | Ga0207651_100374952 | 91 |
| 326 | 3300025972 | Ga0207668_11106709 | Ga0207668_111067092 | 91 |
| 327 | 3300025972 | Ga0207668_11329276 | Ga0207668_113292761 | 91 |
| 328 | 3300025981 | Ga0207640_10082009 | Ga0207640_100820091 | 91 |
| 329 | 3300025981 | Ga0207640_11658197 | Ga0207640_116581971 | 91 |
| 330 | 3300025986 | Ga0207658_10000959 | Ga0207658_100009597 | 91 |
| 331 | 3300025986 | Ga0207658_10034313 | Ga0207658_100343133 | 91 |
| 332 | 3300025986 | Ga0207658_10087064 | Ga0207658_100870642 | 91 |
| 333 | 3300025986 | Ga0207658_10403408 | Ga0207658_104034082 | 91 |
| 334 | 3300026023 | Ga0207677_10072104 | Ga0207677_100721042 | 91 |
| 335 | 3300026023 | Ga0207677_10092228 | Ga0207677_100922282 | 91 |
| 336 | 3300026023 | Ga0207677_10219121 | Ga0207677_102191212 | 91 |
| 337 | 3300026023 | Ga0207677_10823507 | Ga0207677_108235072 | 91 |
| 338 | 3300026035 | Ga0207703_10206014 | Ga0207703_102060142 | 91 |
| 339 | 3300026067 | Ga0207678_10014055 | Ga0207678_100140557 | 91 |
| 340 | 3300026067 | Ga0207678_10133793 | Ga0207678_101337931 | 91 |
| 341 | 3300026067 | Ga0207678_10670291 | Ga0207678_106702912 | 91 |
| 342 | 3300026067 | Ga0207678_11489161 | Ga0207678_114891611 | 91 |
| 343 | 3300026075 | Ga0207708_10496898 | Ga0207708_104968982 | 91 |
| 344 | 3300026075 | Ga0207708_10870744 | Ga0207708_108707441 | 91 |
| 345 | 3300026078 | Ga0207702_10241988 | Ga0207702_102419882 | 91 |
| 346 | 3300026088 | Ga0207641_10049902 | Ga0207641_100499023 | 91 |
| 347 | 3300026088 | Ga0207641_10112479 | Ga0207641_101124794 | 91 |
| 348 | 3300026088 | Ga0207641_10377263 | Ga0207641_103772632 | 91 |
| 349 | 3300026089 | Ga0207648_10002629 | Ga0207648_100026297 | 91 |
| 350 | 3300026089 | Ga0207648_10002848 | Ga0207648_100028482 | 91 |
| 351 | 3300026089 | Ga0207648_10010781 | Ga0207648_100107819 | 91 |
| 352 | 3300026089 | Ga0207648_10097960 | Ga0207648_100979604 | 91 |
| 353 | 3300026089 | Ga0207648_10105316 | Ga0207648_101053162 | 91 |
| 354 | 3300026089 | Ga0207648_10823793 | Ga0207648_108237931 | 91 |
| 355 | 3300026095 | Ga0207676_10015099 | Ga0207676_100150995 | 91 |
| 356 | 3300026095 | Ga0207676_10026609 | Ga0207676_100266094 | 91 |
| 357 | 3300026116 | Ga0207674_10008218 | Ga0207674_100082185 | 91 |
| 358 | 3300026116 | Ga0207674_10372743 | Ga0207674_103727432 | 91 |
| 359 | 3300026116 | Ga0207674_12264397 | Ga0207674_122643972 | 91 |
| 360 | 3300026118 | Ga0207675_101882346 | Ga0207675_1018823462 | 91 |
| 361 | 3300026121 | Ga0207683_10006663 | Ga0207683_100066639 | 91 |
| 362 | 3300026121 | Ga0207683_10052477 | Ga0207683_100524772 | 91 |
| 363 | 3300026142 | Ga0207698_10461291 | Ga0207698_104612912 | 91 |
