F456306

General Info

Members Datasets Scaffolds Average Seq Length
505 230 504 338

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100007128|Ga0070683_1000071282
Length 378
Sequence MRILRILPVQPVNCGFVGTWCIRHSVRWCGLLLTAFCFTGRSKMLNRRRFVPEAICAGALAVFCASGAGQNAVNDLAPVIDVHVHAMDESFPGGGPMCPNAAKFLASDPKTKEAPFGWDQEACTPKLYPAEKGQYLKDVVDEMKRLNVTAVVFGDPKSVQKWKDAAGDRVIRGTSFSEGMTPDARVSLDELRKDFTTGGFKVMGEIGLQYEGLSPSDPSVDRYFALAEQLDVPVAIHMGTGGSGRANLTTPKFRGSMGNPLLLEDLLARHPKLRVQVMHAGYPMIDNMLTLLQANSHVYVDVAGLIWSYPLKEVNRYIQRLVEAGFEDRVMFGTDQMEWPKLMAYSISIIQNADYLTPEEKRDILYNNAVRFLRLDKK

Samples

Sample ID Description Type Environment
1 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
191 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.79
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 1.58
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10060713 3300003320 Bacteria 6291
2 rootH1_10058642 3300003323 Bacteria 4109
3 Ga0065707_10126637 3300005295 Bacteria 1998
4 Ga0070658_10081958 3300005327 Bacteria 2651
5 Ga0070676_10032227 3300005328 Bacteria 3001
6 Ga0070683_100005935 3300005329 Bacteria 10222
7 Ga0070683_100007128 3300005329 Bacteria 9421
8 Ga0070683_100021515 3300005329 Bacteria 5756
9 Ga0070683_100026677 3300005329 Bacteria 5205
10 Ga0070683_100071875 3300005329 Bacteria 3229
11 Ga0070683_100388234 3300005329 Bacteria 1331
12 Ga0070670_100005335 3300005331 Bacteria 10837
13 Ga0068869_100010471 3300005334 Bacteria 6048
14 Ga0068869_100013580 3300005334 Bacteria 5420
15 Ga0068869_100161460 3300005334 Bacteria 1745
16 Ga0070666_10074402 3300005335 Unclassified 2315
17 Ga0068868_100047773 3300005338 Bacteria 3356
18 Ga0068868_100048878 3300005338 Bacteria 3319
19 Ga0068868_100088225 3300005338 Bacteria 2496
20 Ga0068868_100146699 3300005338 Bacteria 1941
21 Ga0070687_100100747 3300005343 Bacteria 1617
22 Ga0070661_100010035 3300005344 Bacteria 6574
23 Ga0070661_100028256 3300005344 Bacteria 4045
24 Ga0070661_100083687 3300005344 Bacteria 2357
25 Ga0070661_100298029 3300005344 Unclassified 1254
26 Ga0070668_100240566 3300005347 Bacteria 1499
27 Ga0070675_100116872 3300005354 Bacteria 2263
28 Ga0070671_100014395 3300005355 Bacteria 6391
29 Ga0070671_100109518 3300005355 Bacteria 2320
30 Ga0070674_100013518 3300005356 Bacteria 5049
31 Ga0070674_100047622 3300005356 Bacteria 2939
32 Ga0070673_100096229 3300005364 Unclassified 2429
33 Ga0070688_100157942 3300005365 Bacteria 1556
34 Ga0070688_100298777 3300005365 Bacteria 1163
35 Ga0070659_100027802 3300005366 Bacteria 4360
36 Ga0070659_100317977 3300005366 Bacteria 1301
37 Ga0070667_100004529 3300005367 Bacteria 11706
38 Ga0070667_100077135 3300005367 Unclassified 2845
39 Ga0070667_100078547 3300005367 Bacteria 2820
40 Ga0070667_100113817 3300005367 Bacteria 2348
41 Ga0070709_10000663 3300005434 Bacteria 19594
42 Ga0070709_10132489 3300005434 Unclassified 1703
43 Ga0070709_10141856 3300005434 Unclassified 1652
44 Ga0070714_100019354 3300005435 Bacteria 5544
45 Ga0070713_100000288 3300005436 Bacteria 33342
46 Ga0070713_100000708 3300005436 Bacteria 21394
47 Ga0070713_100458269 3300005436 Bacteria 1198
48 Ga0070701_10039701 3300005438 Bacteria 2389
49 Ga0070711_100000634 3300005439 Bacteria 18335
50 Ga0070711_100002849 3300005439 Bacteria 9946
51 Ga0070711_100127000 3300005439 Bacteria 1894
52 Ga0070678_100080826 3300005456 Bacteria 2462
53 Ga0070678_100100880 3300005456 Bacteria 2237
54 Ga0070662_100139991 3300005457 Bacteria 1874
55 Ga0070681_10000506 3300005458 Bacteria 31860
56 Ga0070681_10152762 3300005458 Bacteria 2234
57 Ga0070698_100009619 3300005471 Bacteria 10341
58 Ga0070684_100007653 3300005535 Bacteria 8422
59 Ga0070684_100009714 3300005535 Bacteria 7592
60 Ga0070684_100015732 3300005535 Bacteria 6172
61 Ga0070684_100080460 3300005535 Unclassified 2882
62 Ga0068853_100000074 3300005539 Bacteria 69174
63 Ga0068853_100041082 3300005539 Bacteria 3949
64 Ga0068853_100090912 3300005539 Bacteria 2683
65 Ga0068853_100103999 3300005539 Bacteria 2514
66 Ga0068853_100447834 3300005539 Bacteria 1214
67 Ga0070672_100091881 3300005543 Bacteria 2449
68 Ga0070672_100324107 3300005543 Unclassified 1310
69 Ga0070686_100031341 3300005544 Bacteria 3250
70 Ga0070693_100199754 3300005547 Bacteria 1298
71 Ga0070665_100208523 3300005548 Bacteria 1955
72 Ga0070665_100222952 3300005548 Bacteria 1886
73 Ga0068855_100001215 3300005563 Bacteria 31959
74 Ga0068855_100005244 3300005563 Bacteria 15811
75 Ga0068855_100023784 3300005563 Bacteria 7339
76 Ga0068855_100043779 3300005563 Bacteria 5300
77 Ga0068855_100073624 3300005563 Bacteria 3968
78 Ga0068855_100128952 3300005563 Bacteria 2890
79 Ga0068855_100252939 3300005563 Bacteria 1965
80 Ga0070664_100130798 3300005564 Bacteria 2204
81 Ga0068857_100001254 3300005577 Bacteria 19874
82 Ga0068857_100009287 3300005577 Bacteria 8533
83 Ga0068857_100036294 3300005577 Bacteria 4368
84 Ga0068857_100130938 3300005577 Unclassified 2262
85 Ga0068854_100023451 3300005578 Bacteria 4216
86 Ga0068854_100063707 3300005578 Bacteria 2677
87 Ga0068854_100178534 3300005578 Bacteria 1657
88 Ga0068854_100307618 3300005578 Bacteria 1284
89 Ga0068856_100001608 3300005614 Bacteria 23621
90 Ga0068856_100003189 3300005614 Bacteria 16692
91 Ga0068856_100003456 3300005614 Bacteria 15972
92 Ga0068856_100004477 3300005614 Bacteria 13900
93 Ga0068856_100016278 3300005614 Bacteria 7195
94 Ga0068856_100162284 3300005614 Bacteria 2245
95 Ga0068856_100346671 3300005614 Bacteria 1504
96 Ga0068852_100000073 3300005616 Bacteria 69820
97 Ga0068852_100011999 3300005616 Bacteria 6555
98 Ga0068852_100053654 3300005616 Bacteria 3471
99 Ga0068852_100164632 3300005616 Bacteria 2074
100 Ga0068859_100005531 3300005617 Bacteria 12867
101 Ga0068859_100069325 3300005617 Bacteria 3561
102 Ga0068864_100005109 3300005618 Bacteria 10753
103 Ga0068864_100158840 3300005618 Bacteria 2054
104 Ga0068851_10011616 3300005834 Bacteria 4133
105 Ga0068851_10030374 3300005834 Bacteria 2680
106 Ga0068851_10048543 3300005834 Bacteria 2151
107 Ga0068863_100020476 3300005841 Bacteria 6321
108 Ga0068863_100089408 3300005841 Bacteria 2920
109 Ga0068863_100191277 3300005841 Bacteria 1966
110 Ga0068858_100035706 3300005842 Bacteria 4609
111 Ga0068860_100014746 3300005843 Bacteria 7642
112 Ga0068860_100022828 3300005843 Bacteria 6051
113 Ga0068860_100024285 3300005843 Bacteria 5861
114 Ga0068860_100220016 3300005843 Bacteria 1844
115 Ga0068860_100515335 3300005843 Bacteria 1195
116 Ga0068862_100088349 3300005844 Bacteria 2697
117 Ga0068862_100125026 3300005844 Bacteria 2270
118 Ga0070717_10046582 3300006028 Bacteria 3549
119 Ga0075368_10023671 3300006042 Bacteria 2348
120 Ga0075364_10060635 3300006051 Bacteria 2480
121 Ga0075364_10127078 3300006051 Bacteria 1710
122 Ga0070715_10006180 3300006163 Bacteria 4055
123 Ga0070716_100006469 3300006173 Bacteria 5724
124 Ga0070716_100016010 3300006173 Bacteria 3865
125 Ga0070716_100069460 3300006173 Bacteria 2065
126 Ga0070712_100000525 3300006175 Bacteria 22111
127 Ga0070712_100010745 3300006175 Bacteria 5785
128 Ga0070712_100061455 3300006175 Bacteria 2654
129 Ga0075362_10013905 3300006177 Bacteria 3234
