F456209

General Info

Members Datasets Scaffolds Average Seq Length
504 225 1008 241

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10421148|Ga0207678_104211482
Length 290
Sequence VSERALVIVPTYNERENIRPLIESVLSKDARIDMLIVDDGSPDGTGAIVDEIAAANSRVSALHRPSKLGLGTAYLEGFRWALARSYDYVFEMDADFSHNPDHLPEFLRRIEDADLVLGSRYRNGRVTVVNWPMSRLLLSYAANIYARAITGLQLFDSTGGFKCFRRKVLETIDLSAVKSNGYAFQIEMSFRAWKKGFRIAEIPIVFVDRTEGESKMSKRIVREAVWMVWRLRLTEELLVLISISRAFMIRVVDWVCMIFPPMCSLRVTRPWPQFASTGCRCGPATRRCCA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
204 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
225 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.99
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 16.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10421148 3300026067 Bacteria 1158
2 Ga0065707_10030356 3300005295 Bacteria 1045
3 Ga0065707_10095773 3300005295 Unclassified 3339
4 Ga0070658_10146694 3300005327 Unclassified 1973
5 Ga0070658_10298691 3300005327 Bacteria 1373
6 Ga0070676_10010128 3300005328 Bacteria 5108
7 Ga0070676_10043515 3300005328 Bacteria 2610
8 Ga0070676_10080549 3300005328 Unclassified 1974
9 Ga0070676_10133766 3300005328 Bacteria 1571
10 Ga0070683_100000296 3300005329 Bacteria 34300
11 Ga0070683_100000607 3300005329 Bacteria 25708
12 Ga0070683_100031100 3300005329 Bacteria 4851
13 Ga0070683_100037037 3300005329 Bacteria 4465
14 Ga0070683_100061823 3300005329 Bacteria 3482
15 Ga0070690_100012476 3300005330 Bacteria 5000
16 Ga0070670_100000545 3300005331 Bacteria 29977
17 Ga0070670_100033629 3300005331 Bacteria 4416
18 Ga0070670_100036296 3300005331 Unclassified 4242
19 Ga0070670_100106554 3300005331 Bacteria 2415
20 Ga0070677_10106995 3300005333 Bacteria 1243
21 Ga0068869_100011068 3300005334 Bacteria 5908
22 Ga0070680_100008112 3300005336 Bacteria 8019
23 Ga0070680_100012551 3300005336 Bacteria 6586
24 Ga0070680_100014453 3300005336 Bacteria 6173
25 Ga0070680_100078872 3300005336 Bacteria 2713
26 Ga0070680_100160591 3300005336 Bacteria 1889
27 Ga0070682_100027297 3300005337 Bacteria 3425
28 Ga0068868_100070335 3300005338 Bacteria 2790
29 Ga0068868_100325710 3300005338 Bacteria 1310
30 Ga0070660_100021728 3300005339 Bacteria 4737
31 Ga0070660_100030274 3300005339 Bacteria 4061
32 Ga0070660_100278996 3300005339 Bacteria 1367
33 Ga0070689_100042086 3300005340 Bacteria 3507
34 Ga0070691_10054269 3300005341 Bacteria 1918
35 Ga0070687_100010108 3300005343 Bacteria 4065
36 Ga0070687_100278768 3300005343 Bacteria 1051
37 Ga0070661_100005254 3300005344 Bacteria 8915
38 Ga0070661_100015133 3300005344 Bacteria 5443
39 Ga0070661_100067049 3300005344 Bacteria 2637
40 Ga0070692_10022632 3300005345 Bacteria 3071
41 Ga0070692_10023571 3300005345 Bacteria 3017
42 Ga0070668_100001979 3300005347 Bacteria 14966
43 Ga0070668_100117068 3300005347 Bacteria 2126
44 Ga0070669_100002232 3300005353 Bacteria 14024
45 Ga0070669_100011217 3300005353 Bacteria 6360
46 Ga0070669_100040141 3300005353 Bacteria 3401
47 Ga0070669_100129697 3300005353 Bacteria 1933
48 Ga0070669_100411243 3300005353 Bacteria 1109
49 Ga0070669_100535250 3300005353 Bacteria 975
50 Ga0070675_100000777 3300005354 Bacteria 22314
51 Ga0070675_100023040 3300005354 Bacteria 4975
52 Ga0070671_100003399 3300005355 Bacteria 12414
53 Ga0070671_100020350 3300005355 Bacteria 5410
54 Ga0070671_100092680 3300005355 Unclassified 2531
55 Ga0070674_100018928 3300005356 Bacteria 4365
56 Ga0070674_100333245 3300005356 Bacteria 1220
57 Ga0070674_100550624 3300005356 Bacteria 968
58 Ga0070673_100082959 3300005364 Bacteria 2603
59 Ga0070673_100160381 3300005364 Bacteria 1912
60 Ga0070688_100009488 3300005365 Bacteria 5325
61 Ga0070659_100007794 3300005366 Bacteria 7788
62 Ga0070659_100026895 3300005366 Bacteria 4429
63 Ga0070667_100277524 3300005367 Bacteria 1504
64 Ga0070667_100698306 3300005367 Bacteria 939
65 Ga0070714_100076071 3300005435 Bacteria 2914
66 Ga0070701_10002406 3300005438 Bacteria 7206
67 Ga0070701_10154281 3300005438 Bacteria 1325
68 Ga0070701_10275153 3300005438 Bacteria 1026
69 Ga0070705_100536025 3300005440 Bacteria 895
70 Ga0070700_100016423 3300005441 Bacteria 4217
71 Ga0070700_100073206 3300005441 Bacteria 2192
72 Ga0070694_100427294 3300005444 Bacteria 1042
73 Ga0070694_100498917 3300005444 Unclassified 968
74 Ga0070708_100000261 3300005445 Bacteria 39467
75 Ga0070708_100334150 3300005445 Bacteria 1428
76 Ga0070663_100013998 3300005455 Bacteria 5137
77 Ga0070663_100632461 3300005455 Unclassified 903
78 Ga0070678_100038886 3300005456 Bacteria 3352
79 Ga0070662_100000290 3300005457 Bacteria 29689
80 Ga0070662_100038121 3300005457 Bacteria 3412
81 Ga0070662_100217173 3300005457 Bacteria 1524
82 Ga0070681_10001154 3300005458 Bacteria 22820
83 Ga0070681_10008412 3300005458 Bacteria 10105
84 Ga0070681_10014041 3300005458 Bacteria 7971
85 Ga0070681_10048190 3300005458 Unclassified 4258
