F456381

General Info

Members Datasets Scaffolds Average Seq Length
505 269 504 93

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101923630|Ga0307416_1019236301
Length 108
Sequence MRAGLGAARRSARTPLMRYVSLALIVLLGLVHAELWFGKGGVPRMLELRGKLGEQQVANQADRARNAQLVAEVSDLKEGLEMVEEKARYELGMVKPDEILVQISTPRR

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
80 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
176 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.89
Nodule 0
Rhizoplane 2.77
Rhizosphere 80.99
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10118798 3300002067 Bacteria 761
2 JGI24744J21845_10016073 3300002077 Bacteria 1491
3 rootH1_10054985 3300003316 Bacteria 5321
4 rootL2_10072117 3300003322 Bacteria 1328
5 Ga0065712_10331152 3300005290 Bacteria 814
6 Ga0070658_10994249 3300005327 Bacteria 730
7 Ga0070676_10013248 3300005328 Bacteria 4517
8 Ga0070676_10108703 3300005328 Bacteria 1724
9 Ga0070676_10109878 3300005328 Bacteria 1715
10 Ga0070670_100016116 3300005331 Bacteria 6414
11 Ga0070670_100097990 3300005331 Bacteria 2522
12 Ga0070670_100407023 3300005331 Bacteria 1202
13 Ga0070670_100615502 3300005331 Bacteria 972
14 Ga0070670_101911403 3300005331 Bacteria 547
15 Ga0070677_10001548 3300005333 Bacteria 7279
16 Ga0070677_10034968 3300005333 Bacteria 1944
17 Ga0070677_10859805 3300005333 Bacteria 522
18 Ga0068869_100013561 3300005334 Bacteria 5424
19 Ga0068869_100027665 3300005334 Bacteria 3956
20 Ga0068869_100227886 3300005334 Bacteria 1480
21 Ga0070666_10079225 3300005335 Bacteria 2244
22 Ga0070666_10381535 3300005335 Bacteria 1012
23 Ga0070666_11447756 3300005335 Bacteria 513
24 Ga0068868_100081103 3300005338 Bacteria 2600
25 Ga0068868_100097025 3300005338 Bacteria 2381
26 Ga0068868_100308469 3300005338 Bacteria 1346
27 Ga0068868_100553922 3300005338 Bacteria 1014
28 Ga0070689_100034512 3300005340 Bacteria 3860
29 Ga0070687_100848806 3300005343 Bacteria 651
30 Ga0070661_100778719 3300005344 Bacteria 784
31 Ga0070668_101611612 3300005347 Bacteria 595
32 Ga0070669_100006105 3300005353 Bacteria 8694
33 Ga0070669_100518398 3300005353 Bacteria 991
34 Ga0070675_100005184 3300005354 Bacteria 9937
35 Ga0070675_100019867 3300005354 Bacteria 5359
36 Ga0070675_100047712 3300005354 Bacteria 3510
37 Ga0070671_100021133 3300005355 Bacteria 5314
38 Ga0070671_100040868 3300005355 Bacteria 3853
39 Ga0070671_100081753 3300005355 Bacteria 2701
40 Ga0070671_100479630 3300005355 Bacteria 1068
41 Ga0070674_100008300 3300005356 Bacteria 6178
42 Ga0070674_100030634 3300005356 Bacteria 3558
43 Ga0070674_100820464 3300005356 Bacteria 805
44 Ga0070673_100005136 3300005364 Bacteria 8348
45 Ga0070673_100072711 3300005364 Bacteria 2766
46 Ga0070673_100261577 3300005364 Bacteria 1512
47 Ga0070673_101164537 3300005364 Bacteria 722
48 Ga0070673_101919759 3300005364 Bacteria 562
49 Ga0070673_102138282 3300005364 Bacteria 532
50 Ga0070673_102162897 3300005364 Bacteria 529
51 Ga0070688_100068326 3300005365 Bacteria 2265
52 Ga0070688_100771805 3300005365 Bacteria 750
53 Ga0070659_101073669 3300005366 Bacteria 709
54 Ga0070659_101784626 3300005366 Bacteria 551
55 Ga0070667_100001171 3300005367 Bacteria 23847
56 Ga0070667_100043049 3300005367 Bacteria 3789
57 Ga0070667_100089205 3300005367 Bacteria 2648
58 Ga0070667_100218662 3300005367 Bacteria 1695
59 Ga0070667_100799424 3300005367 Bacteria 876
60 Ga0070701_10978897 3300005438 Bacteria 589
61 Ga0070700_101650069 3300005441 Bacteria 549
62 Ga0070700_101941073 3300005441 Bacteria 510
63 Ga0070708_100148628 3300005445 Bacteria 2178
64 Ga0070663_100562612 3300005455 Bacteria 954
65 Ga0070663_101018736 3300005455 Bacteria 721
66 Ga0070678_100001334 3300005456 Bacteria 13117
67 Ga0070678_100009607 3300005456 Bacteria 5871
68 Ga0070678_102108049 3300005456 Bacteria 534
69 Ga0070662_100082775 3300005457 Bacteria 2393
70 Ga0070662_100612187 3300005457 Bacteria 917
71 Ga0068867_100000815 3300005459 Bacteria 21046
72 Ga0068867_100002841 3300005459 Bacteria 12176
73 Ga0068867_100002971 3300005459 Bacteria 11946
74 Ga0068867_100032757 3300005459 Bacteria 3760
75 Ga0068867_100139769 3300005459 Bacteria 1892
76 Ga0068867_100814912 3300005459 Bacteria 833
77 Ga0070698_101658556 3300005471 Bacteria 592
78 Ga0068853_102166775 3300005539 Bacteria 539
79 Ga0070672_100002062 3300005543 Bacteria 12665
80 Ga0070672_100010713 3300005543 Bacteria 6369
81 Ga0070672_100062465 3300005543 Bacteria 2939
82 Ga0070672_100205866 3300005543 Bacteria 1647
83 Ga0070693_100527632 3300005547 Bacteria 842
84 Ga0070665_100129996 3300005548 Bacteria 2520
85 Ga0070665_100471710 3300005548 Bacteria 1266
86 Ga0070664_100502390 3300005564 Bacteria 1118
87 Ga0070664_100817428 3300005564 Bacteria 872
88 Ga0068857_100025437 3300005577 Bacteria 5212
89 Ga0068854_100143833 3300005578 Bacteria 1833
90 Ga0068854_100192091 3300005578 Bacteria 1600
91 Ga0068856_100059001 3300005614 Bacteria 3790
92 Ga0070702_101028629 3300005615 Bacteria 654
93 Ga0070702_101164237 3300005615 Bacteria 619
94 Ga0068852_100138634 3300005616 Bacteria 2249
95 Ga0068852_100601482 3300005616 Bacteria 1104
96 Ga0068852_101263879 3300005616 Bacteria 760
97 Ga0068852_101659834 3300005616 Bacteria 661
98 Ga0068859_100002636 3300005617 Bacteria 18245
99 Ga0068864_100020879 3300005618 Bacteria 5482
100 Ga0068864_100987047 3300005618 Bacteria 835
101 Ga0068864_101195822 3300005618 Bacteria 759
102 Ga0068866_10119073 3300005718 Bacteria 1485
103 Ga0068866_10695891 3300005718 Bacteria 697
104 Ga0068866_11402184 3300005718 Bacteria 511
105 Ga0068861_100467466 3300005719 Bacteria 1133
106 Ga0068851_10104658 3300005834 Bacteria 1505
107 Ga0068870_10042666 3300005840 Bacteria 2362
108 Ga0068870_10261700 3300005840 Bacteria 1077
109 Ga0068863_100147201 3300005841 Bacteria 2253
110 Ga0068863_100326675 3300005841 Bacteria 1491
111 Ga0068858_100054908 3300005842 Bacteria 3683
112 Ga0068860_100478813 3300005843 Bacteria 1241
113 Ga0068860_100536719 3300005843 Bacteria 1171
114 Ga0075365_10253693 3300006038 Bacteria 1236
115 Ga0075368_10024067 3300006042 Bacteria 2330
116 Ga0075368_10223723 3300006042 Bacteria 800
117 Ga0075363_100187176 3300006048 Bacteria 1180
118 Ga0075364_10322521 3300006051 Bacteria 1052
119 Ga0070715_10062786 3300006163 Bacteria 1636
120 Ga0075362_10037524 3300006177 Bacteria 2125
121 Ga0075362_10088534 3300006177 Bacteria 1434
122 Ga0075362_10359198 3300006177 Bacteria 730
123 Ga0075367_10224977 3300006178 Bacteria 1174
124 Ga0075369_10010341 3300006186 Bacteria 3647
125 Ga0075366_10010236 3300006195 Bacteria 5261
126 Ga0075366_10015142 3300006195 Bacteria 4414
127 Ga0075366_10020898 3300006195 Bacteria 3802
128 Ga0075366_10028358 3300006195 Bacteria 3286
129 Ga0075366_10059108 3300006195 Bacteria 2277
130 Ga0075366_10120695 3300006195 Bacteria 1579
131 Ga0075366_10299438 3300006195 Bacteria 984
132 Ga0075366_10425129 3300006195 Bacteria 818
