F456069

General Info

Members Datasets Scaffolds Average Seq Length
503 235 502 219

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000132|Ga0495638_0000132_98700_99356
Length 218
Sequence MRKIQVITLFPDMFSGVFNSSMLWKAQNKQIVEFKLIDLRQFGLGPRRQVDDTPYGGGDGMLLKPEPLFAAVAAAKSYDPNARVLLMTPRGERWRQALAQQWANEEAAGLIVICGRYEGYDERITAVVDAQFSVGDYVLTGGELPAMTIIDSIVRLIPGVLGGEASAEIESFSDGETLEFPQYTRPEEFEGIKVPEVLLSGNHAAIEAWRIEQSKKAS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
67 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
68 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
69 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
122 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
123 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
124 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
125 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
226 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
230 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
231 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
232 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
233 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.64
Nodule 0
Rhizoplane 1.19
Rhizosphere 68.79
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6117524 2162886012 Bacteria 3487
2 JGI24740J21852_10027231 3300001979 Bacteria 1904
3 JGI24737J22298_10002203 3300001990 Bacteria 6943
4 JGI24735J21928_10000149 3300002067 Bacteria 24660
5 JGI24738J21930_10001791 3300002075 Bacteria 5840
6 JGI24742J22300_10000035 3300002244 Bacteria 20678
7 rootH1_10002936 3300003316 Bacteria 45055
8 rootH2_10006847 3300003320 Bacteria 155484
9 rootL2_10079259 3300003322 Bacteria 1463
10 rootL2_10094401 3300003322 Bacteria 4065
11 rootL2_10168822 3300003322 Bacteria 2123
12 rootL2_10202443 3300003322 Bacteria 3213
13 rootL2_10256332 3300003322 Bacteria 4977
14 rootL2_10315181 3300003322 Unclassified 1784
15 rootH1_10030295 3300003323 Bacteria 20195
16 rootH1_10131014 3300003323 Unclassified 1920
17 rootH1_10311088 3300003323 Bacteria 4960
18 Ga0065715_10003451 3300005293 Bacteria 5227
19 Ga0070658_10000024 3300005327 Bacteria 175873
20 Ga0070658_10568127 3300005327 Bacteria 982
21 Ga0070676_10004851 3300005328 Bacteria 7119
22 Ga0070683_100000112 3300005329 Bacteria 53123
23 Ga0070683_100010750 3300005329 Bacteria 7874
24 Ga0070680_100012114 3300005336 Bacteria 6695
25 Ga0070682_100006184 3300005337 Bacteria 6708
26 Ga0070660_100000298 3300005339 Bacteria 33050
27 Ga0070660_100000316 3300005339 Bacteria 31842
28 Ga0070660_100096723 3300005339 Unclassified 2335
29 Ga0070660_100336081 3300005339 Bacteria 1242
30 Ga0070691_10011663 3300005341 Bacteria 4018
31 Ga0070661_100093549 3300005344 Bacteria 2227
32 Ga0070674_100005409 3300005356 Bacteria 7373
33 Ga0070673_100000033 3300005364 Bacteria 60744
34 Ga0070659_100000672 3300005366 Bacteria 24887
35 Ga0070659_100089113 3300005366 Bacteria 2471
36 Ga0070667_100026048 3300005367 Bacteria 4863
37 Ga0070678_100000201 3300005456 Bacteria 26383
38 Ga0070678_100003010 3300005456 Bacteria 9340
39 Ga0070662_100009029 3300005457 Bacteria 6502
40 Ga0070662_100369986 3300005457 Bacteria 1178
41 Ga0070681_10030790 3300005458 Bacteria 5385
42 Ga0068867_100008780 3300005459 Bacteria 7137
43 Ga0070685_10000690 3300005466 Bacteria 18276
44 Ga0070679_100020035 3300005530 Bacteria 6518
45 Ga0070679_100023675 3300005530 Bacteria 6015
46 Ga0070679_100124601 3300005530 Unclassified 2559
47 Ga0070679_100170654 3300005530 Bacteria 2148
48 Ga0070684_100000049 3300005535 Bacteria 79768
49 Ga0070684_100046576 3300005535 Bacteria 3757
50 Ga0070686_100019349 3300005544 Bacteria 4010
51 Ga0070686_100143965 3300005544 Bacteria 1662
52 Ga0070686_100470098 3300005544 Unclassified 970
53 Ga0068855_100000002 3300005563 Bacteria 616881
54 Ga0068855_100000558 3300005563 Bacteria 45648
55 Ga0068855_100000663 3300005563 Bacteria 41994
56 Ga0068855_100003761 3300005563 Bacteria 18553
57 Ga0068855_100042951 3300005563 Bacteria 5356
58 Ga0068855_101133363 3300005563 Unclassified 816
59 Ga0070664_100000123 3300005564 Bacteria 51444