| 364 | 3300026142 | Ga0207698_10540123 | Ga0207698_105401232 | 91 |
| 365 | 3300026142 | Ga0207698_12081265 | Ga0207698_120812652 | 91 |
| 366 | 3300027866 | Ga0209813_10024011 | Ga0209813_100240112 | 91 |
| 367 | 3300027866 | Ga0209813_10153977 | Ga0209813_101539772 | 91 |
| 368 | 3300028379 | Ga0268266_10848140 | Ga0268266_108481402 | 91 |
| 369 | 3300028379 | Ga0268266_11109401 | Ga0268266_111094012 | 91 |
| 370 | 3300028381 | Ga0268264_10092858 | Ga0268264_100928584 | 91 |
| 371 | 3300028381 | Ga0268264_10238395 | Ga0268264_102383953 | 91 |
| 372 | 3300028786 | Ga0307517_10001871 | Ga0307517_100018716 | 91 |
| 373 | 3300028786 | Ga0307517_10083410 | Ga0307517_100834102 | 91 |
| 374 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020239 | 91 |
| 375 | 3300028794 | Ga0307515_10036978 | Ga0307515_100369782 | 91 |
| 376 | 3300028794 | Ga0307515_10038740 | Ga0307515_100387406 | 91 |
| 377 | 3300030522 | Ga0307512_10276590 | Ga0307512_102765902 | 91 |
| 378 | 3300031456 | Ga0307513_10116867 | Ga0307513_101168674 | 91 |
| 379 | 3300031456 | Ga0307513_10119691 | Ga0307513_101196913 | 91 |
| 380 | 3300031456 | Ga0307513_10197218 | Ga0307513_101972182 | 91 |
| 381 | 3300031507 | Ga0307509_10453799 | Ga0307509_104537992 | 91 |
| 382 | 3300031548 | Ga0307408_100000030 | Ga0307408_100000030198 | 91 |
| 383 | 3300031548 | Ga0307408_100529608 | Ga0307408_1005296082 | 91 |
| 384 | 3300031616 | Ga0307508_10038562 | Ga0307508_100385624 | 91 |
| 385 | 3300031730 | Ga0307516_10000312 | Ga0307516_100003122 | 91 |
| 386 | 3300031730 | Ga0307516_10350336 | Ga0307516_103503363 | 91 |
| 387 | 3300031731 | Ga0307405_10006547 | Ga0307405_100065472 | 91 |
| 388 | 3300031731 | Ga0307405_11045951 | Ga0307405_110459511 | 91 |
| 389 | 3300031731 | Ga0307405_11719481 | Ga0307405_117194811 | 91 |
| 390 | 3300031731 | Ga0307405_11790130 | Ga0307405_117901301 | 91 |
| 391 | 3300031824 | Ga0307413_10094755 | Ga0307413_100947553 | 91 |
| 392 | 3300031824 | Ga0307413_10893459 | Ga0307413_108934592 | 91 |
| 393 | 3300031852 | Ga0307410_10009817 | Ga0307410_100098176 | 91 |
| 394 | 3300031901 | Ga0307406_10034996 | Ga0307406_100349963 | 91 |
| 395 | 3300031901 | Ga0307406_10130243 | Ga0307406_101302433 | 91 |
| 396 | 3300031903 | Ga0307407_11519413 | Ga0307407_115194132 | 91 |
| 397 | 3300031911 | Ga0307412_10018914 | Ga0307412_100189145 | 91 |
| 398 | 3300031995 | Ga0307409_100094217 | Ga0307409_1000942172 | 91 |
| 399 | 3300031995 | Ga0307409_100255757 | Ga0307409_1002557572 | 91 |
| 400 | 3300031995 | Ga0307409_100974702 | Ga0307409_1009747022 | 91 |
| 401 | 3300031995 | Ga0307409_102068661 | Ga0307409_1020686611 | 91 |