133 Ga0097621_100083076 3300006237 Bacteria 2668
134 Ga0097621_101813521 3300006237 Bacteria 582
135 Ga0075370_10006318 3300006353 Bacteria 5951
136 Ga0075370_10037650 3300006353 Bacteria 2720
137 Ga0075370_10152705 3300006353 Bacteria 1353
138 Ga0075370_10578672 3300006353 Bacteria 680
139 Ga0068871_100040812 3300006358 Bacteria 3718
140 Ga0068871_100141677 3300006358 Bacteria 2045
141 Ga0068871_100769809 3300006358 Bacteria 886
142 Ga0075433_11596371 3300006852 Bacteria 563
143 Ga0068865_100335970 3300006881 Bacteria 1220
144 Ga0068865_100493325 3300006881 Bacteria 1020
145 Ga0068865_100644583 3300006881 Bacteria 900
146 Ga0097620_100002636 3300006931 Bacteria 18245
147 Ga0105240_10038063 3300009093 Bacteria 6174
148 Ga0111539_10282788 3300009094 Bacteria 1930
149 Ga0105245_10122662 3300009098 Bacteria 2429
150 Ga0105245_10256066 3300009098 Bacteria 1702
151 Ga0105245_11718666 3300009098 Bacteria 680
152 Ga0105243_10039925 3300009148 Bacteria 3662
153 Ga0105243_10187471 3300009148 Bacteria 1804
154 Ga0105243_12768758 3300009148 Bacteria 531
155 Ga0105242_10513252 3300009176 Bacteria 1142
156 Ga0105242_11260373 3300009176 Bacteria 761
157 Ga0105248_10138031 3300009177 Bacteria 2751
158 Ga0105248_11033921 3300009177 Bacteria 928
159 Ga0105248_11782569 3300009177 Bacteria 698
160 Ga0105237_10003466 3300009545 Bacteria 18708
161 Ga0105238_10007665 3300009551 Bacteria 10803
162 Ga0105249_13423643 3300009553 Bacteria 511
163 Ga0105239_10003789 3300010375 Bacteria 18406
164 Ga0105246_11142978 3300011119 Bacteria 713
165 Ga0157328_1020915 3300012478 Bacteria 552
166 Ga0157326_1044290 3300012513 Bacteria 634
167 Ga0157374_10121407 3300013296 Bacteria 2522
168 Ga0157374_10538658 3300013296 Bacteria 1174
169 Ga0157378_10078498 3300013297 Bacteria 2978
170 Ga0157378_10574474 3300013297 Bacteria 1136
171 Ga0157378_10625617 3300013297 Bacteria 1090
172 Ga0163162_10028472 3300013306 Bacteria 5529
173 Ga0163162_10052435 3300013306 Bacteria 4097
174 Ga0163162_12172092 3300013306 Bacteria 637
175 Ga0157372_10114235 3300013307 Bacteria 3095
176 Ga0157375_10039345 3300013308 Bacteria 4551
177 Ga0157375_10056327 3300013308 Bacteria 3881
178 Ga0157375_10237311 3300013308 Bacteria 1983
179 Ga0157375_11101949 3300013308 Bacteria 929
180 Ga0163163_10083873 3300014325 Bacteria 3192
181 Ga0163163_11303849 3300014325 Bacteria 788
182 Ga0157380_12317556 3300014326 Bacteria 601
183 Ga0157377_10000382 3300014745 Bacteria 19272
184 Ga0157377_10260105 3300014745 Bacteria 1129
185 Ga0157379_10013894 3300014968 Bacteria 7057
186 Ga0157379_10016805 3300014968 Bacteria 6440
187 Ga0157376_10051337 3300014969 Bacteria 3425
188 Ga0157376_10327596 3300014969 Bacteria 1458
189 Ga0157376_10361085 3300014969 Bacteria 1393
190 Ga0157376_10745023 3300014969 Bacteria 988
191 Ga0157376_12148946 3300014969 Bacteria 597
192 Ga0163161_10051865 3300017792 Bacteria 2973
193 Ga0163161_10589238 3300017792 Bacteria 915
194 Ga0213876_10361896 3300021384 Bacteria 772
195 Ga0207673_1018564 3300025290 Bacteria 931
196 Ga0207697_10019486 3300025315 Bacteria 2779
197 Ga0207656_10111072 3300025321 Bacteria 1267
198 Ga0207682_10001523 3300025893 Bacteria 10677
199 Ga0207682_10060765 3300025893 Bacteria 1581
200 Ga0207682_10152401 3300025893 Bacteria 1043
201 Ga0207642_10051757 3300025899 Bacteria 1860
202 Ga0207680_10325724 3300025903 Bacteria 1075
203 Ga0207680_10809214 3300025903 Bacteria 672
204 Ga0207680_10936756 3300025903 Bacteria 621
205 Ga0207685_10243966 3300025905 Bacteria 866
206 Ga0207645_10012119 3300025907 Bacteria 5857
207 Ga0207645_10388407 3300025907 Bacteria 938
208 Ga0207643_10049838 3300025908 Bacteria 2374
209 Ga0207643_10057915 3300025908 Bacteria 2207
210 Ga0207705_11075391 3300025909 Bacteria 620
211 Ga0207695_10031173 3300025913 Bacteria 5854
212 Ga0207671_10005697 3300025914 Bacteria 11382
213 Ga0207662_10460817 3300025918 Bacteria 870
214 Ga0207649_10192674 3300025920 Bacteria 1435
215 Ga0207652_10994093 3300025921 Bacteria 738
216 Ga0207681_10049977 3300025923 Bacteria 2828
217 Ga0207681_10409725 3300025923 Bacteria 1096
218 Ga0207694_10024013 3300025924 Bacteria 4630
219 Ga0207650_10002460 3300025925 Bacteria 12887
220 Ga0207650_10290755 3300025925 Bacteria 1332
221 Ga0207650_11402653 3300025925 Bacteria 594
222 Ga0207650_11911347 3300025925 Bacteria 501
223 Ga0207659_10006295 3300025926 Bacteria 7260
224 Ga0207659_10009925 3300025926 Bacteria 5958
225 Ga0207659_10049091 3300025926 Bacteria 2992
226 Ga0207687_10053973 3300025927 Bacteria 2810
227 Ga0207687_10075296 3300025927 Bacteria 2422
228 Ga0207644_10020354 3300025931 Bacteria 4511
229 Ga0207644_10042428 3300025931 Bacteria 3224
230 Ga0207644_10049561 3300025931 Bacteria 3007
231 Ga0207644_10219693 3300025931 Bacteria 1506
232 Ga0207690_10915932 3300025932 Bacteria 727
233 Ga0207690_11051311 3300025932 Bacteria 678
234 Ga0207706_10069481 3300025933 Bacteria 3098
235 Ga0207706_10495191 3300025933 Bacteria 1055
236 Ga0207706_11312454 3300025933 Bacteria 597
237 Ga0207686_10530889 3300025934 Bacteria 917
238 Ga0207709_10011879 3300025935 Bacteria 4804
239 Ga0207709_10831846 3300025935 Bacteria 747
240 Ga0207670_10035459 3300025936 Bacteria 3234
241 Ga0207669_10014898 3300025937 Bacteria 3909
242 Ga0207669_10115308 3300025937 Bacteria 1810
243 Ga0207669_11367081 3300025937 Bacteria 602
244 Ga0207704_10153063 3300025938 Bacteria 1630
245 Ga0207704_10279301 3300025938 Bacteria 1269
246 Ga0207691_10006082 3300025940 Bacteria 11664
247 Ga0207691_10007915 3300025940 Bacteria 10231
248 Ga0207691_10106713 3300025940 Bacteria 2494
249 Ga0207691_10157816 3300025940 Bacteria 1991
250 Ga0207711_10304445 3300025941 Bacteria 1470
251 Ga0207711_10349411 3300025941 Bacteria 1369
252 Ga0207689_10014824 3300025942 Bacteria 6617
253 Ga0207689_10315909 3300025942 Bacteria 1296
254 Ga0207689_10830249 3300025942 Bacteria 780
255 Ga0207689_11328193 3300025942 Bacteria 604
256 Ga0207679_10274408 3300025945 Bacteria 1443
257 Ga0207679_10816817 3300025945 Bacteria 850
258 Ga0207651_10006687 3300025960 Bacteria 6069
259 Ga0207651_10022563 3300025960 Bacteria 3851
260 Ga0207651_10037495 3300025960 Bacteria 3176
261 Ga0207668_11106709 3300025972 Bacteria 710
262 Ga0207668_11329276 3300025972 Bacteria 647
263 Ga0207640_10082009 3300025981 Bacteria 2207
264 Ga0207640_11658197 3300025981 Bacteria 577
265 Ga0207658_10000959 3300025986 Bacteria 23778
266 Ga0207658_10034313 3300025986 Bacteria 3626
267 Ga0207658_10087064 3300025986 Bacteria 2411
268 Ga0207658_10403408 3300025986 Bacteria 1202
269 Ga0207677_10072104 3300026023 Bacteria 2440
270 Ga0207677_10092228 3300026023 Bacteria 2205
271 Ga0207677_10219121 3300026023 Bacteria 1525
272 Ga0207677_10823507 3300026023 Bacteria 832
273 Ga0207703_10206014 3300026035 Bacteria 1750
274 Ga0207678_10014055 3300026067 Bacteria 7040
275 Ga0207678_10133793 3300026067 Bacteria 2115