130 Ga0075362_10053698 3300006177 Bacteria 1809
131 Ga0075367_10015552 3300006178 Bacteria 4141
132 Ga0075366_10026565 3300006195 Bacteria 3392
133 Ga0097621_100000314 3300006237 Bacteria 32871
134 Ga0097621_100002954 3300006237 Bacteria 11675
135 Ga0097621_100004777 3300006237 Bacteria 9480
136 Ga0097621_100180199 3300006237 Bacteria 1825
137 Ga0097621_100230802 3300006237 Bacteria 1616
138 Ga0068871_100003196 3300006358 Bacteria 11243
139 Ga0068871_100007511 3300006358 Bacteria 7794
140 Ga0068871_100007846 3300006358 Bacteria 7649
141 Ga0068871_100113923 3300006358 Bacteria 2278
142 Ga0068871_100190608 3300006358 Bacteria 1766
143 Ga0075428_100088533 3300006844 Bacteria 3377
144 Ga0075428_100298805 3300006844 Bacteria 1731
145 Ga0075429_100144542 3300006880 Bacteria 2082
146 Ga0068865_100019216 3300006881 Unclassified 4421
147 Ga0068865_100132383 3300006881 Bacteria 1870
148 Ga0068865_100287895 3300006881 Unclassified 1310
149 Ga0097620_100005531 3300006931 Bacteria 12867
150 Ga0097620_100069326 3300006931 Bacteria 3561
151 Ga0105240_10003498 3300009093 Bacteria 24350
152 Ga0105240_10003973 3300009093 Bacteria 22823
153 Ga0105240_10011865 3300009093 Bacteria 12096
154 Ga0105240_10022727 3300009093 Bacteria 8308
155 Ga0105240_10028521 3300009093 Bacteria 7290
156 Ga0105240_10036164 3300009093 Bacteria 6355
157 Ga0105240_10057023 3300009093 Bacteria 4884
158 Ga0105240_10235120 3300009093 Bacteria 2127
159 Ga0105240_10299507 3300009093 Bacteria 1840
160 Ga0111539_10002910 3300009094 Bacteria 22714
161 Ga0105245_10003381 3300009098 Bacteria 14291
162 Ga0105245_10109361 3300009098 Bacteria 2568
163 Ga0105245_10277613 3300009098 Bacteria 1636
164 Ga0105243_10166570 3300009148 Bacteria 1905
165 Ga0105241_10000094 3300009174 Bacteria 66981
166 Ga0105241_10000111 3300009174 Bacteria 58391
167 Ga0105241_10002420 3300009174 Bacteria 14007
168 Ga0105241_10006612 3300009174 Bacteria 8543
169 Ga0105241_10013510 3300009174 Bacteria 5982
170 Ga0105241_10343027 3300009174 Bacteria 1295
171 Ga0105242_10012049 3300009176 Bacteria 6654
172 Ga0105242_10136598 3300009176 Bacteria 2123
173 Ga0105248_10000931 3300009177 Bacteria 32596
174 Ga0105248_10018480 3300009177 Bacteria 7705
175 Ga0105248_10035868 3300009177 Bacteria 5548
176 Ga0105248_10053790 3300009177 Bacteria 4516
177 Ga0105248_10411247 3300009177 Unclassified 1523
178 Ga0105248_10518753 3300009177 Bacteria 1344
179 Ga0105237_10003225 3300009545 Bacteria 19544
180 Ga0105237_10027057 3300009545 Bacteria 5858
181 Ga0105237_10030595 3300009545 Bacteria 5467
182 Ga0105237_10043554 3300009545 Bacteria 4521
183 Ga0105237_10163441 3300009545 Bacteria 2225
184 Ga0105237_10181385 3300009545 Bacteria 2105
185 Ga0105237_10199330 3300009545 Bacteria 2001
186 Ga0105237_10250307 3300009545 Bacteria 1774
187 Ga0105238_10000022 3300009551 Bacteria 204310
188 Ga0105238_10000064 3300009551 Bacteria 122380
189 Ga0105238_10009284 3300009551 Bacteria 9845
190 Ga0105238_10027625 3300009551 Bacteria 5783
191 Ga0105238_10040919 3300009551 Bacteria 4695
192 Ga0105238_10126508 3300009551 Bacteria 2534
193 Ga0105238_10193933 3300009551 Bacteria 2007
194 Ga0105238_10378042 3300009551 Bacteria 1407
195 Ga0105249_10145809 3300009553 Bacteria 2274
196 Ga0105249_10458391 3300009553 Bacteria 1314
197 Ga0105239_10004574 3300010375 Bacteria 16490
198 Ga0105239_10004929 3300010375 Bacteria 15757
199 Ga0105239_10015510 3300010375 Bacteria 8438
200 Ga0105239_10099293 3300010375 Bacteria 3218
201 Ga0105239_10364837 3300010375 Bacteria 1632
202 Ga0105246_10007035 3300011119 Bacteria 6885
203 Ga0105246_10091017 3300011119 Bacteria 2198
204 Ga0105246_10101320 3300011119 Bacteria 2097
205 Ga0157373_10054003 3300013100 Bacteria 2856
206 Ga0157373_10114011 3300013100 Bacteria 1900
207 Ga0157371_10014783 3300013102 Bacteria 5876
208 Ga0157369_10000522 3300013105 Bacteria 50647
209 Ga0157369_10001500 3300013105 Bacteria 28635
210 Ga0157369_10003062 3300013105 Bacteria 19966
211 Ga0157369_10003096 3300013105 Bacteria 19865
212 Ga0157369_10006657 3300013105 Bacteria 13354
213 Ga0157369_10014619 3300013105 Bacteria 8855
214 Ga0157369_10042140 3300013105 Bacteria 4981
215 Ga0157369_10052576 3300013105 Bacteria 4407
216 Ga0157369_10112118 3300013105 Bacteria 2898
217 Ga0157369_10337231 3300013105 Unclassified 1566
218 Ga0157369_10513930 3300013105 Bacteria 1239
219 Ga0157374_10000164 3300013296 Bacteria 61685
220 Ga0157374_10000577 3300013296 Bacteria 32518
221 Ga0157374_10019404 3300013296 Bacteria 6017
222 Ga0157374_10168009 3300013296 Bacteria 2139
223 Ga0157374_10368833 3300013296 Bacteria 1429
224 Ga0157378_10000204 3300013297 Bacteria 57882
225 Ga0157378_10011342 3300013297 Bacteria 7799
226 Ga0157378_10024633 3300013297 Bacteria 5298
227 Ga0157378_10040521 3300013297 Bacteria 4130
228 Ga0157378_10048951 3300013297 Bacteria 3760
229 Ga0157378_10054501 3300013297 Bacteria 3560
230 Ga0163162_10017773 3300013306 Bacteria 6957
231 Ga0163162_10026792 3300013306 Bacteria 5700
232 Ga0157372_10001046 3300013307 Bacteria 30268
233 Ga0157372_10005367 3300013307 Bacteria 13621
234 Ga0157372_10011480 3300013307 Bacteria 9420
235 Ga0157372_10011598 3300013307 Bacteria 9380
236 Ga0157372_10012290 3300013307 Bacteria 9121
237 Ga0157372_10015923 3300013307 Bacteria 8063
238 Ga0157372_10051100 3300013307 Bacteria 4599
239 Ga0157372_10111541 3300013307 Bacteria 3133
240 Ga0157372_10150689 3300013307 Bacteria 2684
241 Ga0157372_10196648 3300013307 Bacteria 2335
242 Ga0157372_10214842 3300013307 Bacteria 2229
243 Ga0157375_10013495 3300013308 Bacteria 7275
244 Ga0157375_10180989 3300013308 Bacteria 2259
245 Ga0163163_10029197 3300014325 Bacteria 5303
246 Ga0163163_10067674 3300014325 Bacteria 3552
247 Ga0163163_10129660 3300014325 Bacteria 2562
248 Ga0157380_10172170 3300014326 Bacteria 1893
249 Ga0157377_10054882 3300014745 Bacteria 2257
250 Ga0157379_10013336 3300014968 Bacteria 7195
251 Ga0157379_10020941 3300014968 Bacteria 5787
252 Ga0157379_10056928 3300014968 Bacteria 3493
253 Ga0157379_10101125 3300014968 Bacteria 2587
254 Ga0157379_10241870 3300014968 Bacteria 1637
255 Ga0157376_10003558 3300014969 Bacteria 10744
256 Ga0157376_10004502 3300014969 Bacteria 9710
257 Ga0157376_10007498 3300014969 Bacteria 7794
258 Ga0157376_10009345 3300014969 Bacteria 7122
259 Ga0157376_10073721 3300014969 Bacteria 2908
260 Ga0157376_10078851 3300014969 Bacteria 2822
261 Ga0163161_10092188 3300017792 Bacteria 2243
262 Ga0213876_10006383 3300021384 Bacteria 6428
263 Ga0213876_10021594 3300021384 Bacteria 3405
264 Ga0207656_10078368 3300025321 Unclassified 1481
265 Ga0207710_10005232 3300025900 Bacteria 5607
266 Ga0207680_10059138 3300025903 Unclassified 2326
267 Ga0207699_10017732 3300025906 Bacteria 3756
268 Ga0207699_10064024 3300025906 Bacteria 2223
269 Ga0207699_10133868 3300025906 Unclassified 1621
270 Ga0207645_10008105 3300025907 Bacteria 7363
271 Ga0207645_10117415 3300025907 Bacteria 1726
272 Ga0207705_10066477 3300025909 Bacteria 2608
273 Ga0207705_10150534 3300025909 Bacteria 1744
274 Ga0207654_10000055 3300025911 Bacteria 77517