| 402 | 3300032002 | Ga0307416_100088088 | Ga0307416_1000880884 | 91 |
| 403 | 3300032002 | Ga0307416_100289497 | Ga0307416_1002894972 | 91 |
| 404 | 3300032002 | Ga0307416_100596078 | Ga0307416_1005960783 | 91 |
| 405 | 3300032002 | Ga0307416_101923630 | Ga0307416_1019236301 | 91 |
| 406 | 3300032004 | Ga0307414_10332404 | Ga0307414_103324042 | 91 |
| 407 | 3300032004 | Ga0307414_10772426 | Ga0307414_107724262 | 91 |
| 408 | 3300032005 | Ga0307411_10048663 | Ga0307411_100486632 | 91 |
| 409 | 3300033180 | Ga0307510_10026627 | Ga0307510_100266274 | 91 |
| 410 | 3300035090 | Ga0373949_0045977 | Ga0373949_0045977_777_1055 | 91 |
| 411 | 3300035170 | Ga0373943_0031464 | Ga0373943_0031464_1540_1818 | 91 |
| 412 | 3300036401 | Ga0373937_0956821 | Ga0373937_0956821_115_393 | 91 |
| 413 | 3300037068 | Ga0373925_0533137 | Ga0373925_0533137_250_528 | 91 |
| 414 | 3300037471 | Ga0395905_0005832 | Ga0395905_0005832_1863_2138 | 91 |
| 415 | 3300037471 | Ga0395905_0016819 | Ga0395905_0016819_3817_4095 | 91 |
| 416 | 3300037471 | Ga0395905_0738319 | Ga0395905_0738319_146_421 | 91 |
| 417 | 3300039437 | Ga0436365_0896739 | Ga0436365_0896739_181_459 | 91 |
| 418 | 3300041486 | Ga0451807_0498778 | Ga0451807_0498778_430_714 | 91 |
| 419 | 3300042133 | Ga0450896_056146 | Ga0450896_056146_121_399 | 91 |
| 420 | 3300042876 | Ga0451577_0403684 | Ga0451577_0403684_743_1030 | 91 |
| 421 | 3300044658 | Ga0466972_0183983 | Ga0466972_0183983_471_746 | 91 |
| 422 | 3300044673 | Ga0453683_0283795 | Ga0453683_0283795_558_845 | 91 |
| 423 | 3300044683 | Ga0466965_0090831 | Ga0466965_0090831_1100_1375 | 91 |
| 424 | 3300044712 | Ga0453684_0005559 | Ga0453684_0005559_23538_23816 | 91 |
| 425 | 3300044735 | Ga0466968_0014664 | Ga0466968_0014664_1085_1372 | 91 |
| 426 | 3300044842 | Ga0466957_0532457 | Ga0466957_0532457_14_289 | 91 |
| 427 | 3300044901 | Ga0466960_0936628 | Ga0466960_0936628_181_459 | 91 |
| 428 | 3300045051 | Ga0451576_0114403 | Ga0451576_0114403_1346_1633 | 91 |
| 429 | 3300045051 | Ga0451576_0234298 | Ga0451576_0234298_1523_1828 | 91 |
| 430 | 3300046454 | Ga0495592_0651314 | Ga0495592_0651314_170_448 | 91 |
| 431 | 3300046459 | Ga0495629_0821257 | Ga0495629_0821257_46_324 | 91 |
| 432 | 3300046460 | Ga0495638_0530940 | Ga0495638_0530940_261_539 | 91 |
| 433 | 3300046461 | Ga0495641_0246597 | Ga0495641_0246597_405_683 | 91 |
| 434 | 3300046471 | Ga0495650_0060529 | Ga0495650_0060529_863_1138 | 91 |
| 435 | 3300046472 | Ga0495580_0807912 | Ga0495580_0807912_299_577 | 91 |
| 436 | 3300046506 | Ga0495583_0184829 | Ga0495583_0184829_292_591 | 91 |
| 437 | 3300046512 | Ga0495610_0200309 | Ga0495610_0200309_105_404 | 91 |