276 Ga0207678_10670291 3300026067 Bacteria 912
277 Ga0207678_11489161 3300026067 Bacteria 597
278 Ga0207708_10496898 3300026075 Bacteria 1022
279 Ga0207708_10870744 3300026075 Bacteria 778
280 Ga0207702_10241988 3300026078 Bacteria 1691
281 Ga0207641_10049902 3300026088 Bacteria 3538
282 Ga0207641_10112479 3300026088 Bacteria 2416
283 Ga0207641_10377263 3300026088 Bacteria 1357
284 Ga0207648_10002629 3300026089 Bacteria 19224
285 Ga0207648_10002848 3300026089 Bacteria 18311
286 Ga0207648_10010781 3300026089 Bacteria 8636
287 Ga0207648_10097960 3300026089 Bacteria 2567
288 Ga0207648_10105316 3300026089 Bacteria 2474
289 Ga0207648_10823793 3300026089 Bacteria 865
290 Ga0207676_10015099 3300026095 Bacteria 5569
291 Ga0207676_10026609 3300026095 Bacteria 4302
292 Ga0207674_10008218 3300026116 Bacteria 12093
293 Ga0207674_10372743 3300026116 Bacteria 1380
294 Ga0207674_11187737 3300026116 Bacteria 732
295 Ga0207674_12264397 3300026116 Bacteria 506
296 Ga0207675_101100613 3300026118 Bacteria 814
297 Ga0207675_101882346 3300026118 Bacteria 617
298 Ga0207683_10006663 3300026121 Bacteria 9879
299 Ga0207683_10013159 3300026121 Bacteria 7059
300 Ga0207683_10052477 3300026121 Bacteria 3573
301 Ga0207698_10461291 3300026142 Bacteria 1229
302 Ga0207698_10540123 3300026142 Bacteria 1141
303 Ga0207698_11415505 3300026142 Bacteria 710
304 Ga0207698_12081265 3300026142 Bacteria 581
305 Ga0209983_1007828 3300027665 Bacteria 2186
306 Ga0209813_10024011 3300027866 Bacteria 1739
307 Ga0209813_10153977 3300027866 Bacteria 825
308 Ga0268266_10338942 3300028379 Bacteria 1411
309 Ga0268266_10848140 3300028379 Bacteria 883
310 Ga0268266_11109401 3300028379 Bacteria 765
311 Ga0268264_10092858 3300028381 Bacteria 2606
312 Ga0268264_10238395 3300028381 Bacteria 1684
313 Ga0307517_10001871 3300028786 Bacteria 34464
314 Ga0307517_10083410 3300028786 Bacteria 2702
315 Ga0307515_10000020 3300028794 Bacteria 411735
316 Ga0307515_10036978 3300028794 Bacteria 7871
317 Ga0307515_10038740 3300028794 Bacteria 7610
318 Ga0307512_10276590 3300030522 Bacteria 807
319 Ga0307513_10116867 3300031456 Bacteria 2645
320 Ga0307513_10119691 3300031456 Bacteria 2604
321 Ga0307513_10197218 3300031456 Bacteria 1858
322 Ga0307509_10453799 3300031507 Bacteria 975
323 Ga0307408_100000030 3300031548 Bacteria 223389
324 Ga0307408_100529608 3300031548 Bacteria 1036
325 Ga0307408_102289692 3300031548 Bacteria 523
326 Ga0307508_10038562 3300031616 Bacteria 4293
327 Ga0307516_10000312 3300031730 Bacteria 62905
328 Ga0307516_10014242 3300031730 Bacteria 8424
329 Ga0307516_10299808 3300031730 Bacteria 1283
330 Ga0307516_10350336 3300031730 Bacteria 1142
331 Ga0307516_10992027 3300031730 Bacteria 512
332 Ga0307405_10006547 3300031731 Bacteria 5739
333 Ga0307405_11045951 3300031731 Bacteria 699
334 Ga0307405_11719481 3300031731 Bacteria 556
335 Ga0307405_11790130 3300031731 Bacteria 546
336 Ga0307413_10094755 3300031824 Bacteria 1955
337 Ga0307413_10893459 3300031824 Bacteria 754
338 Ga0307410_10009817 3300031852 Bacteria 5391
339 Ga0307406_10034996 3300031901 Bacteria 3085
340 Ga0307406_10130243 3300031901 Bacteria 1765
341 Ga0307407_11442634 3300031903 Bacteria 543
342 Ga0307407_11519413 3300031903 Bacteria 530
343 Ga0307412_10018914 3300031911 Bacteria 4158
344 Ga0307412_11811467 3300031911 Bacteria 562
345 Ga0307409_100094217 3300031995 Bacteria 2463
346 Ga0307409_100255757 3300031995 Bacteria 1604
347 Ga0307409_100974702 3300031995 Unclassified 865
348 Ga0307409_102068661 3300031995 Bacteria 599
349 Ga0307416_100088088 3300032002 Bacteria 2653
350 Ga0307416_100289497 3300032002 Bacteria 1621
351 Ga0307416_100596078 3300032002 Bacteria 1184
352 Ga0307416_101923630 3300032002 Bacteria 695
353 Ga0307414_10332404 3300032004 Bacteria 1298
354 Ga0307414_10772426 3300032004 Bacteria 875
355 Ga0307411_10048663 3300032005 Bacteria 2749
356 Ga0307510_10026627 3300033180 Bacteria 6642
357 Ga0373949_0045977 3300035090 Bacteria 1087
358 Ga0373943_0031464 3300035170 Bacteria 2518
359 Ga0373937_0956821 3300036401 Bacteria 805
360 Ga0373925_0533137 3300037068 Bacteria 965
361 Ga0395900_0854249 3300037418 Bacteria 835
362 Ga0395898_0060715 3300037466 Bacteria 3673
363 Ga0395898_1309763 3300037466 Bacteria 654
364 Ga0395905_0005832 3300037471 Bacteria 12515
365 Ga0395905_0013446 3300037471 Bacteria 7843
366 Ga0395905_0016819 3300037471 Bacteria 6948
367 Ga0395905_0022443 3300037471 Bacteria 5968
368 Ga0395905_0059190 3300037471 Bacteria 3581
369 Ga0395905_0153068 3300037471 Bacteria 2169
370 Ga0395905_0738319 3300037471 Bacteria 887
371 Ga0395901_0182741 3300038443 Bacteria 2199
372 Ga0395901_0321737 3300038443 Bacteria 1600
373 Ga0395901_0601977 3300038443 Bacteria 1108
374 Ga0436365_0896739 3300039437 Bacteria 681
375 Ga0436361_0433203 3300039447 Bacteria 1008
376 Ga0439436_0257052 3300041404 Bacteria 508
377 Ga0439447_053273 3300041407 Bacteria 962
378 Ga0439453_0062415 3300041408 Bacteria 774
379 Ga0451807_0498778 3300041486 Bacteria 741
380 Ga0439433_0036043 3300041999 Bacteria 1142
381 Ga0439450_201726 3300042008 Bacteria 532
382 Ga0439462_0176408 3300042015 Bacteria 605
383 Ga0450896_040334 3300042133 Bacteria 726
384 Ga0450896_056146 3300042133 Bacteria 635
385 Ga0450898_010021 3300042134 Bacteria 1528
386 Ga0450899_035447 3300042135 Bacteria 615
387 Ga0439464_0173908 3300042439 Bacteria 680
388 Ga0439460_0298363 3300042461 Bacteria 563
389 Ga0451577_0002119 3300042876 Bacteria 24405
390 Ga0451577_0010535 3300042876 Bacteria 8822
391 Ga0451577_0403684 3300042876 Bacteria 1240
392 Ga0451577_0673217 3300042876 Bacteria 938
393 Ga0466972_0183983 3300044658 Bacteria 979
394 Ga0453683_0089346 3300044673 Bacteria 1931
395 Ga0453683_0283795 3300044673 Bacteria 1058
396 Ga0466965_0090831 3300044683 Bacteria 1553
397 Ga0466961_0319434 3300044693 Bacteria 947
398 Ga0453684_0005559 3300044712 Bacteria 24865
399 Ga0453684_0157014 3300044712 Bacteria 2695
400 Ga0466968_0014664 3300044735 Bacteria 3099
401 Ga0466968_0578974 3300044735 Bacteria 565
402 Ga0466957_0497146 3300044842 Bacteria 845
403 Ga0466957_0532457 3300044842 Unclassified 817
404 Ga0466960_0936628 3300044901 Bacteria 530
405 Ga0451576_0003324 3300045051 Bacteria 22289
406 Ga0451576_0114403 3300045051 Bacteria 2808
407 Ga0451576_0234298 3300045051 Bacteria 1917
408 Ga0451576_0543133 3300045051 Bacteria 1221
409 Ga0466958_0439793 3300045836 Bacteria 844
410 Ga0495592_0651314 3300046454 Bacteria 638
411 Ga0495629_0821257 3300046459 Bacteria 612
412 Ga0495638_0530940 3300046460 Bacteria 588
413 Ga0495641_0246597 3300046461 Bacteria 803
414 Ga0495650_0060529 3300046471 Bacteria 1520
415 Ga0495580_0807912 3300046472 Bacteria 608
416 Ga0495583_0184829 3300046506 Bacteria 852
417 Ga0495606_0243764 3300046507 Bacteria 1001
418 Ga0495610_0200309 3300046512 Bacteria 818
419 Ga0495616_0090863 3300046513 Bacteria 1446
420 Ga0495620_0095232 3300046515 Bacteria 1191