86 Ga0070681_10108856 3300005458 Bacteria 2711
87 Ga0070681_10208776 3300005458 Bacteria 1869
88 Ga0070681_10294613 3300005458 Unclassified 1532
89 Ga0068867_100048663 3300005459 Bacteria 3120
90 Ga0068867_100330896 3300005459 Bacteria 1265
91 Ga0070685_10132539 3300005466 Bacteria 1560
92 Ga0070685_10417040 3300005466 Bacteria 933
93 Ga0070706_100085325 3300005467 Unclassified 2926
94 Ga0070706_100900147 3300005467 Bacteria 818
95 Ga0070707_100000813 3300005468 Bacteria 30885
96 Ga0070707_100038009 3300005468 Bacteria 4597
97 Ga0070698_100025223 3300005471 Bacteria 6194
98 Ga0070698_100167020 3300005471 Bacteria 2143
99 Ga0070698_100208386 3300005471 Bacteria 1890
100 Ga0070699_100003489 3300005518 Bacteria 13902
101 Ga0070699_100048889 3300005518 Bacteria 3660
102 Ga0070699_100087405 3300005518 Bacteria 2721
103 Ga0070699_100284353 3300005518 Bacteria 1482
104 Ga0070699_100361798 3300005518 Bacteria 1308
105 Ga0070679_100000423 3300005530 Bacteria 35993
106 Ga0070679_100010147 3300005530 Bacteria 8927
107 Ga0070679_100019552 3300005530 Bacteria 6589
108 Ga0070679_100072857 3300005530 Bacteria 3427
109 Ga0070679_100148173 3300005530 Bacteria 2324
110 Ga0070679_100237639 3300005530 Unclassified 1780
111 Ga0070684_100000729 3300005535 Bacteria 22781
112 Ga0070684_100012635 3300005535 Bacteria 6772
113 Ga0070684_100016347 3300005535 Bacteria 6062
114 Ga0070684_100242209 3300005535 Bacteria 1648
115 Ga0070684_100254601 3300005535 Unclassified 1605
116 Ga0070684_100341680 3300005535 Bacteria 1376
117 Ga0070684_100375473 3300005535 Bacteria 1309
118 Ga0070697_100163131 3300005536 Unclassified 1883
119 Ga0070697_100181944 3300005536 Bacteria 1782
120 Ga0068853_100069013 3300005539 Unclassified 3074
121 Ga0068853_100148158 3300005539 Unclassified 2111
122 Ga0070672_100010090 3300005543 Bacteria 6539
123 Ga0070672_100011782 3300005543 Bacteria 6110
124 Ga0070686_100030922 3300005544 Bacteria 3269
125 Ga0070686_100261675 3300005544 Bacteria 1268
126 Ga0070695_100104220 3300005545 Bacteria 1915
127 Ga0070696_100004034 3300005546 Bacteria 9790
128 Ga0070696_100021190 3300005546 Bacteria 4407
129 Ga0070696_100099151 3300005546 Bacteria 2085
130 Ga0070693_100007383 3300005547 Bacteria 5370
131 Ga0070693_100050500 3300005547 Bacteria 2378
132 Ga0070693_100078655 3300005547 Bacteria 1960
133 Ga0070693_100231012 3300005547 Bacteria 1217
134 Ga0070665_100112770 3300005548 Bacteria 2722
135 Ga0068855_100042743 3300005563 Bacteria 5369
136 Ga0068855_100212102 3300005563 Bacteria 2175
137 Ga0068855_100310897 3300005563 Bacteria 1743
138 Ga0068855_100343119 3300005563 Unclassified 1646
139 Ga0070664_100014184 3300005564 Bacteria 6498
140 Ga0070664_100025880 3300005564 Bacteria 4865
141 Ga0070664_100253182 3300005564 Bacteria 1583
142 Ga0070664_100417085 3300005564 Bacteria 1229
143 Ga0070664_100565099 3300005564 Bacteria 1053
144 Ga0068857_100016965 3300005577 Bacteria 6381
145 Ga0068857_100023082 3300005577 Bacteria 5472
146 Ga0068857_100095134 3300005577 Bacteria 2668
147 Ga0068854_100047434 3300005578 Unclassified 3061
148 Ga0068856_100086538 3300005614 Archaea 3114
149 Ga0068852_100002728 3300005616 Bacteria 12212
150 Ga0068852_100366182 3300005616 Bacteria 1411
151 Ga0068859_100023519 3300005617 Bacteria 6183
152 Ga0068859_100490724 3300005617 Bacteria 1323
153 Ga0068864_100156183 3300005618 Bacteria 2071
154 Ga0068864_100243767 3300005618 Bacteria 1666
155 Ga0068866_10026797 3300005718 Bacteria 2727
156 Ga0068861_100000364 3300005719 Bacteria 26004
157 Ga0068851_10080588 3300005834 Bacteria 1699
158 Ga0068863_100019218 3300005841 Bacteria 6538
159 Ga0068858_100280896 3300005842 Bacteria 1585
160 Ga0068862_100021115 3300005844 Bacteria 5443
161 Ga0097621_100318496 3300006237 Bacteria 1377
162 Ga0097621_100330489 3300006237 Bacteria 1352
163 Ga0097621_100607920 3300006237 Bacteria 1000
164 Ga0075428_100015337 3300006844 Bacteria 8499
165 Ga0075430_100001602 3300006846 Bacteria 18469
166 Ga0075430_100056697 3300006846 Bacteria 3295
167 Ga0075431_100093342 3300006847 Bacteria 3106
168 Ga0075431_100168140 3300006847 Bacteria 2254
169 Ga0075431_100288789 3300006847 Unclassified 1660
170 Ga0075433_10004001 3300006852 Bacteria 11406
171 Ga0075433_10153573 3300006852 Unclassified 2048
172 Ga0075434_100013833 3300006871 Bacteria 7695
173 Ga0075434_100114237 3300006871 Bacteria 2713
174 Ga0075429_100081636 3300006880 Bacteria 2819
175 Ga0075429_100124168 3300006880 Bacteria 2257
176 Ga0075429_100124619 3300006880 Bacteria 2253
177 Ga0075429_100181058 3300006880 Unclassified 1847
178 Ga0068865_100087961 3300006881 Bacteria 2247
179 Ga0075436_100002721 3300006914 Bacteria 12153
180 Ga0075436_100016460 3300006914 Bacteria 5061
181 Ga0075436_100276081 3300006914 Unclassified 1201
182 Ga0075436_100303510 3300006914 Unclassified 1144