| 438 | 3300046513 | Ga0495616_0090863 | Ga0495616_0090863_328_627 | 91 |
| 439 | 3300046519 | Ga0495632_0007745 | Ga0495632_0007745_319_618 | 91 |
| 440 | 3300046519 | Ga0495632_0333567 | Ga0495632_0333567_218_496 | 91 |
| 441 | 3300046528 | Ga0495642_0228548 | Ga0495642_0228548_385_684 | 91 |
| 442 | 3300046530 | Ga0495654_0393360 | Ga0495654_0393360_31_330 | 91 |
| 443 | 3300046539 | Ga0495621_0066745 | Ga0495621_0066745_178_456 | 91 |
| 444 | 3300046539 | Ga0495621_0303791 | Ga0495621_0303791_293_571 | 91 |
| 445 | 3300046542 | Ga0495597_0062371 | Ga0495597_0062371_601_894 | 91 |
| 446 | 3300046543 | Ga0495645_0859374 | Ga0495645_0859374_198_488 | 91 |
| 447 | 3300046660 | Ga0495625_0156033 | Ga0495625_0156033_241_519 | 91 |
| 448 | 3300046680 | Ga0495646_0620580 | Ga0495646_0620580_16_306 | 91 |
| 449 | 3300046683 | Ga0495658_0145588 | Ga0495658_0145588_1085_1363 | 91 |
| 450 | 3300046692 | Ga0495671_0207850 | Ga0495671_0207850_378_659 | 91 |
| 451 | 3300046692 | Ga0495671_0439485 | Ga0495671_0439485_309_608 | 91 |
| 452 | 3300046694 | Ga0495649_0004724 | Ga0495649_0004724_679_978 | 91 |
| 453 | 3300046694 | Ga0495649_0163446 | Ga0495649_0163446_297_578 | 91 |
| 454 | 3300047443 | Ga0495687_000594 | Ga0495687_000594_1509_1802 | 91 |
| 455 | 3300047443 | Ga0495687_005079 | Ga0495687_005079_7873_8172 | 91 |
| 456 | 3300047443 | Ga0495687_006945 | Ga0495687_006945_4967_5266 | 91 |
| 457 | 3300047444 | Ga0495675_0632002 | Ga0495675_0632002_176_454 | 91 |
| 458 | 3300048091 | Ga0495626_0026314 | Ga0495626_0026314_2201_2494 | 91 |
| 459 | 3300048903 | Ga0496100_0340530 | Ga0496100_0340530_169_447 | 91 |
| 460 | 3300048905 | Ga0496102_0989300 | Ga0496102_0989300_321_599 | 91 |
| 461 | 3300048907 | Ga0496104_0272846 | Ga0496104_0272846_571_849 | 91 |
| 462 | 3300048907 | Ga0496104_0284257 | Ga0496104_0284257_771_1049 | 91 |
| 463 | 3300048908 | Ga0496105_0272040 | Ga0496105_0272040_1078_1356 | 91 |
| 464 | 3300048909 | Ga0496106_0650073 | Ga0496106_0650073_337_615 | 91 |
| 465 | 3300048910 | Ga0496107_1278102 | Ga0496107_1278102_72_350 | 91 |
| 466 | 3300048911 | Ga0496108_0402422 | Ga0496108_0402422_545_823 | 91 |
| 467 | 3300048912 | Ga0496109_0128519 | Ga0496109_0128519_866_1144 | 91 |
| 468 | 3300048915 | Ga0496112_1044640 | Ga0496112_1044640_299_577 | 91 |
| 469 | 3300048916 | Ga0496113_0674018 | Ga0496113_0674018_369_647 | 91 |
| 470 | 3300048924 | Ga0496121_0026536 | Ga0496121_0026536_1931_2209 | 91 |
| 471 | 3300048926 | Ga0496123_0466147 | Ga0496123_0466147_52_330 | 91 |
| 472 | 3300048927 | Ga0496124_0466928 | Ga0496124_0466928_277_555 | 91 |
| 473 | 3300048928 | Ga0496125_0564286 | Ga0496125_0564286_241_519 | 91 |