421 Ga0495632_0007745 3300046519 Bacteria 6701
422 Ga0495632_0333567 3300046519 Bacteria 668
423 Ga0495642_0228548 3300046528 Bacteria 813
424 Ga0495654_0393360 3300046530 Bacteria 551
425 Ga0495621_0066745 3300046539 Bacteria 1317
426 Ga0495621_0303791 3300046539 Bacteria 662
427 Ga0495597_0062371 3300046542 Bacteria 1622
428 Ga0495645_0859374 3300046543 Bacteria 541
429 Ga0495625_0156033 3300046660 Bacteria 1532
430 Ga0495646_0620580 3300046680 Bacteria 548
431 Ga0495658_0145588 3300046683 Bacteria 1452
432 Ga0495671_0207850 3300046692 Bacteria 949
433 Ga0495671_0439485 3300046692 Bacteria 624
434 Ga0495649_0004724 3300046694 Bacteria 8839
435 Ga0495649_0163446 3300046694 Bacteria 1167
436 Ga0495687_000594 3300047443 Bacteria 42250
437 Ga0495687_005079 3300047443 Bacteria 8539
438 Ga0495687_006945 3300047443 Bacteria 6806
439 Ga0495675_0632002 3300047444 Bacteria 605
440 Ga0495626_0026314 3300048091 Bacteria 2837
441 Ga0496100_0340530 3300048903 Bacteria 1131
442 Ga0496102_0989300 3300048905 Bacteria 762
443 Ga0496104_0272846 3300048907 Bacteria 1604
444 Ga0496104_0284257 3300048907 Bacteria 1567
445 Ga0496105_0272040 3300048908 Bacteria 1368
446 Ga0496106_0650073 3300048909 Bacteria 842
447 Ga0496107_1278102 3300048910 Bacteria 525
448 Ga0496108_0322469 3300048911 Bacteria 1347
449 Ga0496108_0402422 3300048911 Bacteria 1196
450 Ga0496109_0128519 3300048912 Bacteria 2364
451 Ga0496109_1796616 3300048912 Bacteria 546
452 Ga0496112_1044640 3300048915 Bacteria 736
453 Ga0496113_0674018 3300048916 Bacteria 826
454 Ga0496121_0026536 3300048924 Bacteria 5454
455 Ga0496123_0466147 3300048926 Bacteria 559
456 Ga0496124_0466928 3300048927 Bacteria 856
457 Ga0496125_0564286 3300048928 Bacteria 628
458 Ga0496126_0242250 3300048929 Bacteria 1506
459 Ga0501031_1021239 3300049568 Bacteria 528
460 Ga0501034_0580013 3300049571 Bacteria 1028
461 Ga0501038_1202377 3300049574 Bacteria 550
462 Ga0501039_0845381 3300049575 Bacteria 713
463 Ga0501041_0861602 3300049577 Bacteria 582
464 Ga0501043_0022740 3300049579 Bacteria 4917
465 Ga0501046_0275162 3300049580 Bacteria 1234
466 Ga0501073_0540358 3300049589 Bacteria 805
467 Ga0501225_0065496 3300049705 Bacteria 1027
468 Ga0501080_0093134 3300049742 Bacteria 2798
469 Ga0501281_04327 3300049777 Bacteria 999
470 Ga0501035_0207821 3300049822 Bacteria 1676
471 Ga0501044_0074406 3300049823 Bacteria 3451
472 nmdc:mga03683_488978_c1 3300050489 Bacteria 595
473 nmdc:mga03683_9019_c1 3300050489 Bacteria 3529
474 nmdc:mga03n38_208033_c1 3300050490 Bacteria 1016
475 nmdc:mga00v17_319009_c1 3300050491 Bacteria 1010
476 nmdc:mga0yw44_47259_c1 3300050492 Bacteria 2589
477 nmdc:mga0k408_103026_c1 3300050493 Bacteria 1684
478 nmdc:mga0k408_120188_c1 3300050493 Bacteria 1556
479 nmdc:mga0k408_236051_c1 3300050493 Bacteria 1092
480 nmdc:mga0k408_24186_c1 3300050493 Bacteria 2706
481 nmdc:mga0k408_302552_c1 3300050493 Bacteria 954
482 nmdc:mga0k408_362386_c1 3300050493 Bacteria 864
483 nmdc:mga0k408_39853_c1 3300050493 Bacteria 2701
484 nmdc:mga0k408_9344_c1 3300050493 Bacteria 5283
485 nmdc:mga06z11_248091_c1 3300050494 Bacteria 1048
486 nmdc:mga04h51_328945_c1 3300050495 Bacteria 628
487 nmdc:mga04h51_70965_c1 3300050495 Bacteria 1216
488 nmdc:mga07m45_14664_c2 3300050496 Bacteria 1700
489 nmdc:mga07m45_172542_c1 3300050496 Bacteria 1257
490 nmdc:mga07m45_2545_c1 3300050496 Bacteria 8561
491 nmdc:mga07m45_544471_c1 3300050496 Bacteria 671
492 nmdc:mga07m45_9585_c1 3300050496 Bacteria 5031
493 nmdc:mga0sz30_3098_c1 3300050516 Bacteria 5961
494 Ga0495601_0475858 3300053077 Bacteria 807
495 Ga0495595_0260151 3300053084 Bacteria 870
496 Ga0500578_0035984 3300053086 Bacteria 3181
497 Ga0500647_0056143 3300053091 Bacteria 1894
498 Ga0500583_0275119 3300053092 Bacteria 828
499 Ga0500651_0701111 3300053093 Bacteria 541
500 Ga0500652_179682 3300053131 Bacteria 867
501 Ga0500658_0008541 3300053134 Bacteria 3783
502 Ga0500568_0028846 3300053139 Bacteria 2310
503 Ga0500590_020753 3300053148 Bacteria 3410
504 Ga0500645_002406 3300053730 Bacteria 8396

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10992027 Ga0307516_109920271 79
2 3300006195 Ga0075366_10120695 Ga0075366_101206952 86
3 3300050489 nmdc:mga03683_488978_c1 nmdc:mga03683_488978_c1_39_317 86
4 3300050493 nmdc:mga0k408_236051_c1 nmdc:mga0k408_236051_c1_188_466 86
5 3300046507 Ga0495606_0243764 Ga0495606_0243764_21_353 87
6 3300053091 Ga0500647_0056143 Ga0500647_0056143_124_456 87
7 3300053131 Ga0500652_179682 Ga0500652_179682_65_397 87
8 iso_pu_bacteria 2643221654 2644304274 87
9 3300012478 Ga0157328_1020915 Ga0157328_10209151 88
10 3300048911 Ga0496108_0322469 Ga0496108_0322469_393_659 88
11 3300048912 Ga0496109_1796616 Ga0496109_1796616_192_458 88
12 3300049777 Ga0501281_04327 Ga0501281_04327_267_536 88
13 3300009148 Ga0105243_12768758 Ga0105243_127687582 89
14 3300014326 Ga0157380_12317556 Ga0157380_123175562 89
15 3300025935 Ga0207709_10831846 Ga0207709_108318462 89
16 3300031730 Ga0307516_10014242 Ga0307516_100142426 89
17 3300031730 Ga0307516_10299808 Ga0307516_102998082 89
18 3300031911 Ga0307412_11811467 Ga0307412_118114672 89
19 3300037418 Ga0395900_0854249 Ga0395900_0854249_167_442 89
20 3300037466 Ga0395898_0060715 Ga0395898_0060715_1891_2166 89
21 3300037466 Ga0395898_1309763 Ga0395898_1309763_238_513 89
22 3300037471 Ga0395905_0022443 Ga0395905_0022443_2003_2278 89
23 3300037471 Ga0395905_0059190 Ga0395905_0059190_1666_1941 89
24 3300038443 Ga0395901_0182741 Ga0395901_0182741_1651_1926 89
25 3300038443 Ga0395901_0321737 Ga0395901_0321737_92_367 89
26 3300038443 Ga0395901_0601977 Ga0395901_0601977_359_634 89
27 3300042876 Ga0451577_0002119 Ga0451577_0002119_21592_21867 89
28 3300042876 Ga0451577_0010535 Ga0451577_0010535_208_483 89
29 3300042876 Ga0451577_0673217 Ga0451577_0673217_491_766 89
30 3300044673 Ga0453683_0089346 Ga0453683_0089346_1422_1697 89
31 3300044693 Ga0466961_0319434 Ga0466961_0319434_299_574 89
32 3300044712 Ga0453684_0157014 Ga0453684_0157014_174_449 89
33 3300044735 Ga0466968_0578974 Ga0466968_0578974_53_328 89
34 3300044842 Ga0466957_0497146 Ga0466957_0497146_374_649 89
35 3300045051 Ga0451576_0003324 Ga0451576_0003324_3017_3292 89
36 3300045051 Ga0451576_0543133 Ga0451576_0543133_871_1146 89
37 3300045836 Ga0466958_0439793 Ga0466958_0439793_123_398 89
38 3300046515 Ga0495620_0095232 Ga0495620_0095232_345_638 89
39 3300048929 Ga0496126_0242250 Ga0496126_0242250_440_709 89
40 3300049568 Ga0501031_1021239 Ga0501031_1021239_177_452 89
41 3300049571 Ga0501034_0580013 Ga0501034_0580013_522_797 89
42 3300049574 Ga0501038_1202377 Ga0501038_1202377_182_457 89
43 3300049575 Ga0501039_0845381 Ga0501039_0845381_85_360 89
44 3300049579 Ga0501043_0022740 Ga0501043_0022740_144_419 89
45 3300049580 Ga0501046_0275162 Ga0501046_0275162_908_1183 89
46 3300049589 Ga0501073_0540358 Ga0501073_0540358_445_720 89