183 Ga0097620_100023516 3300006931 Bacteria 6183
184 Ga0097620_100490712 3300006931 Bacteria 1323
185 Ga0075435_100056159 3300007076 Bacteria 3182
186 Ga0099795_10055680 3300007788 Bacteria 1453
187 Ga0105240_10002207 3300009093 Bacteria 31736
188 Ga0105240_10052670 3300009093 Bacteria 5114
189 Ga0105240_10099531 3300009093 Unclassified 3539
190 Ga0105240_10163039 3300009093 Bacteria 2646
191 Ga0105240_10198342 3300009093 Unclassified 2354
192 Ga0105240_10245654 3300009093 Bacteria 2073
193 Ga0111539_10079539 3300009094 Unclassified 3856
194 Ga0105245_10207284 3300009098 Bacteria 1885
195 Ga0114129_10008250 3300009147 Bacteria 14855
196 Ga0114129_10027167 3300009147 Bacteria 8101
197 Ga0114129_10245439 3300009147 Bacteria 2406
198 Ga0105241_10028017 3300009174 Bacteria 4195
199 Ga0105242_10534950 3300009176 Bacteria 1121
200 Ga0105248_10016408 3300009177 Bacteria 8150
201 Ga0105248_10138017 3300009177 Bacteria 2751
202 Ga0105248_10446606 3300009177 Bacteria 1457
203 Ga0105248_10588634 3300009177 Bacteria 1255
204 Ga0105237_10008723 3300009545 Bacteria 10946
205 Ga0105237_10097510 3300009545 Bacteria 2930
206 Ga0105237_10223740 3300009545 Bacteria 1882
207 Ga0105238_10146644 3300009551 Bacteria 2336
208 Ga0105238_10329619 3300009551 Bacteria 1513
209 Ga0105249_10000083 3300009553 Bacteria 135844
210 Ga0105249_10001049 3300009553 Bacteria 24466
211 Ga0105239_11055765 3300010375 Bacteria 935
212 Ga0157373_10003544 3300013100 Bacteria 11791
213 Ga0157373_10045729 3300013100 Bacteria 3124
214 Ga0157373_10073096 3300013100 Bacteria 2420
215 Ga0157373_10320782 3300013100 Unclassified 1102
216 Ga0157371_10072702 3300013102 Unclassified 2435
217 Ga0157370_10001352 3300013104 Bacteria 30418
218 Ga0157370_10038107 3300013104 Bacteria 4652
219 Ga0157370_10192539 3300013104 Bacteria 1893
220 Ga0157370_10310316 3300013104 Bacteria 1456
221 Ga0157369_10088473 3300013105 Bacteria 3306
222 Ga0157369_10127901 3300013105 Bacteria 2692
223 Ga0157369_10157150 3300013105 Bacteria 2401
224 Ga0157374_10412007 3300013296 Bacteria 1349
225 Ga0157378_10022313 3300013297 Bacteria 5572
226 Ga0157378_10046481 3300013297 Bacteria 3859
227 Ga0157378_10100358 3300013297 Unclassified 2642
228 Ga0157378_10358061 3300013297 Unclassified 1427
229 Ga0163162_10004987 3300013306 Bacteria 12791
230 Ga0163162_10510345 3300013306 Bacteria 1332
231 Ga0163162_10518730 3300013306 Bacteria 1321
232 Ga0157372_10003084 3300013307 Bacteria 17944
233 Ga0157372_10020772 3300013307 Bacteria 7091
234 Ga0157372_10051307 3300013307 Bacteria 4590
235 Ga0157372_10099346 3300013307 Bacteria 3320
236 Ga0157372_10223749 3300013307 Bacteria 2181
237 Ga0157372_10256286 3300013307 Bacteria 2031
238 Ga0157372_10456764 3300013307 Bacteria 1489
239 Ga0157375_10059059 3300013308 Bacteria 3797
240 Ga0157375_10230639 3300013308 Bacteria 2010
241 Ga0157375_10426465 3300013308 Bacteria 1492
242 Ga0157375_10501300 3300013308 Bacteria 1378
243 Ga0163163_10166777 3300014325 Bacteria 2249
244 Ga0157380_10001393 3300014326 Bacteria 15781
245 Ga0157380_10326144 3300014326 Bacteria 1426
246 Ga0157379_10020849 3300014968 Bacteria 5800
247 Ga0182007_10025753 3300015262 Bacteria 2045
248 Ga0163161_10095747 3300017792 Bacteria 2203
249 Ga0213875_10066164 3300021388 Bacteria 1689
250 Ga0207697_10010367 3300025315 Bacteria 3987
251 Ga0207697_10127922 3300025315 Bacteria 1096
252 Ga0207688_10351232 3300025901 Unclassified 909
253 Ga0207699_10069047 3300025906 Bacteria 2153
254 Ga0207645_10000052 3300025907 Bacteria 83428
255 Ga0207643_10002996 3300025908 Bacteria 9106
256 Ga0207654_10000837 3300025911 Bacteria 16946
257 Ga0207707_10001107 3300025912 Bacteria 25619
258 Ga0207707_10001652 3300025912 Bacteria 20582
259 Ga0207707_10001843 3300025912 Bacteria 19422
260 Ga0207707_10023719 3300025912 Bacteria 5365
261 Ga0207707_10025547 3300025912 Bacteria 5167
262 Ga0207707_10083290 3300025912 Bacteria 2793
263 Ga0207707_10089350 3300025912 Bacteria 2692
264 Ga0207695_10005807 3300025913 Bacteria 16244
265 Ga0207695_10028389 3300025913 Bacteria 6206
266 Ga0207695_10077976 3300025913 Bacteria 3363
267 Ga0207695_10213216 3300025913 Bacteria 1841
268 Ga0207695_10522439 3300025913 Bacteria 1069
269 Ga0207671_10019015 3300025914 Bacteria 5262
270 Ga0207671_10206338 3300025914 Bacteria 1536
271 Ga0207660_10000488 3300025917 Bacteria 26440
272 Ga0207660_10012785 3300025917 Bacteria 5496
273 Ga0207660_10125606 3300025917 Unclassified 1948
274 Ga0207660_10133973 3300025917 Bacteria 1889
275 Ga0207660_10310474 3300025917 Bacteria 1257
276 Ga0207662_10165634 3300025918 Bacteria 1415
277 Ga0207657_10017286 3300025919 Bacteria 6923
278 Ga0207649_10031682 3300025920 Bacteria 3145
279 Ga0207649_10075479 3300025920 Bacteria 2166
280 Ga0207652_10000429 3300025921 Bacteria 43684
281 Ga0207652_10011777 3300025921 Bacteria 7059
282 Ga0207652_10205749 3300025921 Unclassified 1772