275 Ga0207654_10001748 3300025911 Bacteria 11283
276 Ga0207654_10023681 3300025911 Bacteria 3292
277 Ga0207707_10001125 3300025912 Bacteria 25351
278 Ga0207695_10000096 3300025913 Bacteria 265048
279 Ga0207695_10000168 3300025913 Bacteria 193087
280 Ga0207695_10007098 3300025913 Bacteria 14346
281 Ga0207695_10013431 3300025913 Bacteria 9768
282 Ga0207695_10013487 3300025913 Bacteria 9744
283 Ga0207695_10016331 3300025913 Bacteria 8689
284 Ga0207695_10030629 3300025913 Bacteria 5920
285 Ga0207695_10144759 3300025913 Bacteria 2322
286 Ga0207695_10149098 3300025913 Unclassified 2279
287 Ga0207671_10000022 3300025914 Bacteria 277803
288 Ga0207671_10005196 3300025914 Bacteria 12100
289 Ga0207671_10125381 3300025914 Bacteria 1966
290 Ga0207671_10155086 3300025914 Bacteria 1771
291 Ga0207671_10208982 3300025914 Bacteria 1526
292 Ga0207693_10000010 3300025915 Bacteria 162031
293 Ga0207693_10000203 3300025915 Bacteria 54373
294 Ga0207693_10002101 3300025915 Bacteria 17385
295 Ga0207693_10053625 3300025915 Unclassified 3164
296 Ga0207663_10016513 3300025916 Bacteria 4096
297 Ga0207663_10029594 3300025916 Bacteria 3219
298 Ga0207660_10023311 3300025917 Bacteria 4179
299 Ga0207649_10010373 3300025920 Bacteria 5116
300 Ga0207652_10028705 3300025921 Bacteria 4645
301 Ga0207646_10401956 3300025922 Bacteria 1237
302 Ga0207694_10000009 3300025924 Bacteria 460687
303 Ga0207694_10009788 3300025924 Bacteria 7235
304 Ga0207694_10009895 3300025924 Bacteria 7194
305 Ga0207694_10039017 3300025924 Bacteria 3653
306 Ga0207694_10042176 3300025924 Bacteria 3519
307 Ga0207694_10051786 3300025924 Bacteria 3181
308 Ga0207694_10090948 3300025924 Bacteria 2408
309 Ga0207650_10111768 3300025925 Bacteria 2116
310 Ga0207659_10220404 3300025926 Bacteria 1525
311 Ga0207687_10008287 3300025927 Bacteria 6798
312 Ga0207687_10122196 3300025927 Bacteria 1949
313 Ga0207700_10001773 3300025928 Bacteria 12237
314 Ga0207700_10003811 3300025928 Bacteria 8810
315 Ga0207644_10142941 3300025931 Bacteria 1844
316 Ga0207706_10001497 3300025933 Bacteria 23206
317 Ga0207706_10257529 3300025933 Bacteria 1523
318 Ga0207669_10003763 3300025937 Bacteria 6590
319 Ga0207704_10015941 3300025938 Bacteria 3846
320 Ga0207704_10023357 3300025938 Bacteria 3331
321 Ga0207704_10369191 3300025938 Unclassified 1123
322 Ga0207665_10010521 3300025939 Bacteria 6078
323 Ga0207665_10020140 3300025939 Bacteria 4381
324 Ga0207665_10081571 3300025939 Unclassified 2227
325 Ga0207665_10157558 3300025939 Unclassified 1631
326 Ga0207691_10002031 3300025940 Bacteria 19804
327 Ga0207691_10010251 3300025940 Bacteria 8990
328 Ga0207711_10020458 3300025941 Bacteria 5518
329 Ga0207711_10028225 3300025941 Unclassified 4721
330 Ga0207689_10000353 3300025942 Bacteria 43010
331 Ga0207689_10001414 3300025942 Bacteria 22916
332 Ga0207689_10079258 3300025942 Bacteria 2699
333 Ga0207661_10017028 3300025944 Bacteria 5369
334 Ga0207661_10049491 3300025944 Bacteria 3345
335 Ga0207661_10088183 3300025944 Bacteria 2578
336 Ga0207661_10110880 3300025944 Bacteria 2320
337 Ga0207661_10168639 3300025944 Unclassified 1904
338 Ga0207679_10081087 3300025945 Bacteria 2480
339 Ga0207679_10249410 3300025945 Bacteria 1508
340 Ga0207667_10000370 3300025949 Bacteria 60796
341 Ga0207667_10012010 3300025949 Bacteria 10023
342 Ga0207667_10124328 3300025949 Bacteria 2658
343 Ga0207651_10097998 3300025960 Bacteria 2167
344 Ga0207651_10180473 3300025960 Bacteria 1674
345 Ga0207668_10293449 3300025972 Bacteria 1339
346 Ga0207640_10291852 3300025981 Bacteria 1286
347 Ga0207658_10074941 3300025986 Bacteria 2572
348 Ga0207677_10004837 3300026023 Bacteria 7270
349 Ga0207677_10427134 3300026023 Unclassified 1130
350 Ga0207703_10018683 3300026035 Bacteria 5415
351 Ga0207703_10029508 3300026035 Bacteria 4329
352 Ga0207703_10075075 3300026035 Bacteria 2801
353 Ga0207703_10097110 3300026035 Bacteria 2489
354 Ga0207639_10000065 3300026041 Bacteria 98610
355 Ga0207639_10024514 3300026041 Bacteria 4366
356 Ga0207639_10171914 3300026041 Bacteria 1836
357 Ga0207678_10043705 3300026067 Bacteria 3876
358 Ga0207708_10003824 3300026075 Bacteria 11093
359 Ga0207702_10001288 3300026078 Bacteria 25108
360 Ga0207702_10001772 3300026078 Bacteria 21238
361 Ga0207702_10008208 3300026078 Bacteria 8826
362 Ga0207702_10008647 3300026078 Bacteria 8588
363 Ga0207702_10015752 3300026078 Bacteria 6259
364 Ga0207702_10086025 3300026078 Bacteria 2741
365 Ga0207641_10012696 3300026088 Bacteria 6906
366 Ga0207641_10015820 3300026088 Bacteria 6178
367 Ga0207641_10316616 3300026088 Bacteria 1478
368 Ga0207648_10368797 3300026089 Bacteria 1296
369 Ga0207676_10027930 3300026095 Bacteria 4209
370 Ga0207676_10299078 3300026095 Bacteria 1469
371 Ga0207674_10002547 3300026116 Bacteria 22963
372 Ga0207674_10004444 3300026116 Bacteria 16855
373 Ga0207674_10006526 3300026116 Bacteria 13713
374 Ga0207674_10027214 3300026116 Bacteria 6053
375 Ga0207675_100110593 3300026118 Bacteria 2592
376 Ga0207683_10000883 3300026121 Bacteria 27539
377 Ga0207683_10006491 3300026121 Bacteria 10011
378 Ga0207698_10000028 3300026142 Bacteria 117250
379 Ga0207698_10075615 3300026142 Bacteria 2693
380 Ga0207428_10003247 3300027907 Bacteria 15845
381 Ga0265354_1000676 3300028016 Bacteria 5655
382 Ga0265354_1001392 3300028016 Unclassified 3486
383 Ga0268266_10041475 3300028379 Bacteria 3928
384 Ga0268266_10182961 3300028379 Bacteria 1909
385 Ga0268265_10064122 3300028380 Bacteria 2829
386 Ga0268265_10121818 3300028380 Bacteria 2150
387 Ga0268264_10014593 3300028381 Bacteria 6454
388 Ga0268264_10062250 3300028381 Bacteria 3133
389 Ga0268264_10096288 3300028381 Bacteria 2563
390 Ga0265338_10005268 3300028800 Bacteria 16944
391 Ga0265324_10002928 3300029957 Bacteria 8369
392 Ga0265770_1004679 3300030878 Bacteria 1871
393 Ga0265765_1000985 3300030879 Bacteria 2509
394 Ga0265760_10002706 3300031090 Bacteria 5180
395 Ga0265760_10003756 3300031090 Unclassified 4401
396 Ga0265332_10015284 3300031238 Bacteria 3387
397 Ga0265332_10074349 3300031238 Unclassified 1445
398 Ga0265320_10001745 3300031240 Bacteria 15415
399 Ga0265325_10003006 3300031241 Bacteria 11192
400 Ga0265329_10016115 3300031242 Bacteria 2597
401 Ga0265340_10011080 3300031247 Bacteria 4805
402 Ga0265339_10101875 3300031249 Bacteria 1493
403 Ga0265331_10004138 3300031250 Bacteria 9094
404 Ga0265331_10016601 3300031250 Bacteria 3862
405 Ga0265316_10003460 3300031344 Bacteria 15960
406 Ga0265316_10074430 3300031344 Bacteria 2614
407 Ga0307408_100038375 3300031548 Bacteria 3379
408 Ga0307408_100072470 3300031548 Bacteria 2550
409 Ga0307408_100170011 3300031548 Bacteria 1740
410 Ga0316579_10033319 3300031691 Bacteria 2365
411 Ga0265314_10004267 3300031711 Bacteria 13378
412 Ga0265314_10067059 3300031711 Bacteria 2419
413 Ga0265342_10019679 3300031712 Bacteria 4346
414 Ga0316578_10002573 3300031728 Bacteria 8023
415 Ga0307405_10008093 3300031731 Bacteria 5308
416 Ga0307405_10052448 3300031731 Bacteria 2536
417 Ga0316577_10003003 3300031733 Bacteria 8449
418 Ga0307413_10015851 3300031824 Bacteria 3874
419 Ga0307410_10039339 3300031852 Bacteria 3104
420 Ga0307406_10069205 3300031901 Bacteria 2307