| 474 | 3300049577 | Ga0501041_0861602 | Ga0501041_0861602_25_303 | 91 |
| 475 | 3300049705 | Ga0501225_0065496 | Ga0501225_0065496_205_483 | 91 |
| 476 | 3300049822 | Ga0501035_0207821 | Ga0501035_0207821_263_538 | 91 |
| 477 | 3300050489 | nmdc:mga03683_9019_c1 | nmdc:mga03683_9019_c1_1416_1715 | 91 |
| 478 | 3300050490 | nmdc:mga03n38_208033_c1 | nmdc:mga03n38_208033_c1_557_856 | 91 |
| 479 | 3300050491 | nmdc:mga00v17_319009_c1 | nmdc:mga00v17_319009_c1_135_434 | 91 |
| 480 | 3300050492 | nmdc:mga0yw44_47259_c1 | nmdc:mga0yw44_47259_c1_1075_1374 | 91 |
| 481 | 3300050493 | nmdc:mga0k408_103026_c1 | nmdc:mga0k408_103026_c1_572_850 | 91 |
| 482 | 3300050493 | nmdc:mga0k408_120188_c1 | nmdc:mga0k408_120188_c1_732_1010 | 91 |
| 483 | 3300050493 | nmdc:mga0k408_24186_c1 | nmdc:mga0k408_24186_c1_2252_2530 | 91 |
| 484 | 3300050493 | nmdc:mga0k408_302552_c1 | nmdc:mga0k408_302552_c1_262_540 | 91 |
| 485 | 3300050493 | nmdc:mga0k408_362386_c1 | nmdc:mga0k408_362386_c1_66_344 | 91 |
| 486 | 3300050493 | nmdc:mga0k408_39853_c1 | nmdc:mga0k408_39853_c1_1169_1459 | 91 |
| 487 | 3300050493 | nmdc:mga0k408_9344_c1 | nmdc:mga0k408_9344_c1_1611_1910 | 91 |
| 488 | 3300050494 | nmdc:mga06z11_248091_c1 | nmdc:mga06z11_248091_c1_653_952 | 91 |
| 489 | 3300050495 | nmdc:mga04h51_328945_c1 | nmdc:mga04h51_328945_c1_137_415 | 91 |
| 490 | 3300050495 | nmdc:mga04h51_70965_c1 | nmdc:mga04h51_70965_c1_653_952 | 91 |
| 491 | 3300050496 | nmdc:mga07m45_14664_c2 | nmdc:mga07m45_14664_c2_865_1164 | 91 |
| 492 | 3300050496 | nmdc:mga07m45_172542_c1 | nmdc:mga07m45_172542_c1_330_635 | 91 |
| 493 | 3300050496 | nmdc:mga07m45_2545_c1 | nmdc:mga07m45_2545_c1_1060_1365 | 91 |
| 494 | 3300050496 | nmdc:mga07m45_544471_c1 | nmdc:mga07m45_544471_c1_178_468 | 91 |
| 495 | 3300050496 | nmdc:mga07m45_9585_c1 | nmdc:mga07m45_9585_c1_3755_4057 | 91 |
| 496 | 3300050516 | nmdc:mga0sz30_3098_c1 | nmdc:mga0sz30_3098_c1_4247_4546 | 91 |
| 497 | 3300053077 | Ga0495601_0475858 | Ga0495601_0475858_77_367 | 91 |
| 498 | 3300053084 | Ga0495595_0260151 | Ga0495595_0260151_294_572 | 91 |
| 499 | 3300053086 | Ga0500578_0035984 | Ga0500578_0035984_170_448 | 91 |
| 500 | 3300053092 | Ga0500583_0275119 | Ga0500583_0275119_263_562 | 91 |
| 501 | 3300053093 | Ga0500651_0701111 | Ga0500651_0701111_154_453 | 91 |
| 502 | 3300053134 | Ga0500658_0008541 | Ga0500658_0008541_2721_3020 | 91 |
| 503 | 3300053139 | Ga0500568_0028846 | Ga0500568_0028846_1896_2195 | 91 |
| 504 | 3300053148 | Ga0500590_020753 | Ga0500590_020753_1012_1290 | 91 |
| 505 | 3300053730 | Ga0500645_002406 | Ga0500645_002406_7346_7624 | 91 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar