F456156

General Info

Members Datasets Scaffolds Average Seq Length
504 218 1008 159

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100191995|Ga0068852_1001919951
Length 192
Sequence MGKLRSERIFLSRYFIVDQLFDKSTNRPIQLNPMPQEIIMYTDGSSRGNPGPGGYGTILMYGDKRKELSQGYRRTTNNRMELMAVIAGLEAMKKTGLKITIYSDSQYIVKALNEGWLNKWLATNFAKGKKNKDLWVRFYNLYKQHQAKFVWVKGHAENAYNNRCDELATAAADGNDLLTDEGYEMDPNQLLM

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
196 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
201 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
202 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
203 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
204 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
207 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
208 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 0.79
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 12.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100191995 3300005616 Bacteria 1928
2 SwRhRL2b_contig_1762647 2162886007 Bacteria 207340
3 JGI24736J21556_1017141 3300001904 Bacteria 1149
4 rootH2_10049983 3300003320 Bacteria 6892
5 rootH1_10300104 3300003323 Bacteria 1158
6 rootH1_10349153 3300003323 Bacteria 2367
7 JGI25160J50197_1001628 3300003354 Bacteria 11022
8 Ga0065704_10070151 3300005289 Bacteria 259038
9 Ga0065707_10236673 3300005295 Bacteria 1170
10 Ga0070658_10706254 3300005327 Unclassified 875
11 Ga0070658_11286222 3300005327 Bacteria 635
12 Ga0070676_10094648 3300005328 Bacteria 1836
13 Ga0070683_100004323 3300005329 Bacteria 11679
14 Ga0070683_100005740 3300005329 Bacteria 10371
15 Ga0070683_100036026 3300005329 Bacteria 4526
16 Ga0070690_100029110 3300005330 Bacteria 3423
17 Ga0070690_100229488 3300005330 Bacteria 1304
18 Ga0070690_100895131 3300005330 Bacteria 694
19 Ga0070670_100099146 3300005331 Bacteria 2507
20 Ga0070670_100139328 3300005331 Bacteria 2097
21 Ga0070670_101279721 3300005331 Bacteria 671
22 Ga0070670_101362531 3300005331 Unclassified 650
23 Ga0068869_100038316 3300005334 Bacteria 3416
24 Ga0068869_100063992 3300005334 Bacteria 2704
25 Ga0070666_10246039 3300005335 Bacteria 1265
26 Ga0070666_10406723 3300005335 Unclassified 979
27 Ga0070680_100238146 3300005336 Bacteria 1538
28 Ga0070680_100482425 3300005336 Bacteria 1060
29 Ga0070682_100632771 3300005337 Bacteria 849
30 Ga0068868_100006708 3300005338 Bacteria 8169
31 Ga0068868_100019026 3300005338 Bacteria 5141
32 Ga0068868_100103139 3300005338 Bacteria 2310
33 Ga0068868_100237819 3300005338 Bacteria 1529
34 Ga0068868_101407653 3300005338 Bacteria 650
35 Ga0070660_100136611 3300005339 Unclassified 1965
36 Ga0070660_100321490 3300005339 Bacteria 1271
37 Ga0070660_100652928 3300005339 Bacteria 881
38 Ga0070689_100022336 3300005340 Bacteria 4724
39 Ga0070689_100049370 3300005340 Bacteria 3249
40 Ga0070689_100063344 3300005340 Bacteria 2877
41 Ga0070689_100578884 3300005340 Bacteria 970
42 Ga0070661_100015611 3300005344 Bacteria 5361
43 Ga0070661_100047008 3300005344 Bacteria 3158
44 Ga0070661_100053672 3300005344 Unclassified 2951
45 Ga0070661_100094517 3300005344 Unclassified 2216
46 Ga0070661_100299170 3300005344 Bacteria 1252
47 Ga0070669_100018773 3300005353 Bacteria 4943
48 Ga0070669_100068467 3300005353 Bacteria 2620
49 Ga0070669_100852890 3300005353 Unclassified 776
50 Ga0070675_100012102 3300005354 Bacteria 6764
51 Ga0070675_100013522 3300005354 Bacteria 6416
52 Ga0070675_100066470 3300005354 Bacteria 2982
53 Ga0070675_100102464 3300005354 Bacteria 2412
54 Ga0070675_100166220 3300005354 Bacteria 1900
55 Ga0070675_100250519 3300005354 Bacteria 1550
56 Ga0070675_100934811 3300005354 Bacteria 795
57 Ga0070671_100007985 3300005355 Bacteria 8469
58 Ga0070671_100115067 3300005355 Bacteria 2261
59 Ga0070671_100203787 3300005355 Bacteria 1678
60 Ga0070671_100224812 3300005355 Bacteria 1593
61 Ga0070671_100380106 3300005355 Unclassified 1207
62 Ga0070671_100418725 3300005355 Bacteria 1147
63 Ga0070674_100067454 3300005356 Bacteria 2517
64 Ga0070673_100013439 3300005364 Bacteria 5663
65 Ga0070673_100046702 3300005364 Bacteria 3365
66 Ga0070688_100014764 3300005365 Bacteria 4431
67 Ga0070688_100161755 3300005365 Bacteria 1538
68 Ga0070688_101266949 3300005365 Bacteria 594
69 Ga0070659_100010312 3300005366 Bacteria 6871
70 Ga0070659_100016399 3300005366 Bacteria 5562
71 Ga0070659_100542339 3300005366 Bacteria 995
72 Ga0070659_101339365 3300005366 Unclassified 635
73 Ga0070667_100048085 3300005367 Bacteria 3590
74 Ga0070667_100134617 3300005367 Bacteria 2160
75 Ga0070667_100291850 3300005367 Unclassified 1467
76 Ga0070667_100375426 3300005367 Unclassified 1291
77 Ga0070667_100382352 3300005367 Bacteria 1279
78 Ga0070667_100549986 3300005367 Bacteria 1061
79 Ga0070667_100571966 3300005367 Bacteria 1040
80 Ga0070700_100149200 3300005441 Bacteria 1597