421 Ga0307407_10021867 3300031903 Bacteria 3307
422 Ga0307407_10137788 3300031903 Bacteria 1570
423 Ga0307412_10047317 3300031911 Bacteria 2825
424 Ga0307409_100104577 3300031995 Bacteria 2358
425 Ga0307416_100280135 3300032002 Bacteria 1643
426 Ga0307416_100371668 3300032002 Bacteria 1456
427 Ga0307414_10029001 3300032004 Bacteria 3597
428 Ga0307411_10018346 3300032005 Bacteria 4011
429 Ga0307415_100030756 3300032126 Bacteria 3450
430 Ga0307415_100036810 3300032126 Bacteria 3210
431 Ga0316212_1001441 3300033547 Unclassified 3235
432 Ga0373947_0009182 3300035725 Bacteria 5684
433 Ga0373947_0163429 3300035725 Bacteria 1441
434 Ga0316582_0002658 3300036647 Bacteria 8463
435 Ga0316584_0001274 3300036712 Bacteria 14901
436 Ga0373925_0005308 3300037068 Bacteria 9621
437 Ga0395905_0008635 3300037471 Bacteria 10036
438 Ga0436364_0145533 3300037853 Bacteria 3629
439 Ga0436364_0330172 3300037853 Bacteria 2075
440 Ga0436364_0598181 3300037853 Unclassified 4193
441 Ga0436364_0612043 3300037853 Bacteria 326330
442 Ga0436364_0653530 3300037853 Unclassified 4394
443 Ga0395901_0015456 3300038443 Bacteria 7772
444 Ga0436365_0145100 3300039437 Bacteria 5434
445 Ga0436365_0283911 3300039437 Bacteria 4941
446 Ga0436365_0433973 3300039437 Bacteria 24440
447 Ga0436365_0802840 3300039437 Bacteria 2492
448 Ga0436365_1082953 3300039437 Bacteria 5696
449 Ga0436360_0786466 3300039438 Bacteria 6067
450 Ga0436360_0840616 3300039438 Unclassified 3568
451 Ga0436361_0046421 3300039447 Bacteria 10962
452 Ga0436361_0575470 3300039447 Bacteria 5197
453 Ga0436361_0747193 3300039447 Bacteria 11556
454 Ga0436361_0913485 3300039447 Bacteria 2132
455 Ga0436363_1132264 3300039450 Bacteria 1940
456 Ga0436363_1528194 3300039450 Unclassified 1310
457 Ga0436362_0005664 3300039453 Bacteria 3300
458 Ga0450920_002031 3300042122 Bacteria 3420
459 Ga0450894_002226 3300042131 Bacteria 2634
460 Ga0450895_000747 3300042132 Bacteria 2030
461 Ga0439464_0051743 3300042439 Bacteria 1189
462 Ga0450918_004526 3300042531 Bacteria 2529
463 Ga0466963_0104346 3300044694 Bacteria 1942
464 Ga0466967_0018091 3300045976 Bacteria 5622
465 Ga0495580_0002828 3300046472 Bacteria 14920
466 Ga0495580_0006378 3300046472 Bacteria 9622
467 Ga0495580_0091648 3300046472 Unclassified 2115
468 Ga0495582_0001020 3300046473 Bacteria 15683
469 Ga0495582_0050471 3300046473 Bacteria 2292
470 Ga0495628_0117643 3300046516 Bacteria 2041
471 Ga0495666_0055732 3300046526 Bacteria 1894
472 Ga0495640_0049105 3300046533 Bacteria 2912
473 Ga0495586_0126403 3300046535 Unclassified 1430
474 Ga0495645_0010184 3300046543 Bacteria 6587
475 Ga0495647_0029259 3300046681 Bacteria 2036
476 Ga0495658_0093270 3300046683 Unclassified 1786
477 Ga0495613_0123185 3300046689 Unclassified 1860
478 Ga0495624_0148424 3300046690 Unclassified 1435
479 Ga0495660_0009089 3300046810 Bacteria 5803
480 Ga0495581_0010538 3300047315 Bacteria 5344
481 Ga0495674_0154296 3300047319 Unclassified 1924
482 Ga0495676_0074497 3300047321 Bacteria 2599
483 Ga0495602_0083690 3300048088 Bacteria 2672
484 Ga0496102_0006774 3300048905 Bacteria 9777
485 Ga0496104_0352807 3300048907 Bacteria 1384
486 Ga0496106_0024042 3300048909 Bacteria 4529
487 Ga0496108_0359907 3300048911 Unclassified 1270
488 Ga0496112_0001123 3300048915 Bacteria 19904
489 Ga0496112_0028700 3300048915 Bacteria 5374
490 Ga0496112_0033214 3300048915 Bacteria 5014
491 Ga0496115_0122547 3300048918 Unclassified 2140
492 Ga0501040_0299279 3300049576 Bacteria 1150
493 Ga0501235_024326 3300049669 Bacteria 1352
494 nmdc:mga00v17_36304_c1 3300050491 Bacteria 2937
495 nmdc:mga0k408_34600_c1 3300050493 Bacteria 2893
496 nmdc:mga06z11_5944_c1 3300050494 Bacteria 4931
497 nmdc:mga04h51_43526_c1 3300050495 Bacteria 1477
498 nmdc:mga09592_52213_c2 3300050508 Bacteria 1938
499 nmdc:mga08y16_8907_c1 3300050511 Bacteria 10537
500 nmdc:mga0sz30_59708_c1 3300050516 Bacteria 1627
501 Ga0495619_0150619 3300053085 Unclassified 1605
502 Ga0500641_0003327 3300053096 Bacteria 5691
503 Ga0500618_001866 3300053125 Bacteria 8802
504 Ga0501082_0322958 3300060353 Bacteria 1345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0322958 Ga0501082_0322958_234_1172 282
2 3300005356 Ga0070674_100047622 Ga0070674_1000476224 290
3 3300005366 Ga0070659_100317977 Ga0070659_1003179771 294
4 3300025909 Ga0207705_10150534 Ga0207705_101505341 297
5 3300005329 Ga0070683_100026677 Ga0070683_1000266772 299
6 3300005344 Ga0070661_100298029 Ga0070661_1002980291 299
7 3300013296 Ga0157374_10368833 Ga0157374_103688332 299
8 3300025944 Ga0207661_10049491 Ga0207661_100494911 299
9 3300026041 Ga0207639_10171914 Ga0207639_101719141 302
10 iso_pu_bacteria 2896184354 2896184668 302
11 3300053096 Ga0500641_0003327 Ga0500641_0003327_3438_4376 304
12 3300009177 Ga0105248_10053790 Ga0105248_100537902 305
13 3300006177 Ga0075362_10053698 Ga0075362_100536982 307
14 3300013102 Ga0157371_10014783 Ga0157371_100147832 308
15 3300006051 Ga0075364_10127078 Ga0075364_101270782 309
16 3300006844 Ga0075428_100298805 Ga0075428_1002988052 309
17 3300005335 Ga0070666_10074402 Ga0070666_100744022 310
18 3300009545 Ga0105237_10250307 Ga0105237_102503071 310
19 3300031548 Ga0307408_100038375 Ga0307408_1000383754 311
20 3300031548 Ga0307408_100170011 Ga0307408_1001700112 311
21 3300031731 Ga0307405_10008093 Ga0307405_100080934 311
22 3300031903 Ga0307407_10137788 Ga0307407_101377882 311
23 3300031911 Ga0307412_10047317 Ga0307412_100473172 311
24 3300031995 Ga0307409_100104577 Ga0307409_1001045774 311
25 3300032002 Ga0307416_100280135 Ga0307416_1002801352 311
26 3300032002 Ga0307416_100371668 Ga0307416_1003716681 311
27 3300032004 Ga0307414_10029001 Ga0307414_100290014 311
28 3300032005 Ga0307411_10018346 Ga0307411_100183465 311
29 3300032126 Ga0307415_100030756 Ga0307415_1000307564 311
30 3300013307 Ga0157372_10015923 Ga0157372_1001592311 312
31 3300053125 Ga0500618_001866 Ga0500618_001866_7640_8656 312
32 3300025903 Ga0207680_10059138 Ga0207680_100591382 313
33 3300048088 Ga0495602_0083690 Ga0495602_0083690_1155_2129 314
34 3300048907 Ga0496104_0352807 Ga0496104_0352807_109_1083 314
35 3300005434 Ga0070709_10000663 Ga0070709_1000066319 315
36 3300005436 Ga0070713_100000288 Ga0070713_1000002883 315
37 3300006173 Ga0070716_100006469 Ga0070716_1000064694 315
38 3300006175 Ga0070712_100000525 Ga0070712_1000005252 315
39 3300025915 Ga0207693_10000203 Ga0207693_1000020324 315
40 3300025928 Ga0207700_10003811 Ga0207700_100038114 315
41 3300025939 Ga0207665_10010521 Ga0207665_100105215 315
42 3300037853 Ga0436364_0330172 Ga0436364_0330172_795_1805 315
43 3300037853 Ga0436364_0598181 Ga0436364_0598181_510_1520 315
44 3300039450 Ga0436363_1132264 Ga0436363_1132264_882_1892 315
45 3300046516 Ga0495628_0117643 Ga0495628_0117643_946_1923 315
46 3300048918 Ga0496115_0122547 Ga0496115_0122547_137_1144 315
47 3300050495 nmdc:mga04h51_43526_c1 nmdc:mga04h51_43526_c1_113_1105 315
48 3300009545 Ga0105237_10043554 Ga0105237_100435542 316
49 3300039438 Ga0436360_0840616 Ga0436360_0840616_1285_2283 316
50 3300046810 Ga0495660_0009089 Ga0495660_0009089_3122_4141 316
51 3300013105 Ga0157369_10337231 Ga0157369_103372311 317
52 3300013296 Ga0157374_10168009 Ga0157374_101680092 317
53 3300013307 Ga0157372_10111541 Ga0157372_101115412 317
54 3300014325 Ga0163163_10029197 Ga0163163_100291973 317
55 3300014325 Ga0163163_10129660 Ga0163163_101296602 317
56 3300014968 Ga0157379_10013336 Ga0157379_100133363 317
57 3300025906 Ga0207699_10017732 Ga0207699_100177323 317
58 3300025915 Ga0207693_10002101 Ga0207693_100021014 317
59 3300031238 Ga0265332_10074349 Ga0265332_100743492 317
60 3300031712 Ga0265342_10019679 Ga0265342_100196793 317
61 3300036647 Ga0316582_0002658 Ga0316582_0002658_7305_8300 317
62 3300036712 Ga0316584_0001274 Ga0316584_0001274_2858_3853 317
63 3300048911 Ga0496108_0359907 Ga0496108_0359907_59_1051 317
64 3300048915 Ga0496112_0033214 Ga0496112_0033214_3495_4487 317
65 3300049669 Ga0501235_024326 Ga0501235_024326_111_1106 317
66 3300005334 Ga0068869_100010471 Ga0068869_1000104716 318
67 3300005365 Ga0070688_100157942 Ga0070688_1001579421 318
68 3300005434 Ga0070709_10132489 Ga0070709_101324892 318
69 3300005434 Ga0070709_10141856 Ga0070709_101418562 318
70 3300005436 Ga0070713_100458269 Ga0070713_1004582691 318
71 3300005439 Ga0070711_100127000 Ga0070711_1001270002 318
72 3300005458 Ga0070681_10152762 Ga0070681_101527622 318
73 3300005578 Ga0068854_100307618 Ga0068854_1003076181 318
74 3300005617 Ga0068859_100005531 Ga0068859_1000055314 318
75 3300005841 Ga0068863_100089408 Ga0068863_1000894083 318
76 3300006881 Ga0068865_100132383 Ga0068865_1001323832 318
77 3300006931 Ga0097620_100005531 Ga0097620_10000553112 318
78 3300009177 Ga0105248_10518753 Ga0105248_105187531 318
79 3300010375 Ga0105239_10015510 Ga0105239_100155102 318
80 3300013296 Ga0157374_10019404 Ga0157374_100194046 318
81 3300013297 Ga0157378_10048951 Ga0157378_100489514 318
82 3300013306 Ga0163162_10026792 Ga0163162_100267922 318
83 3300013307 Ga0157372_10051100 Ga0157372_100511005 318
84 3300014745 Ga0157377_10054882 Ga0157377_100548822 318
85 3300014968 Ga0157379_10020941 Ga0157379_100209417 318
86 3300025913 Ga0207695_10016331 Ga0207695_100163316 318
87 3300025915 Ga0207693_10053625 Ga0207693_100536252 318
88 3300025938 Ga0207704_10023357 Ga0207704_100233572 318
89 3300025939 Ga0207665_10157558 Ga0207665_101575581 318
90 3300025942 Ga0207689_10000353 Ga0207689_100003537 318
91 3300025981 Ga0207640_10291852 Ga0207640_102918521 318
92 3300026023 Ga0207677_10427134 Ga0207677_104271341 318
93 3300026035 Ga0207703_10029508 Ga0207703_100295082 318
94 3300026088 Ga0207641_10316616 Ga0207641_103166162 318
95 3300026089 Ga0207648_10368797 Ga0207648_103687971 318
96 3300028379 Ga0268266_10041475 Ga0268266_100414754 318
97 3300037471 Ga0395905_0008635 Ga0395905_0008635_5970_6992 318
98 3300038443 Ga0395901_0015456 Ga0395901_0015456_750_1772 318
99 3300048915 Ga0496112_0001123 Ga0496112_0001123_8528_9532 318
100 3300003323 rootH1_10058642 rootH1_100586422 319
101 3300005343 Ga0070687_100100747 Ga0070687_1001007472 319
102 3300005438 Ga0070701_10039701 Ga0070701_100397012 319
103 3300005456 Ga0070678_100100880 Ga0070678_1001008802 319
104 3300005544 Ga0070686_100031341 Ga0070686_1000313413 319
105 3300005843 Ga0068860_100515335 Ga0068860_1005153352 319
106 3300005844 Ga0068862_100088349 Ga0068862_1000883492 319
107 3300006042 Ga0075368_10023671 Ga0075368_100236712 319
108 3300006051 Ga0075364_10060635 Ga0075364_100606352 319
109 3300006177 Ga0075362_10013905 Ga0075362_100139052 319
110 3300006178 Ga0075367_10015552 Ga0075367_100155523 319
111 3300006195 Ga0075366_10026565 Ga0075366_100265652 319
112 3300006237 Ga0097621_100230802 Ga0097621_1002308022 319
113 3300006844 Ga0075428_100088533 Ga0075428_1000885333 319
114 3300006880 Ga0075429_100144542 Ga0075429_1001445422 319
115 3300009094 Ga0111539_10002910 Ga0111539_100029102 319
116 3300009098 Ga0105245_10277613 Ga0105245_102776131 319
117 3300009148 Ga0105243_10166570 Ga0105243_101665702 319
118 3300009176 Ga0105242_10012049 Ga0105242_100120497 319
119 3300009553 Ga0105249_10458391 Ga0105249_104583911 319
120 3300013308 Ga0157375_10180989 Ga0157375_101809892 319
121 3300014326 Ga0157380_10172170 Ga0157380_101721701 319
122 3300025933 Ga0207706_10257529 Ga0207706_102575292 319
123 3300025972 Ga0207668_10293449 Ga0207668_102934492 319
124 3300026075 Ga0207708_10003824 Ga0207708_100038246 319
125 3300026095 Ga0207676_10299078 Ga0207676_102990782 319
126 3300026118 Ga0207675_100110593 Ga0207675_1001105932 319
127 3300027907 Ga0207428_10003247 Ga0207428_100032472 319
128 3300028380 Ga0268265_10064122 Ga0268265_100641222 319
129 3300031344 Ga0265316_10074430 Ga0265316_100744302 319
130 3300042122 Ga0450920_002031 Ga0450920_002031_1979_2986 319
131 3300042131 Ga0450894_002226 Ga0450894_002226_1597_2604 319
132 3300042132 Ga0450895_000747 Ga0450895_000747_416_1423 319
133 3300042531 Ga0450918_004526 Ga0450918_004526_178_1185 319
134 3300050491 nmdc:mga00v17_36304_c1 nmdc:mga00v17_36304_c1_849_1853 319
135 3300050493 nmdc:mga0k408_34600_c1 nmdc:mga0k408_34600_c1_444_1448 319
136 3300050494 nmdc:mga06z11_5944_c1 nmdc:mga06z11_5944_c1_2621_3625 319
137 3300050508 nmdc:mga09592_52213_c2 nmdc:mga09592_52213_c2_84_1088 319
138 3300050511 nmdc:mga08y16_8907_c1 nmdc:mga08y16_8907_c1_8624_9628 319
139 3300050516 nmdc:mga0sz30_59708_c1 nmdc:mga0sz30_59708_c1_421_1425 319
140 3300005328 Ga0070676_10032227 Ga0070676_100322273 320
141 3300005329 Ga0070683_100007128 Ga0070683_1000071282 320
142 3300005344 Ga0070661_100028256 Ga0070661_1000282562 320
143 3300005435 Ga0070714_100019354 Ga0070714_1000193541 320
144 3300005436 Ga0070713_100000708 Ga0070713_10000070817 320
145 3300005439 Ga0070711_100000634 Ga0070711_1000006342 320
146 3300005471 Ga0070698_100009619 Ga0070698_1000096196 320
147 3300005535 Ga0070684_100080460 Ga0070684_1000804604 320
148 3300005563 Ga0068855_100043779 Ga0068855_1000437796 320
149 3300005577 Ga0068857_100130938 Ga0068857_1001309382 320
150 3300005578 Ga0068854_100023451 Ga0068854_1000234513 320
151 3300005614 Ga0068856_100016278 Ga0068856_1000162785 320
152 3300005617 Ga0068859_100069325 Ga0068859_1000693253 320
153 3300005843 Ga0068860_100022828 Ga0068860_1000228283 320
154 3300006028 Ga0070717_10046582 Ga0070717_100465822 320
155 3300006163 Ga0070715_10006180 Ga0070715_100061802 320
156 3300006173 Ga0070716_100016010 Ga0070716_1000160102 320
157 3300006173 Ga0070716_100069460 Ga0070716_1000694602 320
158 3300006175 Ga0070712_100061455 Ga0070712_1000614551 320
159 3300006358 Ga0068871_100190608 Ga0068871_1001906082 320
160 3300006881 Ga0068865_100287895 Ga0068865_1002878952 320
161 3300006931 Ga0097620_100069326 Ga0097620_1000693263 320
162 3300009174 Ga0105241_10006612 Ga0105241_100066127 320
163 3300009176 Ga0105242_10136598 Ga0105242_101365982 320
164 3300009177 Ga0105248_10035868 Ga0105248_100358683 320
165 3300009551 Ga0105238_10009284 Ga0105238_100092846 320
166 3300013100 Ga0157373_10054003 Ga0157373_100540032 320
167 3300013105 Ga0157369_10052576 Ga0157369_100525763 320
168 3300013105 Ga0157369_10513930 Ga0157369_105139301 320
169 3300013307 Ga0157372_10011598 Ga0157372_100115981 320