283 Ga0207652_10206436 3300025921 Bacteria 1768
284 Ga0207652_10216772 3300025921 Bacteria 1724
285 Ga0207652_10331409 3300025921 Bacteria 1374
286 Ga0207646_10002922 3300025922 Bacteria 19815
287 Ga0207646_10090914 3300025922 Bacteria 2732
288 Ga0207646_10097583 3300025922 Bacteria 2633
289 Ga0207681_10021253 3300025923 Bacteria 4123
290 Ga0207681_10025895 3300025923 Unclassified 3778
291 Ga0207681_10030773 3300025923 Bacteria 3501
292 Ga0207681_10311446 3300025923 Bacteria 1249
293 Ga0207694_10102092 3300025924 Bacteria 2274
294 Ga0207694_10337391 3300025924 Bacteria 1246
295 Ga0207650_10048240 3300025925 Bacteria 3141
296 Ga0207650_10049462 3300025925 Bacteria 3104
297 Ga0207650_10101983 3300025925 Bacteria 2210
298 Ga0207650_10144943 3300025925 Bacteria 1870
299 Ga0207659_10009154 3300025926 Bacteria 6184
300 Ga0207659_10013111 3300025926 Bacteria 5300
301 Ga0207659_10046424 3300025926 Unclassified 3067
302 Ga0207687_10237093 3300025927 Bacteria 1444
303 Ga0207644_10115606 3300025931 Unclassified 2035
304 Ga0207690_10013084 3300025932 Unclassified 4978
305 Ga0207690_10019817 3300025932 Bacteria 4146
306 Ga0207706_10000217 3300025933 Bacteria 63442
307 Ga0207706_10013224 3300025933 Bacteria 7507
308 Ga0207706_10247141 3300025933 Bacteria 1559
309 Ga0207686_10541926 3300025934 Bacteria 909
310 Ga0207670_10101509 3300025936 Bacteria 2055
311 Ga0207670_10123615 3300025936 Bacteria 1885
312 Ga0207669_10049209 3300025937 Bacteria 2511
313 Ga0207669_10480790 3300025937 Bacteria 990
314 Ga0207704_10011652 3300025938 Bacteria 4338
315 Ga0207704_10061089 3300025938 Bacteria 2335
316 Ga0207691_10000818 3300025940 Bacteria 31020
317 Ga0207691_10002987 3300025940 Bacteria 16496
318 Ga0207691_10064413 3300025940 Bacteria 3321
319 Ga0207691_10191881 3300025940 Unclassified 1781
320 Ga0207691_10232675 3300025940 Unclassified 1595
321 Ga0207711_10082635 3300025941 Unclassified 2808
322 Ga0207689_10001625 3300025942 Bacteria 21286
323 Ga0207661_10002624 3300025944 Bacteria 12374
324 Ga0207661_10007536 3300025944 Bacteria 7738
325 Ga0207661_10009142 3300025944 Bacteria 7104
326 Ga0207661_10009660 3300025944 Bacteria 6928
327 Ga0207661_10114660 3300025944 Bacteria 2285
328 Ga0207661_10130696 3300025944 Bacteria 2150
329 Ga0207661_10326150 3300025944 Bacteria 1381
330 Ga0207679_10006498 3300025945 Bacteria 7388
331 Ga0207679_10011932 3300025945 Bacteria 5646
332 Ga0207679_10034521 3300025945 Bacteria 3569
333 Ga0207679_10077300 3300025945 Bacteria 2531
334 Ga0207679_10098604 3300025945 Bacteria 2279
335 Ga0207679_10155689 3300025945 Bacteria 1866
336 Ga0207667_10020776 3300025949 Bacteria 7294
337 Ga0207667_10101332 3300025949 Unclassified 2970
338 Ga0207667_10161081 3300025949 Unclassified 2308
339 Ga0207667_10300067 3300025949 Unclassified 1641
340 Ga0207667_10727693 3300025949 Bacteria 993
341 Ga0207651_10079935 3300025960 Bacteria 2351
342 Ga0207651_10181188 3300025960 Bacteria 1671
343 Ga0207651_10351203 3300025960 Bacteria 1242
344 Ga0207712_10000116 3300025961 Bacteria 86504
345 Ga0207712_10013318 3300025961 Bacteria 5273
346 Ga0207668_10058190 3300025972 Unclassified 2700
347 Ga0207668_10190606 3300025972 Bacteria 1624
348 Ga0207640_10004432 3300025981 Bacteria 7617
349 Ga0207640_10198172 3300025981 Bacteria 1519
350 Ga0207640_10385180 3300025981 Bacteria 1137
351 Ga0207658_10112001 3300025986 Bacteria 2159
352 Ga0207677_10119243 3300026023 Unclassified 1981
353 Ga0207677_10381806 3300026023 Unclassified 1189
354 Ga0207639_10041944 3300026041 Bacteria 3427
355 Ga0207639_10146536 3300026041 Bacteria 1973
356 Ga0207639_10204815 3300026041 Unclassified 1695
357 Ga0207678_10220323 3300026067 Bacteria 1624
358 Ga0207708_10006013 3300026075 Bacteria 8995
359 Ga0207708_10026216 3300026075 Bacteria 4409
360 Ga0207708_10198643 3300026075 Bacteria 1599
361 Ga0207702_10087661 3300026078 Unclassified 2718
362 Ga0207702_10454608 3300026078 Bacteria 1243
363 Ga0207641_10176152 3300026088 Bacteria 1955
364 Ga0207648_10041826 3300026089 Bacteria 4024
365 Ga0207648_10102413 3300026089 Bacteria 2510
366 Ga0207648_10132164 3300026089 Bacteria 2197
367 Ga0207676_10157420 3300026095 Bacteria 1964
368 Ga0207676_10177696 3300026095 Bacteria 1861
369 Ga0207674_10000677 3300026116 Bacteria 44223
370 Ga0207674_10002912 3300026116 Bacteria 21243
371 Ga0207674_10009226 3300026116 Bacteria 11305
372 Ga0207674_10040479 3300026116 Bacteria 4827
373 Ga0207675_100000102 3300026118 Bacteria 67767
374 Ga0207675_100120667 3300026118 Bacteria 2480
375 Ga0207698_10053947 3300026142 Unclassified 3090
376 Ga0207698_10191006 3300026142 Bacteria 1824
377 Ga0207698_10381281 3300026142 Bacteria 1341
378 Ga0207698_10481226 3300026142 Bacteria 1204
379 Ga0209969_1027333 3300027360 Bacteria 865
380 Ga0209996_1003732 3300027395 Bacteria 1923
381 Ga0210000_1003729 3300027462 Bacteria 2202