81 Ga0070663_100871696 3300005455 Bacteria 776
82 Ga0070678_100849680 3300005456 Bacteria 832
83 Ga0070678_101203505 3300005456 Unclassified 702
84 Ga0070662_100037920 3300005457 Bacteria 3420
85 Ga0070662_100040428 3300005457 Bacteria 3320
86 Ga0070662_100064897 3300005457 Bacteria 2675
87 Ga0070662_100329920 3300005457 Unclassified 1246
88 Ga0070662_100396119 3300005457 Bacteria 1139
89 Ga0068867_100029819 3300005459 Unclassified 3932
90 Ga0068867_100157041 3300005459 Unclassified 1791
91 Ga0070685_10005303 3300005466 Bacteria 6537
92 Ga0070685_10023789 3300005466 Bacteria 3358
93 Ga0070685_10072715 3300005466 Bacteria 2042
94 Ga0070685_10867958 3300005466 Bacteria 670
95 Ga0070698_100368894 3300005471 Bacteria 1368
96 Ga0070679_100001669 3300005530 Bacteria 20001
97 Ga0070679_100072746 3300005530 Bacteria 3430
98 Ga0070679_100202399 3300005530 Bacteria 1951
99 Ga0070684_100033579 3300005535 Bacteria 4383
100 Ga0070684_100142551 3300005535 Bacteria 2167
101 Ga0070684_100162601 3300005535 Bacteria 2026
102 Ga0070684_100413602 3300005535 Bacteria 1244
103 Ga0068853_100204623 3300005539 Bacteria 1797
104 Ga0068853_100952946 3300005539 Unclassified 825
105 Ga0070672_100012107 3300005543 Bacteria 6039
106 Ga0070672_100030549 3300005543 Bacteria 4049
107 Ga0070672_100394838 3300005543 Bacteria 1185
108 Ga0070686_100338207 3300005544 Bacteria 1127
109 Ga0070693_100011816 3300005547 Bacteria 4405
110 Ga0070665_100187203 3300005548 Unclassified 2071
111 Ga0068855_100021692 3300005563 Bacteria 7702
112 Ga0070664_100020843 3300005564 Bacteria 5400
113 Ga0070664_100207642 3300005564 Bacteria 1749
114 Ga0070664_100219817 3300005564 Bacteria 1699
115 Ga0070664_100455388 3300005564 Bacteria 1175
116 Ga0068857_100072547 3300005577 Bacteria 3068
117 Ga0068857_100159830 3300005577 Bacteria 2044
118 Ga0068857_100164143 3300005577 Bacteria 2016
119 Ga0068857_100201831 3300005577 Bacteria 1813
120 Ga0068854_100531237 3300005578 Bacteria 995
121 Ga0068854_101015115 3300005578 Bacteria 735
122 Ga0068854_101631687 3300005578 Bacteria 588
123 Ga0068856_100010791 3300005614 Bacteria 8871
124 Ga0068856_100582141 3300005614 Bacteria 1140
125 Ga0068852_100124536 3300005616 Bacteria 2364
126 Ga0068852_100247986 3300005616 Bacteria 1705
127 Ga0068852_100259260 3300005616 Bacteria 1669
128 Ga0068852_100269783 3300005616 Bacteria 1637
129 Ga0068852_101360128 3300005616 Unclassified 732
130 Ga0068859_100036389 3300005617 Bacteria 4942
131 Ga0068859_100097365 3300005617 Bacteria 2995
132 Ga0068859_100314802 3300005617 Bacteria 1659
133 Ga0068859_100333957 3300005617 Bacteria 1610
134 Ga0068864_100121378 3300005618 Bacteria 2337
135 Ga0068864_100330205 3300005618 Bacteria 1435
136 Ga0068864_100367349 3300005618 Bacteria 1361
137 Ga0068864_101086148 3300005618 Unclassified 796
138 Ga0068864_101171077 3300005618 Bacteria 767
139 Ga0068866_10124517 3300005718 Bacteria 1457
140 Ga0068866_10275613 3300005718 Unclassified 1040
141 Ga0068861_100274932 3300005719 Bacteria 1448
142 Ga0068861_100818947 3300005719 Bacteria 875
143 Ga0068851_10356125 3300005834 Bacteria 852
144 Ga0068851_10690800 3300005834 Unclassified 627
145 Ga0068863_100116821 3300005841 Bacteria 2542
146 Ga0068863_100384672 3300005841 Bacteria 1370
147 Ga0068863_101758474 3300005841 Bacteria 630
148 Ga0068858_100168485 3300005842 Bacteria 2064
149 Ga0068858_101393575 3300005842 Bacteria 690
150 Ga0068858_101488862 3300005842 Bacteria 667
151 Ga0068860_100000208 3300005843 Bacteria 92818
152 Ga0068860_100325868 3300005843 Bacteria 1508
153 Ga0068860_100401559 3300005843 Bacteria 1356
154 Ga0068862_100002386 3300005844 Bacteria 16697
155 Ga0068862_100154899 3300005844 Bacteria 2042
156 Ga0068862_100417671 3300005844 Bacteria 1258
157 Ga0068862_101404562 3300005844 Bacteria 701
158 Ga0075366_10015074 3300006195 Bacteria 4421
159 Ga0097621_100034699 3300006237 Bacteria 4025
160 Ga0097621_100352753 3300006237 Bacteria 1309
161 Ga0068871_100004104 3300006358 Bacteria 10072
162 Ga0068871_100056382 3300006358 Bacteria 3194
163 Ga0068871_100064632 3300006358 Bacteria 2996
164 Ga0068871_100266605 3300006358 Unclassified 1495
165 Ga0068871_100653775 3300006358 Bacteria 960
166 Ga0068871_100691219 3300006358 Bacteria 934
167 Ga0068871_101151376 3300006358 Bacteria 726
168 Ga0068865_100310331 3300006881 Bacteria 1265
169 Ga0068865_100507600 3300006881 Bacteria 1006
170 Ga0068865_101609815 3300006881 Bacteria 584
171 Ga0097620_100036393 3300006931 Bacteria 4942
172 Ga0097620_100097360 3300006931 Bacteria 2995
173 Ga0097620_100314799 3300006931 Bacteria 1659
174 Ga0097620_100333959 3300006931 Bacteria 1610
175 Ga0105240_10100782 3300009093 Bacteria 3514
176 Ga0111539_10004437 3300009094 Bacteria 18334
177 Ga0105245_11560029 3300009098 Bacteria 712
178 Ga0105247_10002616 3300009101 Bacteria 12154
179 Ga0105243_10766931 3300009148 Bacteria 947