170 3300014969 Ga0157376_10003558 Ga0157376_1000355810 320
171 3300014969 Ga0157376_10073721 Ga0157376_100737213 320
172 3300025906 Ga0207699_10064024 Ga0207699_100640242 320
173 3300025906 Ga0207699_10133868 Ga0207699_101338682 320
174 3300025911 Ga0207654_10023681 Ga0207654_100236813 320
175 3300025915 Ga0207693_10000010 Ga0207693_1000001040 320
176 3300025916 Ga0207663_10029594 Ga0207663_100295942 320
177 3300025922 Ga0207646_10401956 Ga0207646_104019561 320
178 3300025924 Ga0207694_10090948 Ga0207694_100909482 320
179 3300025928 Ga0207700_10001773 Ga0207700_100017732 320
180 3300025938 Ga0207704_10369191 Ga0207704_103691911 320
181 3300025939 Ga0207665_10020140 Ga0207665_100201402 320
182 3300025939 Ga0207665_10081571 Ga0207665_100815712 320
183 3300025941 Ga0207711_10020458 Ga0207711_100204583 320
184 3300025944 Ga0207661_10017028 Ga0207661_100170282 320
185 3300026035 Ga0207703_10097110 Ga0207703_100971102 320
186 3300028016 Ga0265354_1000676 Ga0265354_10006765 320
187 3300028016 Ga0265354_1001392 Ga0265354_10013922 320
188 3300028381 Ga0268264_10014593 Ga0268264_100145934 320
189 3300030878 Ga0265770_1004679 Ga0265770_10046793 320
190 3300030879 Ga0265765_1000985 Ga0265765_10009852 320
191 3300031090 Ga0265760_10002706 Ga0265760_100027065 320
192 3300031090 Ga0265760_10003756 Ga0265760_100037562 320
193 3300031250 Ga0265331_10016601 Ga0265331_100166014 320
194 3300033547 Ga0316212_1001441 Ga0316212_10014415 320
195 3300035725 Ga0373947_0009182 Ga0373947_0009182_1343_2356 320
196 3300037068 Ga0373925_0005308 Ga0373925_0005308_3678_4691 320
197 3300037853 Ga0436364_0653530 Ga0436364_0653530_1937_2950 320
198 3300039447 Ga0436361_0747193 Ga0436361_0747193_3012_4019 320
199 3300039450 Ga0436363_1528194 Ga0436363_1528194_173_1186 320
200 3300046472 Ga0495580_0002828 Ga0495580_0002828_1383_2396 320
201 3300046472 Ga0495580_0091648 Ga0495580_0091648_693_1730 320
202 3300046473 Ga0495582_0001020 Ga0495582_0001020_1348_2361 320
203 3300046473 Ga0495582_0050471 Ga0495582_0050471_524_1561 320
204 3300046526 Ga0495666_0055732 Ga0495666_0055732_195_1232 320
205 3300046533 Ga0495640_0049105 Ga0495640_0049105_577_1614 320
206 3300046535 Ga0495586_0126403 Ga0495586_0126403_172_1209 320
207 3300046681 Ga0495647_0029259 Ga0495647_0029259_172_1209 320
208 3300046683 Ga0495658_0093270 Ga0495658_0093270_361_1398 320
209 3300046689 Ga0495613_0123185 Ga0495613_0123185_142_1179 320
210 3300046690 Ga0495624_0148424 Ga0495624_0148424_271_1308 320
211 3300047315 Ga0495581_0010538 Ga0495581_0010538_1733_2770 320
212 3300047319 Ga0495674_0154296 Ga0495674_0154296_639_1676 320
213 3300047321 Ga0495676_0074497 Ga0495676_0074497_92_1129 320
214 3300048905 Ga0496102_0006774 Ga0496102_0006774_1096_2109 320
215 3300048909 Ga0496106_0024042 Ga0496106_0024042_2729_3742 320
216 3300053085 Ga0495619_0150619 Ga0495619_0150619_289_1326 320
217 3300005439 Ga0070711_100002849 Ga0070711_1000028493 321
218 3300025916 Ga0207663_10016513 Ga0207663_100165133 321
219 3300039437 Ga0436365_0145100 Ga0436365_0145100_30_1031 321
220 3300039438 Ga0436360_0786466 Ga0436360_0786466_3065_4123 321
221 3300039447 Ga0436361_0575470 Ga0436361_0575470_4156_5163 321
222 3300042439 Ga0439464_0051743 Ga0439464_0051743_13_1029 321
223 3300046543 Ga0495645_0010184 Ga0495645_0010184_4770_5783 321
224 3300005329 Ga0070683_100388234 Ga0070683_1003882341 322
225 3300005338 Ga0068868_100088225 Ga0068868_1000882252 322
226 3300005535 Ga0070684_100007653 Ga0070684_1000076532 322
227 3300005539 Ga0068853_100090912 Ga0068853_1000909122 322
228 3300005563 Ga0068855_100073624 Ga0068855_1000736243 322
229 3300005614 Ga0068856_100346671 Ga0068856_1003466711 322
230 3300005616 Ga0068852_100164632 Ga0068852_1001646322 322
231 3300009093 Ga0105240_10057023 Ga0105240_100570234 322
232 3300009174 Ga0105241_10343027 Ga0105241_103430271 322
233 3300009545 Ga0105237_10027057 Ga0105237_100270573 322
234 3300009551 Ga0105238_10378042 Ga0105238_103780421 322
235 3300013105 Ga0157369_10014619 Ga0157369_100146191 322
236 3300013307 Ga0157372_10012290 Ga0157372_100122906 322
237 3300025913 Ga0207695_10144759 Ga0207695_101447592 322
238 3300025914 Ga0207671_10125381 Ga0207671_101253812 322
239 3300026041 Ga0207639_10024514 Ga0207639_100245144 322
240 3300037853 Ga0436364_0145533 Ga0436364_0145533_564_1580 322
241 3300039437 Ga0436365_0283911 Ga0436365_0283911_3387_4403 322
242 3300039447 Ga0436361_0046421 Ga0436361_0046421_7999_9015 322
243 3300044694 Ga0466963_0104346 Ga0466963_0104346_210_1223 322
244 3300045976 Ga0466967_0018091 Ga0466967_0018091_3516_4529 322
245 3300005295 Ga0065707_10126637 Ga0065707_101266371 323
246 3300005329 Ga0070683_100005935 Ga0070683_1000059356 323
247 3300005329 Ga0070683_100021515 Ga0070683_1000215155 323
248 3300005329 Ga0070683_100071875 Ga0070683_1000718753 323
249 3300005331 Ga0070670_100005335 Ga0070670_1000053357 323
250 3300005334 Ga0068869_100013580 Ga0068869_1000135805 323
251 3300005334 Ga0068869_100161460 Ga0068869_1001614602 323
252 3300005338 Ga0068868_100047773 Ga0068868_1000477732 323
253 3300005338 Ga0068868_100048878 Ga0068868_1000488782 323
254 3300005338 Ga0068868_100146699 Ga0068868_1001466992 323
255 3300005344 Ga0070661_100010035 Ga0070661_1000100358 323
256 3300005355 Ga0070671_100014395 Ga0070671_1000143957 323
257 3300005365 Ga0070688_100298777 Ga0070688_1002987771 323
258 3300005366 Ga0070659_100027802 Ga0070659_1000278021 323
259 3300005367 Ga0070667_100004529 Ga0070667_1000045295 323
260 3300005367 Ga0070667_100113817 Ga0070667_1001138172 323
261 3300005456 Ga0070678_100080826 Ga0070678_1000808262 323
262 3300005457 Ga0070662_100139991 Ga0070662_1001399912 323
263 3300005458 Ga0070681_10000506 Ga0070681_1000050615 323
264 3300005535 Ga0070684_100009714 Ga0070684_1000097146 323
265 3300005535 Ga0070684_100015732 Ga0070684_1000157326 323
266 3300005539 Ga0068853_100000074 Ga0068853_10000007445 323
267 3300005539 Ga0068853_100041082 Ga0068853_1000410821 323
268 3300005539 Ga0068853_100103999 Ga0068853_1001039992 323
269 3300005539 Ga0068853_100447834 Ga0068853_1004478341 323
270 3300005543 Ga0070672_100091881 Ga0070672_1000918812 323
271 3300005547 Ga0070693_100199754 Ga0070693_1001997541 323
272 3300005548 Ga0070665_100222952 Ga0070665_1002229522 323
273 3300005563 Ga0068855_100001215 Ga0068855_10000121524 323
274 3300005563 Ga0068855_100005244 Ga0068855_1000052442 323
275 3300005563 Ga0068855_100023784 Ga0068855_1000237845 323
276 3300005563 Ga0068855_100128952 Ga0068855_1001289522 323
277 3300005563 Ga0068855_100252939 Ga0068855_1002529392 323
278 3300005564 Ga0070664_100130798 Ga0070664_1001307982 323
279 3300005577 Ga0068857_100001254 Ga0068857_10000125411 323
280 3300005577 Ga0068857_100009287 Ga0068857_1000092872 323
281 3300005577 Ga0068857_100036294 Ga0068857_1000362944 323
282 3300005578 Ga0068854_100063707 Ga0068854_1000637072 323
283 3300005578 Ga0068854_100178534 Ga0068854_1001785342 323
284 3300005614 Ga0068856_100001608 Ga0068856_1000016082 323
285 3300005614 Ga0068856_100003189 Ga0068856_1000031893 323
286 3300005614 Ga0068856_100003456 Ga0068856_10000345610 323