382 Ga0209995_1010168 3300027471 Bacteria 1523
383 Ga0209179_1019850 3300027512 Unclassified 1298
384 Ga0209968_1015318 3300027526 Bacteria 1213
385 Ga0209999_1000291 3300027543 Bacteria 7410
386 Ga0209983_1024320 3300027665 Bacteria 1274
387 Ga0209966_1001444 3300027695 Bacteria 4120
388 Ga0209998_10005394 3300027717 Bacteria 2679
389 Ga0268266_10100111 3300028379 Unclassified 2553
390 Ga0268266_10296848 3300028379 Bacteria 1506
391 Ga0268265_10002084 3300028380 Bacteria 15584
392 Ga0268265_10016029 3300028380 Bacteria 5142
393 Ga0268264_10052691 3300028381 Bacteria 3393
394 Ga0268264_10493181 3300028381 Bacteria 1193
395 Ga0307408_100010192 3300031548 Bacteria 6201
396 Ga0307408_100071484 3300031548 Unclassified 2566
397 Ga0307408_100086682 3300031548 Bacteria 2354
398 Ga0307408_100593254 3300031548 Bacteria 983
399 Ga0307405_10000062 3300031731 Bacteria 51691
400 Ga0307405_10054977 3300031731 Unclassified 2489
401 Ga0307405_10084348 3300031731 Bacteria 2085
402 Ga0307405_10228023 3300031731 Bacteria 1371
403 Ga0307413_10006612 3300031824 Bacteria 5314
404 Ga0307410_10009483 3300031852 Bacteria 5458
405 Ga0307410_10009709 3300031852 Bacteria 5412
406 Ga0307410_10473030 3300031852 Unclassified 1026
407 Ga0307406_10009700 3300031901 Bacteria 5412
408 Ga0307406_10018267 3300031901 Bacteria 4094
409 Ga0307406_10045806 3300031901 Unclassified 2748
410 Ga0307406_10052842 3300031901 Unclassified 2586
411 Ga0307406_10079748 3300031901 Bacteria 2172
412 Ga0307407_10010098 3300031903 Bacteria 4435
413 Ga0307407_10094744 3300031903 Bacteria 1839
414 Ga0307407_10131908 3300031903 Unclassified 1600
415 Ga0307412_10006158 3300031911 Bacteria 6760
416 Ga0307412_10025122 3300031911 Bacteria 3686
417 Ga0307412_10032760 3300031911 Bacteria 3297
418 Ga0307412_10171380 3300031911 Bacteria 1623
419 Ga0307409_100004845 3300031995 Bacteria 7640
420 Ga0307409_100010568 3300031995 Bacteria 5750
421 Ga0307409_100064657 3300031995 Bacteria 2875
422 Ga0307409_100108856 3300031995 Bacteria 2318
423 Ga0307409_100332371 3300031995 Bacteria 1426
424 Ga0307416_100018505 3300032002 Bacteria 4909
425 Ga0307416_100026992 3300032002 Bacteria 4243
426 Ga0307416_100078225 3300032002 Unclassified 2782
427 Ga0307416_100177600 3300032002 Bacteria 1992
428 Ga0307416_100419344 3300032002 Bacteria 1382
429 Ga0307414_10005433 3300032004 Bacteria 7017
430 Ga0307414_10095675 3300032004 Bacteria 2220
431 Ga0307414_10165277 3300032004 Unclassified 1763
432 Ga0307414_10227782 3300032004 Unclassified 1535
433 Ga0307411_10000346 3300032005 Bacteria 15638
434 Ga0307411_10003254 3300032005 Bacteria 7490
435 Ga0307411_10126133 3300032005 Bacteria 1862
436 Ga0307415_100000261 3300032126 Bacteria 22792
437 Ga0307415_100008934 3300032126 Bacteria 5585
438 Ga0307415_100106080 3300032126 Bacteria 2073
439 Ga0307415_100313624 3300032126 Bacteria 1304
440 Ga0373961_0084130 3300035241 Bacteria 1005
441 Ga0373935_0066416 3300035692 Unclassified 2317
442 Ga0316582_0040706 3300036647 Bacteria 2902
443 Ga0373925_0128726 3300037068 Bacteria 1972
444 Ga0395905_0133633 3300037471 Unclassified 2334
445 Ga0436364_1055606 3300037853 Bacteria 1919
446 Ga0451577_0008067 3300042876 Bacteria 10273
447 Ga0451576_0189395 3300045051 Bacteria 2148
448 Ga0451576_0388494 3300045051 Unclassified 1463
449 Ga0495592_0062127 3300046454 Bacteria 2744
450 Ga0495582_0116544 3300046473 Bacteria 1503
451 Ga0495665_0210529 3300046531 Bacteria 1007
452 Ga0495588_0198019 3300046674 Bacteria 1061
453 Ga0496108_0192095 3300048911 Bacteria 1770
454 Ga0496112_0024621 3300048915 Bacteria 5768
455 Ga0496112_0151606 3300048915 Bacteria 2285
456 Ga0496114_0452375 3300048917 Unclassified 1137
457 Ga0496115_0038099 3300048918 Bacteria 3813
458 Ga0501299_058336 3300049522 Unclassified 812
459 Ga0501033_0335587 3300049570 Bacteria 1060
460 Ga0501042_0241960 3300049578 Unclassified 1302
461 Ga0501067_0103985 3300049583 Bacteria 1578
462 Ga0501072_0477961 3300049588 Bacteria 986
463 Ga0501074_0097987 3300049590 Bacteria 2099
464 Ga0501202_011717 3300049652 Unclassified 1646
465 Ga0501223_005099 3300049663 Unclassified 2777
466 Ga0501224_003648 3300049664 Unclassified 2161
467 Ga0501230_008868 3300049667 Unclassified 1534
468 Ga0501235_032030 3300049669 Unclassified 1188
469 Ga0501249_015960 3300049679 Unclassified 1609
470 Ga0501249_033521 3300049679 Unclassified 1151
471 Ga0501250_009488 3300049680 Unclassified 1097
472 Ga0501221_051124 3300049704 Unclassified 931
473 Ga0501225_0016449 3300049705 Unclassified 2057
474 Ga0501225_0047108 3300049705 Unclassified 1196
475 Ga0501234_013864 3300049707 Unclassified 1264
476 Ga0501079_0191788 3300049741 Unclassified 1595
477 Ga0501080_0386271 3300049742 Bacteria 1261
478 Ga0501081_0129791 3300049743 Bacteria 1800
479 Ga0501263_001910 3300049760 Unclassified 2058
480 Ga0501044_0084488 3300049823 Bacteria 3208