180 Ga0105241_11747469 3300009174 Bacteria 606
181 Ga0105242_10888228 3300009176 Unclassified 890
182 Ga0105248_10177380 3300009177 Bacteria 2401
183 Ga0105237_10242020 3300009545 Bacteria 1805
184 Ga0105238_10026571 3300009551 Bacteria 5902
185 Ga0105238_10161864 3300009551 Bacteria 2214
186 Ga0105249_11314252 3300009553 Unclassified 795
187 Ga0105239_10000512 3300010375 Bacteria 56021
188 Ga0105239_10004896 3300010375 Bacteria 15837
189 Ga0105239_10409508 3300010375 Bacteria 1535
190 Ga0105239_10621410 3300010375 Bacteria 1233
191 Ga0105239_10795354 3300010375 Unclassified 1083
192 Ga0105239_11209951 3300010375 Bacteria 871
193 Ga0105246_10142844 3300011119 Bacteria 1802
194 Ga0157373_10026247 3300013100 Bacteria 4210
195 Ga0157373_10089628 3300013100 Bacteria 2166
196 Ga0157371_10013173 3300013102 Bacteria 6294
197 Ga0157371_10087508 3300013102 Bacteria 2206
198 Ga0157371_10088290 3300013102 Bacteria 2195
199 Ga0157371_10280347 3300013102 Unclassified 1204
200 Ga0157371_10507383 3300013102 Bacteria 891
201 Ga0157370_10048113 3300013104 Bacteria 4086
202 Ga0157370_10567942 3300013104 Bacteria 1039
203 Ga0157370_11331367 3300013104 Bacteria 647
204 Ga0157369_10029655 3300013105 Bacteria 6043
205 Ga0157369_10046459 3300013105 Bacteria 4718
206 Ga0157374_10002178 3300013296 Bacteria 16512
207 Ga0157374_10004802 3300013296 Bacteria 11344
208 Ga0157374_10053995 3300013296 Unclassified 3747
209 Ga0157374_10093338 3300013296 Bacteria 2873
210 Ga0157374_10336971 3300013296 Bacteria 1497
211 Ga0157378_10023979 3300013297 Bacteria 5367
212 Ga0157378_10066576 3300013297 Bacteria 3227
213 Ga0157378_10075858 3300013297 Unclassified 3028
214 Ga0157378_10389659 3300013297 Bacteria 1370
215 Ga0157378_10666577 3300013297 Bacteria 1057
216 Ga0157378_10707068 3300013297 Bacteria 1027
217 Ga0157378_11225882 3300013297 Bacteria 790
218 Ga0163162_10000720 3300013306 Bacteria 30718
219 Ga0163162_10002012 3300013306 Bacteria 19132
220 Ga0163162_10049356 3300013306 Bacteria 4217
221 Ga0163162_10102224 3300013306 Bacteria 2959
222 Ga0163162_10175339 3300013306 Bacteria 2269
223 Ga0163162_10203416 3300013306 Unclassified 2109
224 Ga0163162_10641567 3300013306 Bacteria 1186
225 Ga0163162_10928669 3300013306 Unclassified 982
226 Ga0157372_10147977 3300013307 Bacteria 2709
227 Ga0157372_10153263 3300013307 Bacteria 2661
228 Ga0157372_10163883 3300013307 Bacteria 2570
229 Ga0157372_10180627 3300013307 Bacteria 2443
230 Ga0157372_10183779 3300013307 Bacteria 2421
231 Ga0157372_10199376 3300013307 Bacteria 2318
232 Ga0157372_10582944 3300013307 Bacteria 1304
233 Ga0157372_10744150 3300013307 Bacteria 1140
234 Ga0157372_12544777 3300013307 Bacteria 587
235 Ga0157375_10037076 3300013308 Bacteria 4668
236 Ga0157375_10159462 3300013308 Bacteria 2397
237 Ga0157375_10359262 3300013308 Bacteria 1622
238 Ga0157375_11638822 3300013308 Unclassified 761
239 Ga0163163_10027308 3300014325 Bacteria 5466
240 Ga0163163_10040843 3300014325 Bacteria 4533
241 Ga0163163_10287041 3300014325 Bacteria 1697
242 Ga0163163_10369193 3300014325 Bacteria 1492
243 Ga0163163_10946751 3300014325 Bacteria 924
244 Ga0163163_11628676 3300014325 Bacteria 706
245 Ga0157380_10003909 3300014326 Bacteria 10276
246 Ga0157380_10111111 3300014326 Bacteria 2303
247 Ga0157380_10218273 3300014326 Unclassified 1704
248 Ga0157380_10487051 3300014326 Bacteria 1194
249 Ga0157377_10000298 3300014745 Bacteria 23299
250 Ga0157377_10001008 3300014745 Bacteria 11879
251 Ga0157377_10003813 3300014745 Bacteria 6851
252 Ga0157377_10007095 3300014745 Bacteria 5386
253 Ga0157377_10070706 3300014745 Bacteria 2016
254 Ga0157379_10064056 3300014968 Bacteria 3286
255 Ga0157379_10559652 3300014968 Bacteria 1064
256 Ga0157376_10027804 3300014969 Unclassified 4488
257 Ga0157376_10119318 3300014969 Bacteria 2335
258 Ga0157376_10287324 3300014969 Unclassified 1551
259 Ga0157376_10971045 3300014969 Bacteria 871
260 Ga0157376_12227196 3300014969 Bacteria 587
261 Ga0163161_10039754 3300017792 Bacteria 3378
262 Ga0163161_10126291 3300017792 Bacteria 1926
263 Ga0163161_10131186 3300017792 Bacteria 1890
264 Ga0207426_1000104 3300025302 Bacteria 249464
265 Ga0207697_10070510 3300025315 Bacteria 1464
266 Ga0207656_10069690 3300025321 Bacteria 1560
267 Ga0207656_10544957 3300025321 Unclassified 591
268 Ga0207710_10011070 3300025900 Bacteria 3799
269 Ga0207680_10138032 3300025903 Bacteria 1614
270 Ga0207680_10192441 3300025903 Unclassified 1385
271 Ga0207647_10000017 3300025904 Bacteria 129999
272 Ga0207647_10026035 3300025904 Bacteria 3832
273 Ga0207647_10027286 3300025904 Bacteria 3724
274 Ga0207645_10028336 3300025907 Bacteria 3615
275 Ga0207645_10032136 3300025907 Bacteria 3375
276 Ga0207645_10275127 3300025907 Bacteria 1117
277 Ga0207645_10507716 3300025907 Unclassified 817
278 Ga0207643_10006337 3300025908 Bacteria 6337
279 Ga0207643_10232140 3300025908 Bacteria 1132
280 Ga0207705_10072673 3300025909 Bacteria 2495
281 Ga0207654_10002051 3300025911 Bacteria 10337
282 Ga0207654_10121921 3300025911 Bacteria 1638
283 Ga0207707_10515902 3300025912 Unclassified 1018
284 Ga0207695_10000812 3300025913 Bacteria 58133
285 Ga0207695_10406515 3300025913 Bacteria 1246
286 Ga0207671_10004593 3300025914 Bacteria 13115
287 Ga0207671_10016344 3300025914 Bacteria 5771
288 Ga0207660_10094011 3300025917 Unclassified 2228
289 Ga0207660_10305557 3300025917 Bacteria 1267
290 Ga0207662_10341133 3300025918 Bacteria 1004
291 Ga0207657_10136724 3300025919 Bacteria 2005
292 Ga0207657_10187117 3300025919 Unclassified 1672
293 Ga0207649_10006393 3300025920 Bacteria 6399
294 Ga0207649_10052790 3300025920 Unclassified 2523
295 Ga0207649_10098031 3300025920 Bacteria 1934
296 Ga0207649_10102143 3300025920 Bacteria 1900
297 Ga0207649_10424668 3300025920 Bacteria 999
298 Ga0207652_10084815 3300025921 Bacteria 2775
299 Ga0207652_10168379 3300025921 Unclassified 1966
300 Ga0207681_10001036 3300025923 Bacteria 18044
301 Ga0207681_10026748 3300025923 Bacteria 3725
302 Ga0207681_10266302 3300025923 Bacteria 1344
303 Ga0207681_10316719 3300025923 Bacteria 1239
304 Ga0207694_10035599 3300025924 Bacteria 3820
305 Ga0207694_10073797 3300025924 Bacteria 2670
306 Ga0207694_10136058 3300025924 Bacteria 1973
307 Ga0207650_10038223 3300025925 Bacteria 3503
308 Ga0207650_10516551 3300025925 Unclassified 999
309 Ga0207659_10077791 3300025926 Bacteria 2443
310 Ga0207644_10073551 3300025931 Bacteria 2506
311 Ga0207644_10114070 3300025931 Bacteria 2047
312 Ga0207644_10200983 3300025931 Bacteria 1572
313 Ga0207644_10331123 3300025931 Unclassified 1233
314 Ga0207644_10368740 3300025931 Bacteria 1169
315 Ga0207690_10161572 3300025932 Bacteria 1670
316 Ga0207706_10010123 3300025933 Bacteria 8634
317 Ga0207706_10020243 3300025933 Bacteria 5980
318 Ga0207706_10056135 3300025933 Bacteria 3473
319 Ga0207706_10059146 3300025933 Bacteria 3375
320 Ga0207706_10397810 3300025933 Bacteria 1195
321 Ga0207706_10444090 3300025933 Bacteria 1122
322 Ga0207670_10015116 3300025936 Bacteria 4603
323 Ga0207670_10105316 3300025936 Bacteria 2022
324 Ga0207669_10231244 3300025937 Bacteria 1364
325 Ga0207704_10074919 3300025938 Bacteria 2162
326 Ga0207691_10026801 3300025940 Bacteria 5409
327 Ga0207691_10114078 3300025940 Bacteria 2401
328 Ga0207691_10429362 3300025940 Bacteria 1125
329 Ga0207691_11030096 3300025940 Bacteria 686
330 Ga0207689_10003442 3300025942 Bacteria 14448
331 Ga0207689_10005404 3300025942 Bacteria 11435
332 Ga0207689_10186456 3300025942 Bacteria 1711
333 Ga0207661_10006349 3300025944 Bacteria 8361
334 Ga0207661_10133975 3300025944 Bacteria 2126
335 Ga0207679_10011639 3300025945 Bacteria 5709
336 Ga0207679_10107032 3300025945 Unclassified 2199
337 Ga0207679_10168027 3300025945 Bacteria 1803
338 Ga0207679_10434192 3300025945 Unclassified 1161
339 Ga0207679_10442980 3300025945 Bacteria 1151
340 Ga0207667_10004214 3300025949 Bacteria 17648
341 Ga0207667_10034142 3300025949 Bacteria 5465
342 Ga0207667_10063017 3300025949 Bacteria 3875
343 Ga0207667_11228788 3300025949 Bacteria 728
344 Ga0207651_10090266 3300025960 Bacteria 2239
345 Ga0207651_10696727 3300025960 Unclassified 895
346 Ga0207651_11525006 3300025960 Bacteria 602
347 Ga0207668_10302416 3300025972 Bacteria 1321
348 Ga0207640_10200068 3300025981 Bacteria 1513
349 Ga0207640_11266226 3300025981 Bacteria 657
350 Ga0207658_10106070 3300025986 Bacteria 2211
351 Ga0207658_10112901 3300025986 Bacteria 2152
352 Ga0207658_10206912 3300025986 Bacteria 1642
353 Ga0207658_11804520 3300025986 Bacteria 558
354 Ga0207677_10019680 3300026023 Bacteria 4082
355 Ga0207677_10040991 3300026023 Unclassified 3058
356 Ga0207677_10053393 3300026023 Bacteria 2751
357 Ga0207677_10109701 3300026023 Bacteria 2052
358 Ga0207677_10332276 3300026023 Bacteria 1267
359 Ga0207703_10026615 3300026035 Bacteria 4554
360 Ga0207703_10292477 3300026035 Unclassified 1483
361 Ga0207703_10416850 3300026035 Bacteria 1249
362 Ga0207639_10039138 3300026041 Bacteria 3531
363 Ga0207639_10058100 3300026041 Bacteria 2973
364 Ga0207639_10616618 3300026041 Bacteria 1001
365 Ga0207639_10625948 3300026041 Bacteria 994
366 Ga0207708_10343769 3300026075 Bacteria 1222
367 Ga0207702_10716043 3300026078 Unclassified 987
368 Ga0207641_10147053 3300026088 Bacteria 2132
369 Ga0207641_10244737 3300026088 Bacteria 1673
370 Ga0207641_11175732 3300026088 Bacteria 766
371 Ga0207648_10006964 3300026089 Bacteria 11188
372 Ga0207648_10105691 3300026089 Unclassified 2470
373 Ga0207648_10208617 3300026089 Bacteria 1734
374 Ga0207648_10583619 3300026089 Bacteria 1029
375 Ga0207648_10737056 3300026089 Bacteria 915
376 Ga0207676_10010717 3300026095 Bacteria 6535
377 Ga0207676_10093906 3300026095 Bacteria 2471
378 Ga0207676_10220694 3300026095 Bacteria 1688
379 Ga0207676_10239865 3300026095 Unclassified 1626
380 Ga0207676_10298557 3300026095 Bacteria 1470
381 Ga0207676_10370464 3300026095 Bacteria 1330
382 Ga0207674_10005277 3300026116 Bacteria 15380
383 Ga0207674_10031945 3300026116 Bacteria 5526
384 Ga0207674_10066133 3300026116 Bacteria 3642
385 Ga0207674_10225385 3300026116 Bacteria 1823
386 Ga0207674_10296674 3300026116 Unclassified 1565
387 Ga0207675_100012681 3300026118 Bacteria 7876
388 Ga0207675_100273668 3300026118 Bacteria 1639
389 Ga0207675_100275871 3300026118 Bacteria 1633
390 Ga0207675_101985235 3300026118 Bacteria 599
391 Ga0207683_10165951 3300026121 Bacteria 1998
392 Ga0207683_10190739 3300026121 Bacteria 1861
393 Ga0207698_10001327 3300026142 Bacteria 14436
394 Ga0207698_10014648 3300026142 Bacteria 5221
395 Ga0207698_10057767 3300026142 Bacteria 3004
396 Ga0207698_10079806 3300026142 Bacteria 2633
397 Ga0207698_10084598 3300026142 Bacteria 2572
398 Ga0207698_10249207 3300026142 Bacteria 1624
399 Ga0207698_10266822 3300026142 Bacteria 1576
400 Ga0207698_10287430 3300026142 Bacteria 1524
401 Ga0207698_11642892 3300026142 Bacteria 658
402 Ga0209984_1004645 3300027424 Bacteria 1625
403 Ga0268266_10113698 3300028379 Bacteria 2401
404 Ga0268265_10002964 3300028380 Bacteria 12424
405 Ga0268265_10674092 3300028380 Bacteria 996
406 Ga0268265_10905843 3300028380 Bacteria 866
407 Ga0268264_10000041 3300028381 Bacteria 372501
408 Ga0268264_10005687 3300028381 Bacteria 10572
409 Ga0268264_10532430 3300028381 Unclassified 1150
410 Ga0268264_10581612 3300028381 Bacteria 1102
411 Ga0307517_10204680 3300028786 Bacteria 1227
412 Ga0307515_10000002 3300028794 Bacteria 1231751
413 Ga0307515_10433288 3300028794 Bacteria 933
414 Ga0265327_10044441 3300031251 Unclassified 2369
415 Ga0265327_10069589 3300031251 Bacteria 1766
416 Ga0265327_10086620 3300031251 Bacteria 1536
417 Ga0307509_10033540 3300031507 Bacteria 5650
418 Ga0307509_10193307 3300031507 Bacteria 1883
419 Ga0307516_10001744 3300031730 Bacteria 29907
420 Ga0307413_10011514 3300031824 Bacteria 4357
421 Ga0307413_10450215 3300031824 Unclassified 1022
422 Ga0307410_10124624 3300031852 Bacteria 1884
423 Ga0307406_10267772 3300031901 Bacteria 1296
424 Ga0307407_10087340 3300031903 Bacteria 1902
425 Ga0307407_11040971 3300031903 Bacteria 634
426 Ga0307412_10811117 3300031911 Bacteria 813
427 Ga0307409_102450165 3300031995 Bacteria 551
428 Ga0307416_100632955 3300032002 Bacteria 1153
429 Ga0307414_10147137 3300032004 Bacteria 1853
430 Ga0307414_10307598 3300032004 Bacteria 1344
431 Ga0307414_10323435 3300032004 Bacteria 1314
432 Ga0307411_10237715 3300032005 Bacteria 1424
433 Ga0307415_100044819 3300032126 Bacteria 2960
434 Ga0373924_0124260 3300035410 Bacteria 1121
435 Ga0373935_0066987 3300035692 Unclassified 2308
436 Ga0395898_0482584 3300037466 Unclassified 1179
437 Ga0395905_0093250 3300037471 Bacteria 2824
438 Ga0436363_1035999 3300039450 Bacteria 627
439 Ga0451798_0385226 3300041458 Bacteria 673
440 Ga0451807_1020963 3300041486 Unclassified 633
441 Ga0451843_1306672 3300041509 Unclassified 670
442 Ga0451853_0313981 3300041512 Bacteria 771
443 Ga0439433_0033093 3300041999 Bacteria 1187
444 Ga0439449_0186810 3300042007 Bacteria 775
445 Ga0439457_126571 3300042014 Bacteria 606
446 Ga0439462_0085775 3300042015 Bacteria 862
447 Ga0450898_034975 3300042134 Bacteria 934
448 Ga0451577_0456328 3300042876 Bacteria 1161
449 Ga0466965_0391372 3300044683 Bacteria 767
450 Ga0466966_0000091 3300044684 Bacteria 56015
451 Ga0466961_0167961 3300044693 Bacteria 1365
452 Ga0466964_0041361 3300044706 Bacteria 1864
453 Ga0453684_0081904 3300044712 Bacteria 4023
454 Ga0466971_0186681 3300044719 Bacteria 976
455 Ga0466957_0008278 3300044842 Bacteria 5911
456 Ga0466959_0000002 3300045049 Bacteria 362671
457 Ga0466959_0046963 3300045049 Bacteria 3177
458 Ga0466967_0109166 3300045976 Bacteria 2540
459 Ga0466967_0552765 3300045976 Bacteria 1133
460 Ga0466967_1461886 3300045976 Bacteria 681
461 Ga0495638_0061375 3300046460 Bacteria 2323
462 Ga0495650_0150173 3300046471 Bacteria 837
463 Ga0495648_0006558 3300046524 Bacteria 9469
464 Ga0495611_0000235 3300046648 Bacteria 38170
465 Ga0495611_0058650 3300046648 Bacteria 1746
466 Ga0495687_000001 3300047443 Bacteria 1215582
467 Ga0495686_0000004 3300047472 Bacteria 869019
468 Ga0495686_0159239 3300047472 Bacteria 1320
469 Ga0495686_0650371 3300047472 Bacteria 542
470 Ga0496108_1289428 3300048911 Bacteria 615
471 Ga0496115_0710666 3300048918 Bacteria 789
472 Ga0501033_0681294 3300049570 Bacteria 701
473 Ga0501034_0000043 3300049571 Bacteria 229049
474 Ga0501034_0078266 3300049571 Unclassified 3311
475 Ga0501034_0830559 3300049571 Bacteria 815
476 Ga0501037_0108310 3300049573 Bacteria 2002
477 Ga0501037_0225749 3300049573 Unclassified 1316
478 Ga0501043_0686824 3300049579 Bacteria 749
479 Ga0501207_008076 3300049654 Bacteria 1515
480 Ga0501209_157743 3300049656 Bacteria 685
481 Ga0501223_011085 3300049663 Bacteria 1809
482 Ga0501233_089579 3300049668 Bacteria 802
483 Ga0501235_041736 3300049669 Bacteria 1050
484 Ga0501247_073022 3300049677 Bacteria 544
485 Ga0501251_019153 3300049681 Bacteria 895
486 Ga0501253_088207 3300049683 Bacteria 710
487 Ga0501219_000268 3300049703 Bacteria 9256
488 Ga0501225_0009949 3300049705 Bacteria 2700
489 Ga0501225_0146477 3300049705 Bacteria 717
490 Ga0501080_0479980 3300049742 Bacteria 1112
491 Ga0501266_001374 3300049763 Bacteria 3110
492 Ga0501272_005972 3300049769 Bacteria 1295
493 Ga0501274_006003 3300049771 Bacteria 1040
494 Ga0501035_0361448 3300049822 Unclassified 1213
495 Ga0501284_00127 3300050005 Bacteria 11013
496 Ga0501284_02019 3300050005 Bacteria 1101
497 nmdc:mga08y16_944433_c1 3300050511 Unclassified 846
498 Ga0500583_0022877 3300053092 Bacteria 2626
499 Ga0500651_0786434 3300053093 Bacteria 503
500 Ga0500642_0056474 3300053130 Bacteria 1749
501 Ga0500652_007659 3300053131 Bacteria 3550
502 Ga0500559_0061563 3300053136 Bacteria 1674
503 Ga0500568_0030374 3300053139 Bacteria 2237
504 Ga0466962_0109459 3300061719 Bacteria 1330
505 Ga0068852_100191995
506 SwRhRL2b_contig_1762647
507 JGI24736J21556_1017141
508 rootH2_10049983
509 rootH1_10300104
510 rootH1_10349153
511 JGI25160J50197_1001628
512 Ga0065704_10070151
513 Ga0065707_10236673
514 Ga0070658_10706254
515 Ga0070658_11286222
516 Ga0070676_10094648
517 Ga0070683_100004323
518 Ga0070683_100005740
519 Ga0070683_100036026
520 Ga0070690_100029110
521 Ga0070690_100229488
522 Ga0070690_100895131
523 Ga0070670_100099146
524 Ga0070670_100139328
525 Ga0070670_101279721
526 Ga0070670_101362531
527 Ga0068869_100038316
528 Ga0068869_100063992
529 Ga0070666_10246039
530 Ga0070666_10406723
531 Ga0070680_100238146
532 Ga0070680_100482425
533 Ga0070682_100632771
534 Ga0068868_100006708
535 Ga0068868_100019026
536 Ga0068868_100103139
537 Ga0068868_100237819
538 Ga0068868_101407653
539 Ga0070660_100136611
540 Ga0070660_100321490
541 Ga0070660_100652928
542 Ga0070689_100022336
543 Ga0070689_100049370
544 Ga0070689_100063344
545 Ga0070689_100578884
546 Ga0070661_100015611
547 Ga0070661_100047008
548 Ga0070661_100053672
549 Ga0070661_100094517
550 Ga0070661_100299170
551 Ga0070669_100018773
552 Ga0070669_100068467
553 Ga0070669_100852890
554 Ga0070675_100012102
555 Ga0070675_100013522
556 Ga0070675_100066470
557 Ga0070675_100102464
558 Ga0070675_100166220
559 Ga0070675_100250519
560 Ga0070675_100934811
561 Ga0070671_100007985
562 Ga0070671_100115067
563 Ga0070671_100203787
564 Ga0070671_100224812
565 Ga0070671_100380106
566 Ga0070671_100418725
567 Ga0070674_100067454
568 Ga0070673_100013439
569 Ga0070673_100046702
570 Ga0070688_100014764
571 Ga0070688_100161755
572 Ga0070688_101266949
573 Ga0070659_100010312
574 Ga0070659_100016399
575 Ga0070659_100542339
576 Ga0070659_101339365
577 Ga0070667_100048085
578 Ga0070667_100134617
579 Ga0070667_100291850
580 Ga0070667_100375426
581 Ga0070667_100382352
582 Ga0070667_100549986
583 Ga0070667_100571966
584 Ga0070700_100149200
585 Ga0070663_100871696
586 Ga0070678_100849680
587 Ga0070678_101203505
588 Ga0070662_100037920
589 Ga0070662_100040428
590 Ga0070662_100064897
591 Ga0070662_100329920
592 Ga0070662_100396119
593 Ga0068867_100029819
594 Ga0068867_100157041
595 Ga0070685_10005303
596 Ga0070685_10023789
597 Ga0070685_10072715
598 Ga0070685_10867958
599 Ga0070698_100368894
600 Ga0070679_100001669
601 Ga0070679_100072746
602 Ga0070679_100202399
603 Ga0070684_100033579
604 Ga0070684_100142551
605 Ga0070684_100162601
606 Ga0070684_100413602
607 Ga0068853_100204623
608 Ga0068853_100952946
609 Ga0070672_100012107
610 Ga0070672_100030549
611 Ga0070672_100394838
612 Ga0070686_100338207
613 Ga0070693_100011816
614 Ga0070665_100187203
615 Ga0068855_100021692
616 Ga0070664_100020843
617 Ga0070664_100207642
618 Ga0070664_100219817
619 Ga0070664_100455388
620 Ga0068857_100072547
621 Ga0068857_100159830
622 Ga0068857_100164143
623 Ga0068857_100201831
624 Ga0068854_100531237
625 Ga0068854_101015115
626 Ga0068854_101631687
627 Ga0068856_100010791
628 Ga0068856_100582141
629 Ga0068852_100124536
630 Ga0068852_100247986
631 Ga0068852_100259260
632 Ga0068852_100269783
633 Ga0068852_101360128
634 Ga0068859_100036389
635 Ga0068859_100097365
636 Ga0068859_100314802
637 Ga0068859_100333957
638 Ga0068864_100121378
639 Ga0068864_100330205
640 Ga0068864_100367349
641 Ga0068864_101086148
642 Ga0068864_101171077
643 Ga0068866_10124517
644 Ga0068866_10275613
645 Ga0068861_100274932
646 Ga0068861_100818947
647 Ga0068851_10356125
648 Ga0068851_10690800
649 Ga0068863_100116821
650 Ga0068863_100384672
651 Ga0068863_101758474
652 Ga0068858_100168485
653 Ga0068858_101393575
654 Ga0068858_101488862
655 Ga0068860_100000208
656 Ga0068860_100325868
657 Ga0068860_100401559
658 Ga0068862_100002386
659 Ga0068862_100154899
660 Ga0068862_100417671
661 Ga0068862_101404562
662 Ga0075366_10015074
663 Ga0097621_100034699
664 Ga0097621_100352753
665 Ga0068871_100004104
666 Ga0068871_100056382
667 Ga0068871_100064632
668 Ga0068871_100266605
669 Ga0068871_100653775
670 Ga0068871_100691219
671 Ga0068871_101151376
672 Ga0068865_100310331
673 Ga0068865_100507600
674 Ga0068865_101609815
675 Ga0097620_100036393
676 Ga0097620_100097360
677 Ga0097620_100314799
678 Ga0097620_100333959
679 Ga0105240_10100782
680 Ga0111539_10004437
681 Ga0105245_11560029
682 Ga0105247_10002616
683 Ga0105243_10766931
684 Ga0105241_11747469
685 Ga0105242_10888228
686 Ga0105248_10177380
687 Ga0105237_10242020
688 Ga0105238_10026571
689 Ga0105238_10161864
690 Ga0105249_11314252
691 Ga0105239_10000512
692 Ga0105239_10004896
693 Ga0105239_10409508
694 Ga0105239_10621410
695 Ga0105239_10795354
696 Ga0105239_11209951
697 Ga0105246_10142844
698 Ga0157373_10026247
699 Ga0157373_10089628
700 Ga0157371_10013173
701 Ga0157371_10087508
702 Ga0157371_10088290
703 Ga0157371_10280347
704 Ga0157371_10507383
705 Ga0157370_10048113
706 Ga0157370_10567942
707 Ga0157370_11331367
708 Ga0157369_10029655
709 Ga0157369_10046459
710 Ga0157374_10002178
711 Ga0157374_10004802
712 Ga0157374_10053995
713 Ga0157374_10093338
714 Ga0157374_10336971
715 Ga0157378_10023979
716 Ga0157378_10066576
717 Ga0157378_10075858
718 Ga0157378_10389659
719 Ga0157378_10666577
720 Ga0157378_10707068
721 Ga0157378_11225882
722 Ga0163162_10000720
723 Ga0163162_10002012
724 Ga0163162_10049356
725 Ga0163162_10102224
726 Ga0163162_10175339
727 Ga0163162_10203416
728 Ga0163162_10641567
729 Ga0163162_10928669
730 Ga0157372_10147977
731 Ga0157372_10153263
732 Ga0157372_10163883
733 Ga0157372_10180627
734 Ga0157372_10183779
735 Ga0157372_10199376
736 Ga0157372_10582944
737 Ga0157372_10744150
738 Ga0157372_12544777
739 Ga0157375_10037076
740 Ga0157375_10159462
741 Ga0157375_10359262
742 Ga0157375_11638822
743 Ga0163163_10027308
744 Ga0163163_10040843
745 Ga0163163_10287041
746 Ga0163163_10369193
747 Ga0163163_10946751
748 Ga0163163_11628676
749 Ga0157380_10003909
750 Ga0157380_10111111
751 Ga0157380_10218273
752 Ga0157380_10487051
753 Ga0157377_10000298
754 Ga0157377_10001008
755 Ga0157377_10003813
756 Ga0157377_10007095
757 Ga0157377_10070706
758 Ga0157379_10064056
759 Ga0157379_10559652
760 Ga0157376_10027804
761 Ga0157376_10119318
762 Ga0157376_10287324
763 Ga0157376_10971045
764 Ga0157376_12227196
765 Ga0163161_10039754
766 Ga0163161_10126291
767 Ga0163161_10131186
768 Ga0207426_1000104
769 Ga0207697_10070510
770 Ga0207656_10069690
771 Ga0207656_10544957
772 Ga0207710_10011070
773 Ga0207680_10138032
774 Ga0207680_10192441
775 Ga0207647_10000017
776 Ga0207647_10026035
777 Ga0207647_10027286
778 Ga0207645_10028336
779 Ga0207645_10032136
780 Ga0207645_10275127
781 Ga0207645_10507716
782 Ga0207643_10006337
783 Ga0207643_10232140
784 Ga0207705_10072673
785 Ga0207654_10002051
786 Ga0207654_10121921
787 Ga0207707_10515902
788 Ga0207695_10000812
789 Ga0207695_10406515
790 Ga0207671_10004593
791 Ga0207671_10016344
792 Ga0207660_10094011
793 Ga0207660_10305557
794 Ga0207662_10341133
795 Ga0207657_10136724
796 Ga0207657_10187117
797 Ga0207649_10006393
798 Ga0207649_10052790
799 Ga0207649_10098031
800 Ga0207649_10102143
801 Ga0207649_10424668
802 Ga0207652_10084815
803 Ga0207652_10168379
804 Ga0207681_10001036
805 Ga0207681_10026748
806 Ga0207681_10266302
807 Ga0207681_10316719
808 Ga0207694_10035599
809 Ga0207694_10073797
810 Ga0207694_10136058
811 Ga0207650_10038223
812 Ga0207650_10516551
813 Ga0207659_10077791
814 Ga0207644_10073551
815 Ga0207644_10114070
816 Ga0207644_10200983
817 Ga0207644_10331123
818 Ga0207644_10368740
819 Ga0207690_10161572
820 Ga0207706_10010123
821 Ga0207706_10020243
822 Ga0207706_10056135
823 Ga0207706_10059146
824 Ga0207706_10397810
825 Ga0207706_10444090
826 Ga0207670_10015116
827 Ga0207670_10105316
828 Ga0207669_10231244
829 Ga0207704_10074919
830 Ga0207691_10026801
831 Ga0207691_10114078
832 Ga0207691_10429362
833 Ga0207691_11030096
834 Ga0207689_10003442
835 Ga0207689_10005404
836 Ga0207689_10186456
837 Ga0207661_10006349
838 Ga0207661_10133975
839 Ga0207679_10011639
840 Ga0207679_10107032
841 Ga0207679_10168027
842 Ga0207679_10434192
843 Ga0207679_10442980
844 Ga0207667_10004214
845 Ga0207667_10034142
846 Ga0207667_10063017
847 Ga0207667_11228788
848 Ga0207651_10090266
849 Ga0207651_10696727
850 Ga0207651_11525006
851 Ga0207668_10302416
852 Ga0207640_10200068
853 Ga0207640_11266226
854 Ga0207658_10106070
855 Ga0207658_10112901
856 Ga0207658_10206912
857 Ga0207658_11804520
858 Ga0207677_10019680
859 Ga0207677_10040991
860 Ga0207677_10053393
861 Ga0207677_10109701
862 Ga0207677_10332276
863 Ga0207703_10026615