47 3300049742 Ga0501080_0093134 Ga0501080_0093134_2513_2788 89
48 3300049823 Ga0501044_0074406 Ga0501044_0074406_2960_3235 89
49 3300005328 Ga0070676_10109878 Ga0070676_101098781 90
50 3300005335 Ga0070666_11447756 Ga0070666_114477561 90
51 3300005364 Ga0070673_101164537 Ga0070673_1011645371 90
52 3300005367 Ga0070667_100799424 Ga0070667_1007994242 90
53 3300005438 Ga0070701_10978897 Ga0070701_109788971 90
54 3300005543 Ga0070672_100205866 Ga0070672_1002058662 90
55 3300005616 Ga0068852_101263879 Ga0068852_1012638792 90
56 3300005618 Ga0068864_100987047 Ga0068864_1009870472 90
57 3300005719 Ga0068861_100467466 Ga0068861_1004674662 90
58 3300009093 Ga0105240_10038063 Ga0105240_100380634 90
59 3300009545 Ga0105237_10003466 Ga0105237_1000346620 90
60 3300009551 Ga0105238_10007665 Ga0105238_100076654 90
61 3300010375 Ga0105239_10003789 Ga0105239_100037898 90
62 3300025893 Ga0207682_10152401 Ga0207682_101524012 90
63 3300025903 Ga0207680_10809214 Ga0207680_108092142 90
64 3300025913 Ga0207695_10031173 Ga0207695_100311736 90
65 3300025914 Ga0207671_10005697 Ga0207671_1000569713 90
66 3300025918 Ga0207662_10460817 Ga0207662_104608171 90
67 3300025924 Ga0207694_10024013 Ga0207694_100240135 90
68 3300025932 Ga0207690_10915932 Ga0207690_109159322 90
69 3300025933 Ga0207706_11312454 Ga0207706_113124542 90
70 3300025940 Ga0207691_10157816 Ga0207691_101578164 90
71 3300025942 Ga0207689_11328193 Ga0207689_113281932 90
72 3300026116 Ga0207674_11187737 Ga0207674_111877371 90
73 3300026118 Ga0207675_101100613 Ga0207675_1011006132 90
74 3300026121 Ga0207683_10013159 Ga0207683_100131599 90
75 3300026142 Ga0207698_11415505 Ga0207698_114155052 90
76 3300027665 Ga0209983_1007828 Ga0209983_10078283 90
77 3300028379 Ga0268266_10338942 Ga0268266_103389422 90
78 3300031548 Ga0307408_102289692 Ga0307408_1022896922 90
79 3300031903 Ga0307407_11442634 Ga0307407_114426342 90
80 3300037471 Ga0395905_0013446 Ga0395905_0013446_1989_2261 90
81 3300037471 Ga0395905_0153068 Ga0395905_0153068_361_633 90
82 3300039447 Ga0436361_0433203 Ga0436361_0433203_501_773 90
83 3300041404 Ga0439436_0257052 Ga0439436_0257052_37_309 90
84 3300041407 Ga0439447_053273 Ga0439447_053273_628_900 90
85 3300041408 Ga0439453_0062415 Ga0439453_0062415_460_732 90
86 3300041999 Ga0439433_0036043 Ga0439433_0036043_67_339 90
87 3300042008 Ga0439450_201726 Ga0439450_201726_221_493 90
88 3300042015 Ga0439462_0176408 Ga0439462_0176408_175_447 90
89 3300042133 Ga0450896_040334 Ga0450896_040334_64_336 90
90 3300042134 Ga0450898_010021 Ga0450898_010021_1146_1418 90
91 3300042135 Ga0450899_035447 Ga0450899_035447_184_456 90
92 3300042439 Ga0439464_0173908 Ga0439464_0173908_109_381 90
93 3300042461 Ga0439460_0298363 Ga0439460_0298363_255_527 90
94 3300002067 JGI24735J21928_10118798 JGI24735J21928_101187981 91
95 3300002077 JGI24744J21845_10016073 JGI24744J21845_100160732 91
96 3300003316 rootH1_10054985 rootH1_100549851 91
97 3300003322 rootL2_10072117 rootL2_100721173 91
98 3300005290 Ga0065712_10331152 Ga0065712_103311522 91
99 3300005327 Ga0070658_10994249 Ga0070658_109942492 91
100 3300005328 Ga0070676_10013248 Ga0070676_100132482 91
101 3300005328 Ga0070676_10108703 Ga0070676_101087032 91
102 3300005331 Ga0070670_100016116 Ga0070670_1000161164 91
103 3300005331 Ga0070670_100097990 Ga0070670_1000979902 91
104 3300005331 Ga0070670_100407023 Ga0070670_1004070232 91
105 3300005331 Ga0070670_100615502 Ga0070670_1006155022 91
106 3300005331 Ga0070670_101911403 Ga0070670_1019114032 91
107 3300005333 Ga0070677_10001548 Ga0070677_100015486 91
108 3300005333 Ga0070677_10034968 Ga0070677_100349682 91
109 3300005333 Ga0070677_10859805 Ga0070677_108598051 91
110 3300005334 Ga0068869_100013561 Ga0068869_1000135617 91
111 3300005334 Ga0068869_100027665 Ga0068869_1000276652 91
112 3300005334 Ga0068869_100227886 Ga0068869_1002278862 91
113 3300005335 Ga0070666_10079225 Ga0070666_100792252 91
114 3300005335 Ga0070666_10381535 Ga0070666_103815352 91
115 3300005338 Ga0068868_100081103 Ga0068868_1000811032 91
116 3300005338 Ga0068868_100097025 Ga0068868_1000970252 91
117 3300005338 Ga0068868_100308469 Ga0068868_1003084692 91
118 3300005338 Ga0068868_100553922 Ga0068868_1005539222 91
119 3300005340 Ga0070689_100034512 Ga0070689_1000345122 91
120 3300005343 Ga0070687_100848806 Ga0070687_1008488061 91
121 3300005344 Ga0070661_100778719 Ga0070661_1007787192 91
122 3300005347 Ga0070668_101611612 Ga0070668_1016116122 91
123 3300005353 Ga0070669_100006105 Ga0070669_1000061052 91
124 3300005353 Ga0070669_100518398 Ga0070669_1005183982 91
125 3300005354 Ga0070675_100005184 Ga0070675_1000051849 91
126 3300005354 Ga0070675_100019867 Ga0070675_1000198671 91
127 3300005354 Ga0070675_100047712 Ga0070675_1000477124 91
128 3300005355 Ga0070671_100021133 Ga0070671_1000211335 91
129 3300005355 Ga0070671_100040868 Ga0070671_1000408682 91
130 3300005355 Ga0070671_100081753 Ga0070671_1000817532 91
131 3300005355 Ga0070671_100479630 Ga0070671_1004796302 91
132 3300005356 Ga0070674_100008300 Ga0070674_1000083003 91
133 3300005356 Ga0070674_100030634 Ga0070674_1000306342 91
134 3300005356 Ga0070674_100820464 Ga0070674_1008204642 91
135 3300005364 Ga0070673_100005136 Ga0070673_1000051362 91
136 3300005364 Ga0070673_100072711 Ga0070673_1000727111 91
137 3300005364 Ga0070673_100261577 Ga0070673_1002615772 91
138 3300005364 Ga0070673_101919759 Ga0070673_1019197592 91
139 3300005364 Ga0070673_102138282 Ga0070673_1021382821 91
140 3300005364 Ga0070673_102162897 Ga0070673_1021628971 91
141 3300005365 Ga0070688_100068326 Ga0070688_1000683262 91
142 3300005365 Ga0070688_100771805 Ga0070688_1007718051 91
143 3300005366 Ga0070659_101073669 Ga0070659_1010736692 91
144 3300005366 Ga0070659_101784626 Ga0070659_1017846262 91
145 3300005367 Ga0070667_100001171 Ga0070667_1000011717 91
146 3300005367 Ga0070667_100043049 Ga0070667_1000430495 91
147 3300005367 Ga0070667_100089205 Ga0070667_1000892052 91
148 3300005367 Ga0070667_100218662 Ga0070667_1002186622 91
149 3300005441 Ga0070700_101650069 Ga0070700_1016500692 91
150 3300005441 Ga0070700_101941073 Ga0070700_1019410732 91
151 3300005445 Ga0070708_100148628 Ga0070708_1001486284 91
152 3300005455 Ga0070663_100562612 Ga0070663_1005626121 91
153 3300005455 Ga0070663_101018736 Ga0070663_1010187361 91
154 3300005456 Ga0070678_100001334 Ga0070678_1000013348 91
155 3300005456 Ga0070678_100009607 Ga0070678_1000096074 91
156 3300005456 Ga0070678_102108049 Ga0070678_1021080491 91
157 3300005457 Ga0070662_100082775 Ga0070662_1000827752 91
158 3300005457 Ga0070662_100612187 Ga0070662_1006121871 91
159 3300005459 Ga0068867_100000815 Ga0068867_1000008159 91
160 3300005459 Ga0068867_100002841 Ga0068867_10000284116 91
161 3300005459 Ga0068867_100002971 Ga0068867_1000029715 91
162 3300005459 Ga0068867_100032757 Ga0068867_1000327572 91
163 3300005459 Ga0068867_100139769 Ga0068867_1001397691 91