481 nmdc:mga05p37_23651_c1 3300050507 Bacteria 7459
482 nmdc:mga05p37_293287_c1 3300050507 Bacteria 1935
483 nmdc:mga05p37_48382_c1 3300050507 Bacteria 5230
484 nmdc:mga09592_165630_c1 3300050508 Bacteria 1910
485 nmdc:mga09592_379835_c1 3300050508 Bacteria 1222
486 nmdc:mga09592_492027_c1 3300050508 Bacteria 1056
487 nmdc:mga09592_579897_c1 3300050508 Bacteria 962
488 nmdc:mga09592_93461_c1 3300050508 Bacteria 2572
489 nmdc:mga0qj67_117239_c1 3300050509 Bacteria 2152
490 nmdc:mga0qj67_23551_c1 3300050509 Bacteria 4738
491 nmdc:mga0qj67_65825_c1 3300050509 Bacteria 2885
492 nmdc:mga06r32_402555_c1 3300050510 Bacteria 1351
493 nmdc:mga06r32_440502_c1 3300050510 Bacteria 1283
494 nmdc:mga08y16_226381_c1 3300050511 Unclassified 1935
495 nmdc:mga0n895_42820_c1 3300050512 Bacteria 4408
496 nmdc:mga0n895_90059_c1 3300050512 Bacteria 3069
497 nmdc:mga08x19_17495_c1 3300050514 Unclassified 4387
498 nmdc:mga08x19_207271_c1 3300050514 Bacteria 1345
499 nmdc:mga08x19_34945_c1 3300050514 Bacteria 3179
500 nmdc:mga08x19_5774_c1 3300050514 Bacteria 7314
501 nmdc:mga0a205_268323_c1 3300050515 Unclassified 1584
502 nmdc:mga0a205_28042_c1 3300050515 Bacteria 5380
503 Ga0500628_000156 3300053129 Bacteria 13102
504 Ga0590071_012453 3300059421 Bacteria 1992
505 Ga0207678_10421148
506 Ga0065707_10030356
507 Ga0065707_10095773
508 Ga0070658_10146694
509 Ga0070658_10298691
510 Ga0070676_10010128
511 Ga0070676_10043515
512 Ga0070676_10080549
513 Ga0070676_10133766
514 Ga0070683_100000296
515 Ga0070683_100000607
516 Ga0070683_100031100
517 Ga0070683_100037037
518 Ga0070683_100061823
519 Ga0070690_100012476
520 Ga0070670_100000545
521 Ga0070670_100033629
522 Ga0070670_100036296
523 Ga0070670_100106554
524 Ga0070677_10106995
525 Ga0068869_100011068
526 Ga0070680_100008112
527 Ga0070680_100012551
528 Ga0070680_100014453
529 Ga0070680_100078872
530 Ga0070680_100160591
531 Ga0070682_100027297
532 Ga0068868_100070335
533 Ga0068868_100325710
534 Ga0070660_100021728
535 Ga0070660_100030274
536 Ga0070660_100278996
537 Ga0070689_100042086
538 Ga0070691_10054269
539 Ga0070687_100010108
540 Ga0070687_100278768
541 Ga0070661_100005254
542 Ga0070661_100015133
543 Ga0070661_100067049
544 Ga0070692_10022632
545 Ga0070692_10023571
546 Ga0070668_100001979
547 Ga0070668_100117068
548 Ga0070669_100002232
549 Ga0070669_100011217
550 Ga0070669_100040141
551 Ga0070669_100129697
552 Ga0070669_100411243
553 Ga0070669_100535250
554 Ga0070675_100000777
555 Ga0070675_100023040
556 Ga0070671_100003399
557 Ga0070671_100020350
558 Ga0070671_100092680
559 Ga0070674_100018928
560 Ga0070674_100333245
561 Ga0070674_100550624
562 Ga0070673_100082959
563 Ga0070673_100160381
564 Ga0070688_100009488
565 Ga0070659_100007794
566 Ga0070659_100026895
567 Ga0070667_100277524
568 Ga0070667_100698306
569 Ga0070714_100076071
570 Ga0070701_10002406
571 Ga0070701_10154281
572 Ga0070701_10275153
573 Ga0070705_100536025
574 Ga0070700_100016423
575 Ga0070700_100073206
576 Ga0070694_100427294
577 Ga0070694_100498917
578 Ga0070708_100000261
579 Ga0070708_100334150
580 Ga0070663_100013998
581 Ga0070663_100632461
582 Ga0070678_100038886
583 Ga0070662_100000290
584 Ga0070662_100038121
585 Ga0070662_100217173
586 Ga0070681_10001154
587 Ga0070681_10008412
588 Ga0070681_10014041
589 Ga0070681_10048190
590 Ga0070681_10108856
591 Ga0070681_10208776
592 Ga0070681_10294613
593 Ga0068867_100048663
594 Ga0068867_100330896
595 Ga0070685_10132539
596 Ga0070685_10417040
597 Ga0070706_100085325
598 Ga0070706_100900147
599 Ga0070707_100000813
600 Ga0070707_100038009
601 Ga0070698_100025223
602 Ga0070698_100167020
603 Ga0070698_100208386
604 Ga0070699_100003489
605 Ga0070699_100048889
606 Ga0070699_100087405
607 Ga0070699_100284353
608 Ga0070699_100361798
609 Ga0070679_100000423
610 Ga0070679_100010147
611 Ga0070679_100019552
612 Ga0070679_100072857
613 Ga0070679_100148173
614 Ga0070679_100237639
615 Ga0070684_100000729
616 Ga0070684_100012635
617 Ga0070684_100016347
618 Ga0070684_100242209
619 Ga0070684_100254601
620 Ga0070684_100341680
621 Ga0070684_100375473
622 Ga0070697_100163131
623 Ga0070697_100181944
624 Ga0068853_100069013
625 Ga0068853_100148158
626 Ga0070672_100010090
627 Ga0070672_100011782
628 Ga0070686_100030922
629 Ga0070686_100261675
630 Ga0070695_100104220
631 Ga0070696_100004034
632 Ga0070696_100021190
633 Ga0070696_100099151
634 Ga0070693_100007383
635 Ga0070693_100050500
636 Ga0070693_100078655
637 Ga0070693_100231012
638 Ga0070665_100112770
639 Ga0068855_100042743
640 Ga0068855_100212102
641 Ga0068855_100310897
642 Ga0068855_100343119
643 Ga0070664_100014184
644 Ga0070664_100025880
645 Ga0070664_100253182
646 Ga0070664_100417085
647 Ga0070664_100565099
648 Ga0068857_100016965
649 Ga0068857_100023082
650 Ga0068857_100095134
651 Ga0068854_100047434
652 Ga0068856_100086538
653 Ga0068852_100002728