864 Ga0207703_10292477
865 Ga0207703_10416850
866 Ga0207639_10039138
867 Ga0207639_10058100
868 Ga0207639_10616618
869 Ga0207639_10625948
870 Ga0207708_10343769
871 Ga0207702_10716043
872 Ga0207641_10147053
873 Ga0207641_10244737
874 Ga0207641_11175732
875 Ga0207648_10006964
876 Ga0207648_10105691
877 Ga0207648_10208617
878 Ga0207648_10583619
879 Ga0207648_10737056
880 Ga0207676_10010717
881 Ga0207676_10093906
882 Ga0207676_10220694
883 Ga0207676_10239865
884 Ga0207676_10298557
885 Ga0207676_10370464
886 Ga0207674_10005277
887 Ga0207674_10031945
888 Ga0207674_10066133
889 Ga0207674_10225385
890 Ga0207674_10296674
891 Ga0207675_100012681
892 Ga0207675_100273668
893 Ga0207675_100275871
894 Ga0207675_101985235
895 Ga0207683_10165951
896 Ga0207683_10190739
897 Ga0207698_10001327
898 Ga0207698_10014648
899 Ga0207698_10057767
900 Ga0207698_10079806
901 Ga0207698_10084598
902 Ga0207698_10249207
903 Ga0207698_10266822
904 Ga0207698_10287430
905 Ga0207698_11642892
906 Ga0209984_1004645
907 Ga0268266_10113698
908 Ga0268265_10002964
909 Ga0268265_10674092
910 Ga0268265_10905843
911 Ga0268264_10000041
912 Ga0268264_10005687
913 Ga0268264_10532430
914 Ga0268264_10581612
915 Ga0307517_10204680
916 Ga0307515_10000002
917 Ga0307515_10433288
918 Ga0265327_10044441
919 Ga0265327_10069589
920 Ga0265327_10086620
921 Ga0307509_10033540
922 Ga0307509_10193307
923 Ga0307516_10001744
924 Ga0307413_10011514
925 Ga0307413_10450215
926 Ga0307410_10124624
927 Ga0307406_10267772
928 Ga0307407_10087340
929 Ga0307407_11040971
930 Ga0307412_10811117
931 Ga0307409_102450165
932 Ga0307416_100632955
933 Ga0307414_10147137
934 Ga0307414_10307598
935 Ga0307414_10323435
936 Ga0307411_10237715
937 Ga0307415_100044819
938 Ga0373924_0124260
939 Ga0373935_0066987
940 Ga0395898_0482584
941 Ga0395905_0093250
942 Ga0436363_1035999
943 Ga0451798_0385226
944 Ga0451807_1020963
945 Ga0451843_1306672
946 Ga0451853_0313981
947 Ga0439433_0033093
948 Ga0439449_0186810
949 Ga0439457_126571
950 Ga0439462_0085775
951 Ga0450898_034975
952 Ga0451577_0456328
953 Ga0466965_0391372
954 Ga0466966_0000091
955 Ga0466961_0167961
956 Ga0466964_0041361
957 Ga0453684_0081904
958 Ga0466971_0186681
959 Ga0466957_0008278
960 Ga0466959_0000002
961 Ga0466959_0046963
962 Ga0466967_0109166
963 Ga0466967_0552765
964 Ga0466967_1461886
965 Ga0495638_0061375
966 Ga0495650_0150173
967 Ga0495648_0006558
968 Ga0495611_0000235
969 Ga0495611_0058650
970 Ga0495687_000001
971 Ga0495686_0000004
972 Ga0495686_0159239
973 Ga0495686_0650371
974 Ga0496108_1289428
975 Ga0496115_0710666
976 Ga0501033_0681294
977 Ga0501034_0000043
978 Ga0501034_0078266
979 Ga0501034_0830559
980 Ga0501037_0108310
981 Ga0501037_0225749
982 Ga0501043_0686824
983 Ga0501207_008076
984 Ga0501209_157743
985 Ga0501223_011085
986 Ga0501233_089579
987 Ga0501235_041736
988 Ga0501247_073022
989 Ga0501251_019153
990 Ga0501253_088207
991 Ga0501219_000268
992 Ga0501225_0009949
993 Ga0501225_0146477
994 Ga0501080_0479980
995 Ga0501266_001374
996 Ga0501272_005972
997 Ga0501274_006003
998 Ga0501035_0361448
999 Ga0501284_00127
1000 Ga0501284_02019
1001 nmdc:mga08y16_944433_c1
1002 Ga0500583_0022877
1003 Ga0500651_0786434
1004 Ga0500642_0056474
1005 Ga0500652_007659
1006 Ga0500559_0061563
1007 Ga0500568_0030374
1008 Ga0466962_0109459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

35

173

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h08-assembly1.cif.gz_A crystal structure of the ribonuclease h1 from chlorobium tepidum 0.9669 3 140
3h08-assembly2.cif.gz_B crystal structure of the ribonuclease h1 from chlorobium tepidum 0.958 3 140
1g15-assembly1.cif.gz_A co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site 0.9513 3 150
1jl2-assembly1.cif.gz_B crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h 0.9494 3 149
3h08-assembly1.cif.gz_A crystal structure of the ribonuclease h1 from chlorobium tepidum 0.9465 3 140
ID Description Score Start End Superfamily
af_A0A0R0EHL2_85_153_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9553 1 58 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9311 3 150 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9244 3 150 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9211 3 149 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.909 3 149 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3D0FQW3-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9972 4 139 GO:0003676
GO:0004523
GO:0043137
AF-A0A1F3E8I0-F1-model_v4 Ribonuclease HI 0.9968 8 113 GO:0003676
GO:0004523
AF-A0A832F4Y0-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.996 8 152 GO:0003676
GO:0004523
GO:0043137
AF-A0A2M8FTY5-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9953 3 152 GO:0003676
GO:0004523
GO:0043137
AF-A0A1I2VFF9-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9939 2 152 GO:0003676
GO:0004523
GO:0043137

Map