164 3300005459 Ga0068867_100814912 Ga0068867_1008149122 91
165 3300005471 Ga0070698_101658556 Ga0070698_1016585562 91
166 3300005539 Ga0068853_102166775 Ga0068853_1021667751 91
167 3300005543 Ga0070672_100002062 Ga0070672_1000020629 91
168 3300005543 Ga0070672_100010713 Ga0070672_1000107135 91
169 3300005543 Ga0070672_100062465 Ga0070672_1000624654 91
170 3300005547 Ga0070693_100527632 Ga0070693_1005276322 91
171 3300005548 Ga0070665_100129996 Ga0070665_1001299962 91
172 3300005548 Ga0070665_100471710 Ga0070665_1004717102 91
173 3300005564 Ga0070664_100502390 Ga0070664_1005023902 91
174 3300005564 Ga0070664_100817428 Ga0070664_1008174282 91
175 3300005577 Ga0068857_100025437 Ga0068857_1000254372 91
176 3300005578 Ga0068854_100143833 Ga0068854_1001438332 91
177 3300005578 Ga0068854_100192091 Ga0068854_1001920912 91
178 3300005614 Ga0068856_100059001 Ga0068856_1000590016 91
179 3300005615 Ga0070702_101028629 Ga0070702_1010286292 91
180 3300005615 Ga0070702_101164237 Ga0070702_1011642372 91
181 3300005616 Ga0068852_100138634 Ga0068852_1001386345 91
182 3300005616 Ga0068852_100601482 Ga0068852_1006014822 91
183 3300005616 Ga0068852_101659834 Ga0068852_1016598341 91
184 3300005617 Ga0068859_100002636 Ga0068859_1000026364 91
185 3300005618 Ga0068864_100020879 Ga0068864_1000208795 91
186 3300005618 Ga0068864_101195822 Ga0068864_1011958222 91
187 3300005718 Ga0068866_10119073 Ga0068866_101190733 91
188 3300005718 Ga0068866_10695891 Ga0068866_106958911 91
189 3300005718 Ga0068866_11402184 Ga0068866_114021842 91
190 3300005834 Ga0068851_10104658 Ga0068851_101046581 91
191 3300005840 Ga0068870_10042666 Ga0068870_100426662 91
192 3300005840 Ga0068870_10261700 Ga0068870_102617002 91
193 3300005841 Ga0068863_100147201 Ga0068863_1001472014 91
194 3300005841 Ga0068863_100326675 Ga0068863_1003266752 91
195 3300005842 Ga0068858_100054908 Ga0068858_1000549083 91
196 3300005843 Ga0068860_100478813 Ga0068860_1004788132 91
197 3300005843 Ga0068860_100536719 Ga0068860_1005367193 91
198 3300006038 Ga0075365_10253693 Ga0075365_102536932 91
199 3300006042 Ga0075368_10024067 Ga0075368_100240674 91
200 3300006042 Ga0075368_10223723 Ga0075368_102237232 91
201 3300006048 Ga0075363_100187176 Ga0075363_1001871762 91
202 3300006051 Ga0075364_10322521 Ga0075364_103225212 91
203 3300006163 Ga0070715_10062786 Ga0070715_100627862 91
204 3300006177 Ga0075362_10037524 Ga0075362_100375243 91
205 3300006177 Ga0075362_10088534 Ga0075362_100885342 91
206 3300006177 Ga0075362_10359198 Ga0075362_103591982 91
207 3300006178 Ga0075367_10224977 Ga0075367_102249772 91
208 3300006186 Ga0075369_10010341 Ga0075369_100103414 91
209 3300006195 Ga0075366_10010236 Ga0075366_100102364 91
210 3300006195 Ga0075366_10015142 Ga0075366_100151424 91
211 3300006195 Ga0075366_10020898 Ga0075366_100208982 91
212 3300006195 Ga0075366_10028358 Ga0075366_100283584 91
213 3300006195 Ga0075366_10059108 Ga0075366_100591084 91
214 3300006195 Ga0075366_10299438 Ga0075366_102994382 91
215 3300006195 Ga0075366_10425129 Ga0075366_104251292 91
216 3300006237 Ga0097621_100083076 Ga0097621_1000830762 91
217 3300006237 Ga0097621_101813521 Ga0097621_1018135212 91
218 3300006353 Ga0075370_10006318 Ga0075370_100063184 91
219 3300006353 Ga0075370_10037650 Ga0075370_100376503 91
220 3300006353 Ga0075370_10152705 Ga0075370_101527052 91
221 3300006353 Ga0075370_10578672 Ga0075370_105786722 91
222 3300006358 Ga0068871_100040812 Ga0068871_1000408123 91
223 3300006358 Ga0068871_100141677 Ga0068871_1001416773 91
224 3300006358 Ga0068871_100769809 Ga0068871_1007698091 91
225 3300006852 Ga0075433_11596371 Ga0075433_115963711 91
226 3300006881 Ga0068865_100335970 Ga0068865_1003359702 91
227 3300006881 Ga0068865_100493325 Ga0068865_1004933252 91
228 3300006881 Ga0068865_100644583 Ga0068865_1006445832 91
229 3300006931 Ga0097620_100002636 Ga0097620_1000026364 91
230 3300009094 Ga0111539_10282788 Ga0111539_102827882 91
231 3300009098 Ga0105245_10122662 Ga0105245_101226622 91
232 3300009098 Ga0105245_10256066 Ga0105245_102560661 91
233 3300009098 Ga0105245_11718666 Ga0105245_117186662 91
234 3300009148 Ga0105243_10039925 Ga0105243_100399255 91
235 3300009148 Ga0105243_10187471 Ga0105243_101874712 91
236 3300009176 Ga0105242_10513252 Ga0105242_105132522 91
237 3300009176 Ga0105242_11260373 Ga0105242_112603731 91
238 3300009177 Ga0105248_10138031 Ga0105248_101380314 91
239 3300009177 Ga0105248_11033921 Ga0105248_110339212 91
240 3300009177 Ga0105248_11782569 Ga0105248_117825692 91
241 3300009553 Ga0105249_13423643 Ga0105249_134236432 91
242 3300011119 Ga0105246_11142978 Ga0105246_111429781 91
243 3300012513 Ga0157326_1044290 Ga0157326_10442902 91
244 3300013296 Ga0157374_10121407 Ga0157374_101214072 91
245 3300013296 Ga0157374_10538658 Ga0157374_105386581 91
246 3300013297 Ga0157378_10078498 Ga0157378_100784981 91
247 3300013297 Ga0157378_10574474 Ga0157378_105744742 91
248 3300013297 Ga0157378_10625617 Ga0157378_106256172 91
249 3300013306 Ga0163162_10028472 Ga0163162_100284726 91
250 3300013306 Ga0163162_10052435 Ga0163162_100524355 91
251 3300013306 Ga0163162_12172092 Ga0163162_121720921 91
252 3300013307 Ga0157372_10114235 Ga0157372_101142352 91
253 3300013308 Ga0157375_10039345 Ga0157375_100393456 91
254 3300013308 Ga0157375_10056327 Ga0157375_100563272 91
255 3300013308 Ga0157375_10237311 Ga0157375_102373112 91
256 3300013308 Ga0157375_11101949 Ga0157375_111019492 91
257 3300014325 Ga0163163_10083873 Ga0163163_100838735 91
258 3300014325 Ga0163163_11303849 Ga0163163_113038491 91
259 3300014745 Ga0157377_10000382 Ga0157377_1000038215 91
260 3300014745 Ga0157377_10260105 Ga0157377_102601052 91
261 3300014968 Ga0157379_10013894 Ga0157379_100138946 91
262 3300014968 Ga0157379_10016805 Ga0157379_100168058 91
263 3300014969 Ga0157376_10051337 Ga0157376_100513375 91
264 3300014969 Ga0157376_10327596 Ga0157376_103275962 91
265 3300014969 Ga0157376_10361085 Ga0157376_103610852 91
266 3300014969 Ga0157376_10745023 Ga0157376_107450232 91
267 3300014969 Ga0157376_12148946 Ga0157376_121489462 91
268 3300017792 Ga0163161_10051865 Ga0163161_100518655 91
269 3300017792 Ga0163161_10589238 Ga0163161_105892382 91
270 3300021384 Ga0213876_10361896 Ga0213876_103618962 91
271 3300025290 Ga0207673_1018564 Ga0207673_10185642 91
272 3300025315 Ga0207697_10019486 Ga0207697_100194862 91
273 3300025321 Ga0207656_10111072 Ga0207656_101110723 91
274 3300025893 Ga0207682_10001523 Ga0207682_100015239 91
275 3300025893 Ga0207682_10060765 Ga0207682_100607652 91
276 3300025899 Ga0207642_10051757 Ga0207642_100517573 91
277 3300025903 Ga0207680_10325724 Ga0207680_103257243 91
278 3300025903 Ga0207680_10936756 Ga0207680_109367562 91
279 3300025905 Ga0207685_10243966 Ga0207685_102439662 91
280 3300025907 Ga0207645_10012119 Ga0207645_100121194 91
281 3300025907 Ga0207645_10388407 Ga0207645_103884072 91
282 3300025908 Ga0207643_10049838 Ga0207643_100498384 91
283 3300025908 Ga0207643_10057915 Ga0207643_100579152 91
284 3300025909 Ga0207705_11075391 Ga0207705_110753911 91
285 3300025920 Ga0207649_10192674 Ga0207649_101926742 91
286 3300025921 Ga0207652_10994093 Ga0207652_109940932 91
287 3300025923 Ga0207681_10049977 Ga0207681_100499774 91
288 3300025923 Ga0207681_10409725 Ga0207681_104097251 91
289 3300025925 Ga0207650_10002460 Ga0207650_100024605 91
290 3300025925 Ga0207650_10290755 Ga0207650_102907552 91
291 3300025925 Ga0207650_11402653 Ga0207650_114026532 91
292 3300025925 Ga0207650_11911347 Ga0207650_119113472 91
293 3300025926 Ga0207659_10006295 Ga0207659_100062959 91
294 3300025926 Ga0207659_10009925 Ga0207659_100099256 91
295 3300025926 Ga0207659_10049091 Ga0207659_100490913 91
296 3300025927 Ga0207687_10053973 Ga0207687_100539734 91
297 3300025927 Ga0207687_10075296 Ga0207687_100752962 91
298 3300025931 Ga0207644_10020354 Ga0207644_100203543 91
299 3300025931 Ga0207644_10042428 Ga0207644_100424283 91
300 3300025931 Ga0207644_10049561 Ga0207644_100495614 91
301 3300025931 Ga0207644_10219693 Ga0207644_102196933 91
302 3300025932 Ga0207690_11051311 Ga0207690_110513111 91
303 3300025933 Ga0207706_10069481 Ga0207706_100694812 91
304 3300025933 Ga0207706_10495191 Ga0207706_104951912 91
305 3300025934 Ga0207686_10530889 Ga0207686_105308892 91
306 3300025935 Ga0207709_10011879 Ga0207709_100118794 91
307 3300025936 Ga0207670_10035459 Ga0207670_100354594 91
308 3300025937 Ga0207669_10014898 Ga0207669_100148982 91
309 3300025937 Ga0207669_10115308 Ga0207669_101153081 91
310 3300025937 Ga0207669_11367081 Ga0207669_113670812 91
311 3300025938 Ga0207704_10153063 Ga0207704_101530632 91
312 3300025938 Ga0207704_10279301 Ga0207704_102793012 91
313 3300025940 Ga0207691_10006082 Ga0207691_100060825 91
314 3300025940 Ga0207691_10007915 Ga0207691_100079158 91
315 3300025940 Ga0207691_10106713 Ga0207691_101067133 91
316 3300025941 Ga0207711_10304445 Ga0207711_103044452 91
317 3300025941 Ga0207711_10349411 Ga0207711_103494112 91
318 3300025942 Ga0207689_10014824 Ga0207689_100148244 91
319 3300025942 Ga0207689_10315909 Ga0207689_103159093 91
320 3300025942 Ga0207689_10830249 Ga0207689_108302492 91
321 3300025945 Ga0207679_10274408 Ga0207679_102744082 91
322 3300025945 Ga0207679_10816817 Ga0207679_108168172 91
323 3300025960 Ga0207651_10006687 Ga0207651_100066872 91
324 3300025960 Ga0207651_10022563 Ga0207651_100225634 91
325 3300025960 Ga0207651_10037495 Ga0207651_100374952 91
326 3300025972 Ga0207668_11106709 Ga0207668_111067092 91
327 3300025972 Ga0207668_11329276 Ga0207668_113292761 91
328 3300025981 Ga0207640_10082009 Ga0207640_100820091 91
329 3300025981 Ga0207640_11658197 Ga0207640_116581971 91
330 3300025986 Ga0207658_10000959 Ga0207658_100009597 91
331 3300025986 Ga0207658_10034313 Ga0207658_100343133 91
332 3300025986 Ga0207658_10087064 Ga0207658_100870642 91
333 3300025986 Ga0207658_10403408 Ga0207658_104034082 91
334 3300026023 Ga0207677_10072104 Ga0207677_100721042 91
335 3300026023 Ga0207677_10092228 Ga0207677_100922282 91
336 3300026023 Ga0207677_10219121 Ga0207677_102191212 91
337 3300026023 Ga0207677_10823507 Ga0207677_108235072 91
338 3300026035 Ga0207703_10206014 Ga0207703_102060142 91
339 3300026067 Ga0207678_10014055 Ga0207678_100140557 91
340 3300026067 Ga0207678_10133793 Ga0207678_101337931 91
341 3300026067 Ga0207678_10670291 Ga0207678_106702912 91
342 3300026067 Ga0207678_11489161 Ga0207678_114891611 91
343 3300026075 Ga0207708_10496898 Ga0207708_104968982 91
344 3300026075 Ga0207708_10870744 Ga0207708_108707441 91
345 3300026078 Ga0207702_10241988 Ga0207702_102419882 91
346 3300026088 Ga0207641_10049902 Ga0207641_100499023 91
347 3300026088 Ga0207641_10112479 Ga0207641_101124794 91
348 3300026088 Ga0207641_10377263 Ga0207641_103772632 91
349 3300026089 Ga0207648_10002629 Ga0207648_100026297 91
350 3300026089 Ga0207648_10002848 Ga0207648_100028482 91
351 3300026089 Ga0207648_10010781 Ga0207648_100107819 91
352 3300026089 Ga0207648_10097960 Ga0207648_100979604 91
353 3300026089 Ga0207648_10105316 Ga0207648_101053162 91
354 3300026089 Ga0207648_10823793 Ga0207648_108237931 91
355 3300026095 Ga0207676_10015099 Ga0207676_100150995 91
356 3300026095 Ga0207676_10026609 Ga0207676_100266094 91
357 3300026116 Ga0207674_10008218 Ga0207674_100082185 91
358 3300026116 Ga0207674_10372743 Ga0207674_103727432 91
359 3300026116 Ga0207674_12264397 Ga0207674_122643972 91
360 3300026118 Ga0207675_101882346 Ga0207675_1018823462 91
361 3300026121 Ga0207683_10006663 Ga0207683_100066639 91
362 3300026121 Ga0207683_10052477 Ga0207683_100524772 91
363 3300026142 Ga0207698_10461291 Ga0207698_104612912 91
364 3300026142 Ga0207698_10540123 Ga0207698_105401232 91
365 3300026142 Ga0207698_12081265 Ga0207698_120812652 91
366 3300027866 Ga0209813_10024011 Ga0209813_100240112 91
367 3300027866 Ga0209813_10153977 Ga0209813_101539772 91
368 3300028379 Ga0268266_10848140 Ga0268266_108481402 91
369 3300028379 Ga0268266_11109401 Ga0268266_111094012 91
370 3300028381 Ga0268264_10092858 Ga0268264_100928584 91
371 3300028381 Ga0268264_10238395 Ga0268264_102383953 91
372 3300028786 Ga0307517_10001871 Ga0307517_100018716 91
373 3300028786 Ga0307517_10083410 Ga0307517_100834102 91
374 3300028794 Ga0307515_10000020 Ga0307515_10000020239 91
375 3300028794 Ga0307515_10036978 Ga0307515_100369782 91
376 3300028794 Ga0307515_10038740 Ga0307515_100387406 91
377 3300030522 Ga0307512_10276590 Ga0307512_102765902 91
378 3300031456 Ga0307513_10116867 Ga0307513_101168674 91
379 3300031456 Ga0307513_10119691 Ga0307513_101196913 91
380 3300031456 Ga0307513_10197218 Ga0307513_101972182 91
381 3300031507 Ga0307509_10453799 Ga0307509_104537992 91
382 3300031548 Ga0307408_100000030 Ga0307408_100000030198 91
383 3300031548 Ga0307408_100529608 Ga0307408_1005296082 91
384 3300031616 Ga0307508_10038562 Ga0307508_100385624 91
385 3300031730 Ga0307516_10000312 Ga0307516_100003122 91
386 3300031730 Ga0307516_10350336 Ga0307516_103503363 91
387 3300031731 Ga0307405_10006547 Ga0307405_100065472 91
388 3300031731 Ga0307405_11045951 Ga0307405_110459511 91
389 3300031731 Ga0307405_11719481 Ga0307405_117194811 91
390 3300031731 Ga0307405_11790130 Ga0307405_117901301 91
391 3300031824 Ga0307413_10094755 Ga0307413_100947553 91
392 3300031824 Ga0307413_10893459 Ga0307413_108934592 91
393 3300031852 Ga0307410_10009817 Ga0307410_100098176 91
394 3300031901 Ga0307406_10034996 Ga0307406_100349963 91
395 3300031901 Ga0307406_10130243 Ga0307406_101302433 91
396 3300031903 Ga0307407_11519413 Ga0307407_115194132 91
397 3300031911 Ga0307412_10018914 Ga0307412_100189145 91
398 3300031995 Ga0307409_100094217 Ga0307409_1000942172 91
399 3300031995 Ga0307409_100255757 Ga0307409_1002557572 91
400 3300031995 Ga0307409_100974702 Ga0307409_1009747022 91
401 3300031995 Ga0307409_102068661 Ga0307409_1020686611 91
402 3300032002 Ga0307416_100088088 Ga0307416_1000880884 91
403 3300032002 Ga0307416_100289497 Ga0307416_1002894972 91
404 3300032002 Ga0307416_100596078 Ga0307416_1005960783 91
405 3300032002 Ga0307416_101923630 Ga0307416_1019236301 91
406 3300032004 Ga0307414_10332404 Ga0307414_103324042 91
407 3300032004 Ga0307414_10772426 Ga0307414_107724262 91
408 3300032005 Ga0307411_10048663 Ga0307411_100486632 91
409 3300033180 Ga0307510_10026627 Ga0307510_100266274 91
410 3300035090 Ga0373949_0045977 Ga0373949_0045977_777_1055 91
411 3300035170 Ga0373943_0031464 Ga0373943_0031464_1540_1818 91
412 3300036401 Ga0373937_0956821 Ga0373937_0956821_115_393 91
413 3300037068 Ga0373925_0533137 Ga0373925_0533137_250_528 91
414 3300037471 Ga0395905_0005832 Ga0395905_0005832_1863_2138 91
415 3300037471 Ga0395905_0016819 Ga0395905_0016819_3817_4095 91
416 3300037471 Ga0395905_0738319 Ga0395905_0738319_146_421 91
417 3300039437 Ga0436365_0896739 Ga0436365_0896739_181_459 91
418 3300041486 Ga0451807_0498778 Ga0451807_0498778_430_714 91
419 3300042133 Ga0450896_056146 Ga0450896_056146_121_399 91
420 3300042876 Ga0451577_0403684 Ga0451577_0403684_743_1030 91
421 3300044658 Ga0466972_0183983 Ga0466972_0183983_471_746 91
422 3300044673 Ga0453683_0283795 Ga0453683_0283795_558_845 91
423 3300044683 Ga0466965_0090831 Ga0466965_0090831_1100_1375 91
424 3300044712 Ga0453684_0005559 Ga0453684_0005559_23538_23816 91
425 3300044735 Ga0466968_0014664 Ga0466968_0014664_1085_1372 91
426 3300044842 Ga0466957_0532457 Ga0466957_0532457_14_289 91
427 3300044901 Ga0466960_0936628 Ga0466960_0936628_181_459 91
428 3300045051 Ga0451576_0114403 Ga0451576_0114403_1346_1633 91
429 3300045051 Ga0451576_0234298 Ga0451576_0234298_1523_1828 91
430 3300046454 Ga0495592_0651314 Ga0495592_0651314_170_448 91
431 3300046459 Ga0495629_0821257 Ga0495629_0821257_46_324 91
432 3300046460 Ga0495638_0530940 Ga0495638_0530940_261_539 91
433 3300046461 Ga0495641_0246597 Ga0495641_0246597_405_683 91
434 3300046471 Ga0495650_0060529 Ga0495650_0060529_863_1138 91
435 3300046472 Ga0495580_0807912 Ga0495580_0807912_299_577 91
436 3300046506 Ga0495583_0184829 Ga0495583_0184829_292_591 91
437 3300046512 Ga0495610_0200309 Ga0495610_0200309_105_404 91
438 3300046513 Ga0495616_0090863 Ga0495616_0090863_328_627 91
439 3300046519 Ga0495632_0007745 Ga0495632_0007745_319_618 91
440 3300046519 Ga0495632_0333567 Ga0495632_0333567_218_496 91
441 3300046528 Ga0495642_0228548 Ga0495642_0228548_385_684 91
442 3300046530 Ga0495654_0393360 Ga0495654_0393360_31_330 91
443 3300046539 Ga0495621_0066745 Ga0495621_0066745_178_456 91
444 3300046539 Ga0495621_0303791 Ga0495621_0303791_293_571 91
445 3300046542 Ga0495597_0062371 Ga0495597_0062371_601_894 91
446 3300046543 Ga0495645_0859374 Ga0495645_0859374_198_488 91
447 3300046660 Ga0495625_0156033 Ga0495625_0156033_241_519 91
448 3300046680 Ga0495646_0620580 Ga0495646_0620580_16_306 91
449 3300046683 Ga0495658_0145588 Ga0495658_0145588_1085_1363 91
450 3300046692 Ga0495671_0207850 Ga0495671_0207850_378_659 91
451 3300046692 Ga0495671_0439485 Ga0495671_0439485_309_608 91
452 3300046694 Ga0495649_0004724 Ga0495649_0004724_679_978 91
453 3300046694 Ga0495649_0163446 Ga0495649_0163446_297_578 91
454 3300047443 Ga0495687_000594 Ga0495687_000594_1509_1802 91
455 3300047443 Ga0495687_005079 Ga0495687_005079_7873_8172 91
456 3300047443 Ga0495687_006945 Ga0495687_006945_4967_5266 91
457 3300047444 Ga0495675_0632002 Ga0495675_0632002_176_454 91
458 3300048091 Ga0495626_0026314 Ga0495626_0026314_2201_2494 91
459 3300048903 Ga0496100_0340530 Ga0496100_0340530_169_447 91
460 3300048905 Ga0496102_0989300 Ga0496102_0989300_321_599 91
461 3300048907 Ga0496104_0272846 Ga0496104_0272846_571_849 91
462 3300048907 Ga0496104_0284257 Ga0496104_0284257_771_1049 91
463 3300048908 Ga0496105_0272040 Ga0496105_0272040_1078_1356 91
464 3300048909 Ga0496106_0650073 Ga0496106_0650073_337_615 91
465 3300048910 Ga0496107_1278102 Ga0496107_1278102_72_350 91
466 3300048911 Ga0496108_0402422 Ga0496108_0402422_545_823 91
467 3300048912 Ga0496109_0128519 Ga0496109_0128519_866_1144 91
468 3300048915 Ga0496112_1044640 Ga0496112_1044640_299_577 91
469 3300048916 Ga0496113_0674018 Ga0496113_0674018_369_647 91
470 3300048924 Ga0496121_0026536 Ga0496121_0026536_1931_2209 91
471 3300048926 Ga0496123_0466147 Ga0496123_0466147_52_330 91
472 3300048927 Ga0496124_0466928 Ga0496124_0466928_277_555 91
473 3300048928 Ga0496125_0564286 Ga0496125_0564286_241_519 91
474 3300049577 Ga0501041_0861602 Ga0501041_0861602_25_303 91
475 3300049705 Ga0501225_0065496 Ga0501225_0065496_205_483 91
476 3300049822 Ga0501035_0207821 Ga0501035_0207821_263_538 91
477 3300050489 nmdc:mga03683_9019_c1 nmdc:mga03683_9019_c1_1416_1715 91
478 3300050490 nmdc:mga03n38_208033_c1 nmdc:mga03n38_208033_c1_557_856 91
479 3300050491 nmdc:mga00v17_319009_c1 nmdc:mga00v17_319009_c1_135_434 91
480 3300050492 nmdc:mga0yw44_47259_c1 nmdc:mga0yw44_47259_c1_1075_1374 91
481 3300050493 nmdc:mga0k408_103026_c1 nmdc:mga0k408_103026_c1_572_850 91
482 3300050493 nmdc:mga0k408_120188_c1 nmdc:mga0k408_120188_c1_732_1010 91
483 3300050493 nmdc:mga0k408_24186_c1 nmdc:mga0k408_24186_c1_2252_2530 91
484 3300050493 nmdc:mga0k408_302552_c1 nmdc:mga0k408_302552_c1_262_540 91
485 3300050493 nmdc:mga0k408_362386_c1 nmdc:mga0k408_362386_c1_66_344 91
486 3300050493 nmdc:mga0k408_39853_c1 nmdc:mga0k408_39853_c1_1169_1459 91
487 3300050493 nmdc:mga0k408_9344_c1 nmdc:mga0k408_9344_c1_1611_1910 91
488 3300050494 nmdc:mga06z11_248091_c1 nmdc:mga06z11_248091_c1_653_952 91
489 3300050495 nmdc:mga04h51_328945_c1 nmdc:mga04h51_328945_c1_137_415 91
490 3300050495 nmdc:mga04h51_70965_c1 nmdc:mga04h51_70965_c1_653_952 91
491 3300050496 nmdc:mga07m45_14664_c2 nmdc:mga07m45_14664_c2_865_1164 91
492 3300050496 nmdc:mga07m45_172542_c1 nmdc:mga07m45_172542_c1_330_635 91
493 3300050496 nmdc:mga07m45_2545_c1 nmdc:mga07m45_2545_c1_1060_1365 91
494 3300050496 nmdc:mga07m45_544471_c1 nmdc:mga07m45_544471_c1_178_468 91
495 3300050496 nmdc:mga07m45_9585_c1 nmdc:mga07m45_9585_c1_3755_4057 91
496 3300050516 nmdc:mga0sz30_3098_c1 nmdc:mga0sz30_3098_c1_4247_4546 91
497 3300053077 Ga0495601_0475858 Ga0495601_0475858_77_367 91
498 3300053084 Ga0495595_0260151 Ga0495595_0260151_294_572 91
499 3300053086 Ga0500578_0035984 Ga0500578_0035984_170_448 91
500 3300053092 Ga0500583_0275119 Ga0500583_0275119_263_562 91
501 3300053093 Ga0500651_0701111 Ga0500651_0701111_154_453 91
502 3300053134 Ga0500658_0008541 Ga0500658_0008541_2721_3020 91
503 3300053139 Ga0500568_0028846 Ga0500568_0028846_1896_2195 91
504 3300053148 Ga0500590_020753 Ga0500590_020753_1012_1290 91
505 3300053730 Ga0500645_002406 Ga0500645_002406_7346_7624 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04977

DivIC

Septum formation initiator

27

106

0.94

Feature Viewer

pLDDT pTM Quality
84.09 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map