287 3300005614 Ga0068856_100004477 Ga0068856_1000044778 323
288 3300005614 Ga0068856_100162284 Ga0068856_1001622841 323
289 3300005616 Ga0068852_100000073 Ga0068852_10000007322 323
290 3300005616 Ga0068852_100011999 Ga0068852_1000119995 323
291 3300005616 Ga0068852_100053654 Ga0068852_1000536543 323
292 3300005618 Ga0068864_100005109 Ga0068864_1000051095 323
293 3300005618 Ga0068864_100158840 Ga0068864_1001588402 323
294 3300005834 Ga0068851_10011616 Ga0068851_100116164 323
295 3300005834 Ga0068851_10030374 Ga0068851_100303742 323
296 3300005834 Ga0068851_10048543 Ga0068851_100485432 323
297 3300005841 Ga0068863_100020476 Ga0068863_1000204762 323
298 3300005841 Ga0068863_100191277 Ga0068863_1001912772 323
299 3300005842 Ga0068858_100035706 Ga0068858_1000357065 323
300 3300005843 Ga0068860_100014746 Ga0068860_1000147466 323
301 3300005843 Ga0068860_100024285 Ga0068860_1000242852 323
302 3300005843 Ga0068860_100220016 Ga0068860_1002200162 323
303 3300005844 Ga0068862_100125026 Ga0068862_1001250263 323
304 3300006237 Ga0097621_100000314 Ga0097621_1000003148 323
305 3300006237 Ga0097621_100002954 Ga0097621_1000029542 323
306 3300006237 Ga0097621_100004777 Ga0097621_1000047775 323
307 3300006237 Ga0097621_100180199 Ga0097621_1001801992 323
308 3300006358 Ga0068871_100003196 Ga0068871_1000031962 323
309 3300006358 Ga0068871_100007511 Ga0068871_1000075116 323
310 3300006358 Ga0068871_100007846 Ga0068871_1000078462 323
311 3300006358 Ga0068871_100113923 Ga0068871_1001139232 323
312 3300006881 Ga0068865_100019216 Ga0068865_1000192162 323
313 3300009093 Ga0105240_10003498 Ga0105240_1000349813 323
314 3300009093 Ga0105240_10003973 Ga0105240_1000397320 323
315 3300009093 Ga0105240_10011865 Ga0105240_100118658 323
316 3300009093 Ga0105240_10022727 Ga0105240_100227277 323
317 3300009093 Ga0105240_10028521 Ga0105240_100285215 323
318 3300009093 Ga0105240_10036164 Ga0105240_100361644 323
319 3300009093 Ga0105240_10235120 Ga0105240_102351203 323
320 3300009093 Ga0105240_10299507 Ga0105240_102995072 323
321 3300009098 Ga0105245_10003381 Ga0105245_100033817 323
322 3300009098 Ga0105245_10109361 Ga0105245_101093612 323
323 3300009174 Ga0105241_10000094 Ga0105241_1000009428 323
324 3300009174 Ga0105241_10000111 Ga0105241_1000011140 323
325 3300009174 Ga0105241_10002420 Ga0105241_100024206 323
326 3300009174 Ga0105241_10013510 Ga0105241_100135103 323
327 3300009177 Ga0105248_10000931 Ga0105248_1000093116 323
328 3300009177 Ga0105248_10018480 Ga0105248_100184807 323
329 3300009545 Ga0105237_10003225 Ga0105237_1000322517 323
330 3300009545 Ga0105237_10030595 Ga0105237_100305954 323
331 3300009545 Ga0105237_10163441 Ga0105237_101634412 323
332 3300009545 Ga0105237_10181385 Ga0105237_101813852 323
333 3300009545 Ga0105237_10199330 Ga0105237_101993303 323
334 3300009551 Ga0105238_10000022 Ga0105238_1000002290 323
335 3300009551 Ga0105238_10000064 Ga0105238_1000006489 323
336 3300009551 Ga0105238_10027625 Ga0105238_100276254 323
337 3300009551 Ga0105238_10040919 Ga0105238_100409195 323
338 3300009551 Ga0105238_10126508 Ga0105238_101265083 323
339 3300009551 Ga0105238_10193933 Ga0105238_101939332 323
340 3300009553 Ga0105249_10145809 Ga0105249_101458091 323
341 3300010375 Ga0105239_10004574 Ga0105239_1000457412 323
342 3300010375 Ga0105239_10004929 Ga0105239_100049299 323
343 3300010375 Ga0105239_10099293 Ga0105239_100992932 323
344 3300010375 Ga0105239_10364837 Ga0105239_103648372 323
345 3300011119 Ga0105246_10007035 Ga0105246_100070352 323
346 3300011119 Ga0105246_10101320 Ga0105246_101013202 323
347 3300013100 Ga0157373_10114011 Ga0157373_101140111 323
348 3300013105 Ga0157369_10000522 Ga0157369_1000052248 323
349 3300013105 Ga0157369_10001500 Ga0157369_1000150019 323
350 3300013105 Ga0157369_10003062 Ga0157369_1000306214 323
351 3300013105 Ga0157369_10003096 Ga0157369_1000309614 323
352 3300013105 Ga0157369_10006657 Ga0157369_1000665710 323
353 3300013105 Ga0157369_10042140 Ga0157369_100421403 323
354 3300013105 Ga0157369_10112118 Ga0157369_101121182 323
355 3300013296 Ga0157374_10000164 Ga0157374_1000016445 323
356 3300013296 Ga0157374_10000577 Ga0157374_100005772 323
357 3300013297 Ga0157378_10000204 Ga0157378_100002048 323
358 3300013297 Ga0157378_10011342 Ga0157378_100113422 323
359 3300013297 Ga0157378_10024633 Ga0157378_100246332 323
360 3300013297 Ga0157378_10040521 Ga0157378_100405212 323
361 3300013306 Ga0163162_10017773 Ga0163162_100177735 323
362 3300013307 Ga0157372_10001046 Ga0157372_1000104626 323
363 3300013307 Ga0157372_10005367 Ga0157372_100053676 323
364 3300013307 Ga0157372_10011480 Ga0157372_100114807 323
365 3300013307 Ga0157372_10150689 Ga0157372_101506892 323
366 3300013307 Ga0157372_10196648 Ga0157372_101966482 323
367 3300013307 Ga0157372_10214842 Ga0157372_102148422 323
368 3300013308 Ga0157375_10013495 Ga0157375_100134956 323
369 3300014325 Ga0163163_10067674 Ga0163163_100676744 323
370 3300014968 Ga0157379_10056928 Ga0157379_100569284 323
371 3300014968 Ga0157379_10101125 Ga0157379_101011252 323
372 3300014969 Ga0157376_10004502 Ga0157376_1000450210 323
373 3300014969 Ga0157376_10007498 Ga0157376_100074986 323
374 3300014969 Ga0157376_10009345 Ga0157376_100093455 323
375 3300014969 Ga0157376_10078851 Ga0157376_100788512 323
376 3300017792 Ga0163161_10092188 Ga0163161_100921882 323
377 3300021384 Ga0213876_10021594 Ga0213876_100215942 323
378 3300025321 Ga0207656_10078368 Ga0207656_100783681 323
379 3300025900 Ga0207710_10005232 Ga0207710_100052326 323
380 3300025907 Ga0207645_10008105 Ga0207645_100081058 323
381 3300025911 Ga0207654_10000055 Ga0207654_1000005537 323
382 3300025911 Ga0207654_10001748 Ga0207654_100017482 323
383 3300025912 Ga0207707_10001125 Ga0207707_1000112512 323
384 3300025913 Ga0207695_10000096 Ga0207695_10000096107 323
385 3300025913 Ga0207695_10000168 Ga0207695_10000168114 323
386 3300025913 Ga0207695_10007098 Ga0207695_100070984 323
387 3300025913 Ga0207695_10013431 Ga0207695_100134314 323
388 3300025913 Ga0207695_10013487 Ga0207695_100134875 323
389 3300025913 Ga0207695_10030629 Ga0207695_100306293 323
390 3300025913 Ga0207695_10149098 Ga0207695_101490982 323
391 3300025914 Ga0207671_10000022 Ga0207671_10000022181 323
392 3300025914 Ga0207671_10005196 Ga0207671_100051966 323
393 3300025914 Ga0207671_10208982 Ga0207671_102089822 323
394 3300025917 Ga0207660_10023311 Ga0207660_100233114 323
395 3300025920 Ga0207649_10010373 Ga0207649_100103735 323
396 3300025921 Ga0207652_10028705 Ga0207652_100287052 323
397 3300025924 Ga0207694_10000009 Ga0207694_10000009101 323
398 3300025924 Ga0207694_10009788 Ga0207694_100097883 323
399 3300025924 Ga0207694_10009895 Ga0207694_100098956 323
400 3300025924 Ga0207694_10039017 Ga0207694_100390172 323
401 3300025924 Ga0207694_10042176 Ga0207694_100421762 323
402 3300025924 Ga0207694_10051786 Ga0207694_100517862 323
403 3300025927 Ga0207687_10008287 Ga0207687_100082875 323
404 3300025927 Ga0207687_10122196 Ga0207687_101221962 323
405 3300025931 Ga0207644_10142941 Ga0207644_101429411 323
406 3300025933 Ga0207706_10001497 Ga0207706_100014979 323