654 Ga0068852_100366182
655 Ga0068859_100023519
656 Ga0068859_100490724
657 Ga0068864_100156183
658 Ga0068864_100243767
659 Ga0068866_10026797
660 Ga0068861_100000364
661 Ga0068851_10080588
662 Ga0068863_100019218
663 Ga0068858_100280896
664 Ga0068862_100021115
665 Ga0097621_100318496
666 Ga0097621_100330489
667 Ga0097621_100607920
668 Ga0075428_100015337
669 Ga0075430_100001602
670 Ga0075430_100056697
671 Ga0075431_100093342
672 Ga0075431_100168140
673 Ga0075431_100288789
674 Ga0075433_10004001
675 Ga0075433_10153573
676 Ga0075434_100013833
677 Ga0075434_100114237
678 Ga0075429_100081636
679 Ga0075429_100124168
680 Ga0075429_100124619
681 Ga0075429_100181058
682 Ga0068865_100087961
683 Ga0075436_100002721
684 Ga0075436_100016460
685 Ga0075436_100276081
686 Ga0075436_100303510
687 Ga0097620_100023516
688 Ga0097620_100490712
689 Ga0075435_100056159
690 Ga0099795_10055680
691 Ga0105240_10002207
692 Ga0105240_10052670
693 Ga0105240_10099531
694 Ga0105240_10163039
695 Ga0105240_10198342
696 Ga0105240_10245654
697 Ga0111539_10079539
698 Ga0105245_10207284
699 Ga0114129_10008250
700 Ga0114129_10027167
701 Ga0114129_10245439
702 Ga0105241_10028017
703 Ga0105242_10534950
704 Ga0105248_10016408
705 Ga0105248_10138017
706 Ga0105248_10446606
707 Ga0105248_10588634
708 Ga0105237_10008723
709 Ga0105237_10097510
710 Ga0105237_10223740
711 Ga0105238_10146644
712 Ga0105238_10329619
713 Ga0105249_10000083
714 Ga0105249_10001049
715 Ga0105239_11055765
716 Ga0157373_10003544
717 Ga0157373_10045729
718 Ga0157373_10073096
719 Ga0157373_10320782
720 Ga0157371_10072702
721 Ga0157370_10001352
722 Ga0157370_10038107
723 Ga0157370_10192539
724 Ga0157370_10310316
725 Ga0157369_10088473
726 Ga0157369_10127901
727 Ga0157369_10157150
728 Ga0157374_10412007
729 Ga0157378_10022313
730 Ga0157378_10046481
731 Ga0157378_10100358
732 Ga0157378_10358061
733 Ga0163162_10004987
734 Ga0163162_10510345
735 Ga0163162_10518730
736 Ga0157372_10003084
737 Ga0157372_10020772
738 Ga0157372_10051307
739 Ga0157372_10099346
740 Ga0157372_10223749
741 Ga0157372_10256286
742 Ga0157372_10456764
743 Ga0157375_10059059
744 Ga0157375_10230639
745 Ga0157375_10426465
746 Ga0157375_10501300
747 Ga0163163_10166777
748 Ga0157380_10001393
749 Ga0157380_10326144
750 Ga0157379_10020849
751 Ga0182007_10025753
752 Ga0163161_10095747
753 Ga0213875_10066164
754 Ga0207697_10010367
755 Ga0207697_10127922
756 Ga0207688_10351232
757 Ga0207699_10069047
758 Ga0207645_10000052
759 Ga0207643_10002996
760 Ga0207654_10000837
761 Ga0207707_10001107
762 Ga0207707_10001652
763 Ga0207707_10001843
764 Ga0207707_10023719
765 Ga0207707_10025547
766 Ga0207707_10083290
767 Ga0207707_10089350
768 Ga0207695_10005807
769 Ga0207695_10028389
770 Ga0207695_10077976
771 Ga0207695_10213216
772 Ga0207695_10522439
773 Ga0207671_10019015
774 Ga0207671_10206338
775 Ga0207660_10000488
776 Ga0207660_10012785
777 Ga0207660_10125606
778 Ga0207660_10133973
779 Ga0207660_10310474
780 Ga0207662_10165634
781 Ga0207657_10017286
782 Ga0207649_10031682
783 Ga0207649_10075479
784 Ga0207652_10000429
785 Ga0207652_10011777
786 Ga0207652_10205749
787 Ga0207652_10206436
788 Ga0207652_10216772
789 Ga0207652_10331409
790 Ga0207646_10002922
791 Ga0207646_10090914
792 Ga0207646_10097583
793 Ga0207681_10021253
794 Ga0207681_10025895
795 Ga0207681_10030773
796 Ga0207681_10311446
797 Ga0207694_10102092
798 Ga0207694_10337391
799 Ga0207650_10048240
800 Ga0207650_10049462
801 Ga0207650_10101983
802 Ga0207650_10144943
803 Ga0207659_10009154
804 Ga0207659_10013111
805 Ga0207659_10046424
806 Ga0207687_10237093
807 Ga0207644_10115606
808 Ga0207690_10013084
809 Ga0207690_10019817
810 Ga0207706_10000217
811 Ga0207706_10013224
812 Ga0207706_10247141
813 Ga0207686_10541926
814 Ga0207670_10101509
815 Ga0207670_10123615
816 Ga0207669_10049209
817 Ga0207669_10480790
818 Ga0207704_10011652
819 Ga0207704_10061089
820 Ga0207691_10000818
821 Ga0207691_10002987
822 Ga0207691_10064413
823 Ga0207691_10191881
824 Ga0207691_10232675
825 Ga0207711_10082635
826 Ga0207689_10001625
827 Ga0207661_10002624
828 Ga0207661_10007536
829 Ga0207661_10009142
830 Ga0207661_10009660
831 Ga0207661_10114660
832 Ga0207661_10130696
833 Ga0207661_10326150
834 Ga0207679_10006498
835 Ga0207679_10011932
836 Ga0207679_10034521
837 Ga0207679_10077300
838 Ga0207679_10098604
839 Ga0207679_10155689
840 Ga0207667_10020776
841 Ga0207667_10101332
842 Ga0207667_10161081
843 Ga0207667_10300067
844 Ga0207667_10727693
845 Ga0207651_10079935
846 Ga0207651_10181188
847 Ga0207651_10351203
848 Ga0207712_10000116
849 Ga0207712_10013318
850 Ga0207668_10058190
851 Ga0207668_10190606
852 Ga0207640_10004432
853 Ga0207640_10198172
854 Ga0207640_10385180
855 Ga0207658_10112001
856 Ga0207677_10119243
857 Ga0207677_10381806
858 Ga0207639_10041944
859 Ga0207639_10146536
860 Ga0207639_10204815
861 Ga0207678_10220323