407 3300025938 Ga0207704_10015941 Ga0207704_100159412 323
408 3300025940 Ga0207691_10010251 Ga0207691_100102513 323
409 3300025941 Ga0207711_10028225 Ga0207711_100282254 323
410 3300025942 Ga0207689_10001414 Ga0207689_100014142 323
411 3300025942 Ga0207689_10079258 Ga0207689_100792583 323
412 3300025944 Ga0207661_10088183 Ga0207661_100881834 323
413 3300025944 Ga0207661_10110880 Ga0207661_101108802 323
414 3300025944 Ga0207661_10168639 Ga0207661_101686392 323
415 3300025945 Ga0207679_10081087 Ga0207679_100810874 323
416 3300025949 Ga0207667_10000370 Ga0207667_1000037014 323
417 3300025949 Ga0207667_10012010 Ga0207667_100120102 323
418 3300025949 Ga0207667_10124328 Ga0207667_101243282 323
419 3300025960 Ga0207651_10180473 Ga0207651_101804732 323
420 3300025986 Ga0207658_10074941 Ga0207658_100749414 323
421 3300026023 Ga0207677_10004837 Ga0207677_100048376 323
422 3300026035 Ga0207703_10018683 Ga0207703_100186835 323
423 3300026035 Ga0207703_10075075 Ga0207703_100750751 323
424 3300026041 Ga0207639_10000065 Ga0207639_1000006597 323
425 3300026078 Ga0207702_10001288 Ga0207702_1000128813 323
426 3300026078 Ga0207702_10001772 Ga0207702_1000177211 323
427 3300026078 Ga0207702_10008208 Ga0207702_100082087 323
428 3300026078 Ga0207702_10008647 Ga0207702_100086478 323
429 3300026078 Ga0207702_10015752 Ga0207702_100157525 323
430 3300026078 Ga0207702_10086025 Ga0207702_100860254 323
431 3300026088 Ga0207641_10012696 Ga0207641_100126963 323
432 3300026088 Ga0207641_10015820 Ga0207641_100158202 323
433 3300026095 Ga0207676_10027930 Ga0207676_100279302 323
434 3300026116 Ga0207674_10002547 Ga0207674_1000254715 323
435 3300026116 Ga0207674_10004444 Ga0207674_100044446 323
436 3300026116 Ga0207674_10006526 Ga0207674_100065265 323
437 3300026116 Ga0207674_10027214 Ga0207674_100272144 323
438 3300026121 Ga0207683_10000883 Ga0207683_100008835 323
439 3300026142 Ga0207698_10000028 Ga0207698_1000002819 323
440 3300026142 Ga0207698_10075615 Ga0207698_100756151 323
441 3300028379 Ga0268266_10182961 Ga0268266_101829613 323
442 3300028380 Ga0268265_10121818 Ga0268265_101218181 323
443 3300028381 Ga0268264_10062250 Ga0268264_100622501 323
444 3300028381 Ga0268264_10096288 Ga0268264_100962882 323
445 3300028800 Ga0265338_10005268 Ga0265338_100052689 323
446 3300029957 Ga0265324_10002928 Ga0265324_100029286 323
447 3300031238 Ga0265332_10015284 Ga0265332_100152842 323
448 3300031240 Ga0265320_10001745 Ga0265320_1000174514 323
449 3300031241 Ga0265325_10003006 Ga0265325_100030067 323
450 3300031242 Ga0265329_10016115 Ga0265329_100161152 323
451 3300031247 Ga0265340_10011080 Ga0265340_100110804 323
452 3300031249 Ga0265339_10101875 Ga0265339_101018751 323
453 3300031250 Ga0265331_10004138 Ga0265331_100041385 323
454 3300031344 Ga0265316_10003460 Ga0265316_100034609 323
455 3300031691 Ga0316579_10033319 Ga0316579_100333192 323
456 3300031711 Ga0265314_10004267 Ga0265314_1000426710 323
457 3300031711 Ga0265314_10067059 Ga0265314_100670592 323
458 3300031728 Ga0316578_10002573 Ga0316578_100025732 323
459 3300031733 Ga0316577_10003003 Ga0316577_100030034 323
460 3300035725 Ga0373947_0163429 Ga0373947_0163429_59_1087 323
461 3300037853 Ga0436364_0612043 Ga0436364_0612043_4942_5964 323
462 3300039437 Ga0436365_1082953 Ga0436365_1082953_516_1529 323
463 3300039447 Ga0436361_0913485 Ga0436361_0913485_287_1303 323
464 3300048915 Ga0496112_0028700 Ga0496112_0028700_3136_4140 323
465 3300049576 Ga0501040_0299279 Ga0501040_0299279_11_1033 323
466 3300005327 Ga0070658_10081958 Ga0070658_100819582 324
467 3300005344 Ga0070661_100083687 Ga0070661_1000836871 324
468 3300006175 Ga0070712_100010745 Ga0070712_1000107451 324
469 3300009177 Ga0105248_10411247 Ga0105248_104112471 324
470 3300025907 Ga0207645_10117415 Ga0207645_101174152 324
471 3300025909 Ga0207705_10066477 Ga0207705_100664771 324
472 3300025945 Ga0207679_10249410 Ga0207679_102494102 324
473 3300031548 Ga0307408_100072470 Ga0307408_1000724702 324
474 3300031731 Ga0307405_10052448 Ga0307405_100524482 324
475 3300031901 Ga0307406_10069205 Ga0307406_100692052 324
476 3300039437 Ga0436365_0802840 Ga0436365_0802840_855_1874 324
477 3300046472 Ga0495580_0006378 Ga0495580_0006378_3615_4646 324
478 3300005347 Ga0070668_100240566 Ga0070668_1002405662 326
479 3300005356 Ga0070674_100013518 Ga0070674_1000135183 326
480 3300025937 Ga0207669_10003763 Ga0207669_100037632 326
481 3300026067 Ga0207678_10043705 Ga0207678_100437052 326
482 3300005354 Ga0070675_100116872 Ga0070675_1001168723 327
483 3300005355 Ga0070671_100109518 Ga0070671_1001095181 327
484 3300005364 Ga0070673_100096229 Ga0070673_1000962293 327
485 3300005367 Ga0070667_100077135 Ga0070667_1000771353 327
486 3300005367 Ga0070667_100078547 Ga0070667_1000785472 327
487 3300005543 Ga0070672_100324107 Ga0070672_1003241072 327
488 3300005548 Ga0070665_100208523 Ga0070665_1002085232 327
489 3300011119 Ga0105246_10091017 Ga0105246_100910172 327
490 3300013297 Ga0157378_10054501 Ga0157378_100545013 327
491 3300014968 Ga0157379_10241870 Ga0157379_102418702 327
492 3300025914 Ga0207671_10155086 Ga0207671_101550862 327
493 3300025925 Ga0207650_10111768 Ga0207650_101117683 327
494 3300025926 Ga0207659_10220404 Ga0207659_102204042 327
495 3300025940 Ga0207691_10002031 Ga0207691_1000203122 327
496 3300025960 Ga0207651_10097998 Ga0207651_100979983 327
497 3300026121 Ga0207683_10006491 Ga0207683_100064918 327
498 3300031824 Ga0307413_10015851 Ga0307413_100158512 328
499 3300031852 Ga0307410_10039339 Ga0307410_100393392 328
500 3300031903 Ga0307407_10021867 Ga0307407_100218672 328
501 3300032126 Ga0307415_100036810 Ga0307415_1000368102 328
502 3300003320 rootH2_10060713 rootH2_100607132 329
503 3300021384 Ga0213876_10006383 Ga0213876_100063832 329
504 3300039437 Ga0436365_0433973 Ga0436365_0433973_13008_14111 329
505 3300039453 Ga0436362_0005664 Ga0436362_0005664_1971_3074 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

80

375

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7242 22 318
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7101 22 318
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.6868 23 319
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.68 23 319
3ij6-assembly2.cif.gz_D crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus 0.6738 81 317
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.819 81 321 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7893 81 319 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7116 81 321 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7043 81 319 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.704 81 319 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A4R1DCK2-F1-model_v4 deleted 0.9879 195 320
AF-A0A7W1PCF0-F1-model_v4 Amidohydrolase family protein 0.9848 220 320 GO:0016787
AF-A0A520HF42-F1-model_v4 Amidohydrolase 0.9804 197 320 GO:0016787
AF-A0A1F5B0K9-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9733 132 321 GO:0016787
GO:0016831
AF-A0A4Q3VP37-F1-model_v4 Amidohydrolase 0.9696 131 320 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
85.12 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map