862 Ga0207708_10006013
863 Ga0207708_10026216
864 Ga0207708_10198643
865 Ga0207702_10087661
866 Ga0207702_10454608
867 Ga0207641_10176152
868 Ga0207648_10041826
869 Ga0207648_10102413
870 Ga0207648_10132164
871 Ga0207676_10157420
872 Ga0207676_10177696
873 Ga0207674_10000677
874 Ga0207674_10002912
875 Ga0207674_10009226
876 Ga0207674_10040479
877 Ga0207675_100000102
878 Ga0207675_100120667
879 Ga0207698_10053947
880 Ga0207698_10191006
881 Ga0207698_10381281
882 Ga0207698_10481226
883 Ga0209969_1027333
884 Ga0209996_1003732
885 Ga0210000_1003729
886 Ga0209995_1010168
887 Ga0209179_1019850
888 Ga0209968_1015318
889 Ga0209999_1000291
890 Ga0209983_1024320
891 Ga0209966_1001444
892 Ga0209998_10005394
893 Ga0268266_10100111
894 Ga0268266_10296848
895 Ga0268265_10002084
896 Ga0268265_10016029
897 Ga0268264_10052691
898 Ga0268264_10493181
899 Ga0307408_100010192
900 Ga0307408_100071484
901 Ga0307408_100086682
902 Ga0307408_100593254
903 Ga0307405_10000062
904 Ga0307405_10054977
905 Ga0307405_10084348
906 Ga0307405_10228023
907 Ga0307413_10006612
908 Ga0307410_10009483
909 Ga0307410_10009709
910 Ga0307410_10473030
911 Ga0307406_10009700
912 Ga0307406_10018267
913 Ga0307406_10045806
914 Ga0307406_10052842
915 Ga0307406_10079748
916 Ga0307407_10010098
917 Ga0307407_10094744
918 Ga0307407_10131908
919 Ga0307412_10006158
920 Ga0307412_10025122
921 Ga0307412_10032760
922 Ga0307412_10171380
923 Ga0307409_100004845
924 Ga0307409_100010568
925 Ga0307409_100064657
926 Ga0307409_100108856
927 Ga0307409_100332371
928 Ga0307416_100018505
929 Ga0307416_100026992
930 Ga0307416_100078225
931 Ga0307416_100177600
932 Ga0307416_100419344
933 Ga0307414_10005433
934 Ga0307414_10095675
935 Ga0307414_10165277
936 Ga0307414_10227782
937 Ga0307411_10000346
938 Ga0307411_10003254
939 Ga0307411_10126133
940 Ga0307415_100000261
941 Ga0307415_100008934
942 Ga0307415_100106080
943 Ga0307415_100313624
944 Ga0373961_0084130
945 Ga0373935_0066416
946 Ga0316582_0040706
947 Ga0373925_0128726
948 Ga0395905_0133633
949 Ga0436364_1055606
950 Ga0451577_0008067
951 Ga0451576_0189395
952 Ga0451576_0388494
953 Ga0495592_0062127
954 Ga0495582_0116544
955 Ga0495665_0210529
956 Ga0495588_0198019
957 Ga0496108_0192095
958 Ga0496112_0024621
959 Ga0496112_0151606
960 Ga0496114_0452375
961 Ga0496115_0038099
962 Ga0501299_058336
963 Ga0501033_0335587
964 Ga0501042_0241960
965 Ga0501067_0103985
966 Ga0501072_0477961
967 Ga0501074_0097987
968 Ga0501202_011717
969 Ga0501223_005099
970 Ga0501224_003648
971 Ga0501230_008868
972 Ga0501235_032030
973 Ga0501249_015960
974 Ga0501249_033521
975 Ga0501250_009488
976 Ga0501221_051124
977 Ga0501225_0016449
978 Ga0501225_0047108
979 Ga0501234_013864
980 Ga0501079_0191788
981 Ga0501080_0386271
982 Ga0501081_0129791
983 Ga0501263_001910
984 Ga0501044_0084488
985 nmdc:mga05p37_23651_c1
986 nmdc:mga05p37_293287_c1
987 nmdc:mga05p37_48382_c1
988 nmdc:mga09592_165630_c1
989 nmdc:mga09592_379835_c1
990 nmdc:mga09592_492027_c1
991 nmdc:mga09592_579897_c1
992 nmdc:mga09592_93461_c1
993 nmdc:mga0qj67_117239_c1
994 nmdc:mga0qj67_23551_c1
995 nmdc:mga0qj67_65825_c1
996 nmdc:mga06r32_402555_c1
997 nmdc:mga06r32_440502_c1
998 nmdc:mga08y16_226381_c1
999 nmdc:mga0n895_42820_c1
1000 nmdc:mga0n895_90059_c1
1001 nmdc:mga08x19_17495_c1
1002 nmdc:mga08x19_207271_c1
1003 nmdc:mga08x19_34945_c1
1004 nmdc:mga08x19_5774_c1
1005 nmdc:mga0a205_268323_c1
1006 nmdc:mga0a205_28042_c1
1007 Ga0500628_000156
1008 Ga0590071_012453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

6

173

0.98

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

3

228

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8729 13 243
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8417 13 243
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7828 5 213
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7792 13 243
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7689 13 243
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9285 5 247 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.907 5 247 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8589 15 241 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8565 13 236 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8454 15 241 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V3CZJ5-F1-model_v4 Polyprenol monophosphomannose synthase 0.9827 124 246 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V0IGF1-F1-model_v4 Polyprenol monophosphomannose synthase 0.9808 11 248 GO:0004582
GO:0009247
GO:0016020
AF-A0A660SCN6-F1-model_v4 Polyprenol monophosphomannose synthase 0.9781 77 248 GO:0004582
GO:0009247
GO:0016020
AF-A0A524LUN0-F1-model_v4 Glycosyltransferase 0.974 9 114 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V0IGF1-F1-model_v4 Polyprenol monophosphomannose synthase 0.9726 11 248 GO:0004582
GO:0009247
GO:0016020

Map