60 Ga0070664_100033858 3300005564 Bacteria 4283
61 Ga0068857_100000002 3300005577 Bacteria 241401
62 Ga0068857_100000441 3300005577 Bacteria 29474
63 Ga0068857_100021011 3300005577 Bacteria 5744
64 Ga0068857_100067343 3300005577 Bacteria 3187
65 Ga0068857_100137169 3300005577 Bacteria 2209
66 Ga0068854_100097044 3300005578 Bacteria 2203
67 Ga0068854_100130351 3300005578 Bacteria 1919
68 Ga0068856_100000001 3300005614 Bacteria 565602
69 Ga0068856_100000027 3300005614 Bacteria 133290
70 Ga0068856_100000200 3300005614 Bacteria 63772
71 Ga0068856_100088978 3300005614 Bacteria 3070
72 Ga0068856_100124656 3300005614 Unclassified 2579
73 Ga0068856_100593876 3300005614 Bacteria 1128
74 Ga0068852_100000001 3300005616 Bacteria 716526
75 Ga0068852_100000155 3300005616 Bacteria 45515
76 Ga0068852_100127692 3300005616 Bacteria 2337
77 Ga0068864_100497451 3300005618 Bacteria 1172
78 Ga0068858_100261066 3300005842 Bacteria 1646
79 Ga0068860_100013616 3300005843 Bacteria 7972
80 Ga0081455_10000001 3300005937 Bacteria 603871
81 Ga0081539_10003201 3300005985 Bacteria 20691
82 Ga0075365_10000001 3300006038 Bacteria 371589
83 Ga0075365_10000014 3300006038 Bacteria 79945
84 Ga0075365_10029935 3300006038 Bacteria 3483
85 Ga0075365_10042374 3300006038 Bacteria 2976
86 Ga0075365_10093438 3300006038 Unclassified 2052
87 Ga0075365_10127123 3300006038 Unclassified 1762
88 Ga0075368_10000065 3300006042 Bacteria 25604
89 Ga0075368_10002082 3300006042 Bacteria 6462
90 Ga0075363_100018117 3300006048 Bacteria 3503
91 Ga0075363_100160372 3300006048 Bacteria 1273
92 Ga0075364_10002663 3300006051 Bacteria 10027
93 Ga0075364_10002700 3300006051 Bacteria 9968
94 Ga0075364_10006382 3300006051 Bacteria 6932
95 Ga0075364_10009765 3300006051 Bacteria 5769
96 Ga0075362_10000063 3300006177 Bacteria 31783
97 Ga0075362_10084474 3300006177 Bacteria 1467
98 Ga0075362_10216418 3300006177 Bacteria 935
99 Ga0075367_10000093 3300006178 Bacteria 24511
100 Ga0075367_10009612 3300006178 Bacteria 5061
101 Ga0075369_10000001 3300006186 Bacteria 299616
102 Ga0075369_10000181 3300006186 Bacteria 18065
103 Ga0075366_10000001 3300006195 Bacteria 569172
104 Ga0075366_10000138 3300006195 Bacteria 30666
105 Ga0075366_10001109 3300006195 Bacteria 13248
106 Ga0075366_10001938 3300006195 Bacteria 10463
107 Ga0075366_10002568 3300006195 Bacteria 9334
108 Ga0075366_10239071 3300006195 Bacteria 1107
109 Ga0075366_10246603 3300006195 Bacteria 1089
110 Ga0097621_100000001 3300006237 Bacteria 632268
111 Ga0097621_100043685 3300006237 Bacteria 3613
112 Ga0075370_10000462 3300006353 Bacteria 15151
113 Ga0075370_10006270 3300006353 Bacteria 5971
114 Ga0075370_10052787 3300006353 Unclassified 2307
115 Ga0075370_10187760 3300006353 Unclassified 1217
116 Ga0068871_100000002 3300006358 Bacteria 152322
117 Ga0068871_100000232 3300006358 Bacteria 39467
118 Ga0075428_100001999 3300006844 Bacteria 21962
119 Ga0068865_100000307 3300006881 Bacteria 27001
120 Ga0105240_10000003 3300009093 Bacteria 1183681
121 Ga0105240_10000004 3300009093 Bacteria 708156
122 Ga0105240_10000050 3300009093 Bacteria 236144
123 Ga0105240_10001357 3300009093 Bacteria 42000
124 Ga0105240_10032247 3300009093 Bacteria 6785
125 Ga0105240_10233925 3300009093 Bacteria 2134
126 Ga0111539_10001451 3300009094 Bacteria 31651
127 Ga0105245_10000001 3300009098 Bacteria 939270
128 Ga0105245_10000002 3300009098 Bacteria 634374
129 Ga0105245_10000200 3300009098 Bacteria 57196
130 Ga0105245_10006834 3300009098 Bacteria 10007
131 Ga0105243_10000001 3300009148 Bacteria 1156578
132 Ga0105241_10000842 3300009174 Bacteria 23254
133 Ga0105241_10126007 3300009174 Bacteria 2068
134 Ga0105241_10169893 3300009174 Bacteria 1800
135 Ga0105241_10257938 3300009174 Bacteria 1481
136 Ga0105242_10000001 3300009176 Bacteria 574039
137 Ga0105242_10002087 3300009176 Bacteria 15739
138 Ga0105248_10830652 3300009177 Bacteria 1043
139 Ga0105237_10000001 3300009545 Bacteria 1009213
140 Ga0105237_10000002 3300009545 Bacteria 702357
141 Ga0105237_10009293 3300009545 Bacteria 10533
142 Ga0105237_10114986 3300009545 Bacteria 2684
143 Ga0105237_10838583 3300009545 Bacteria 926
144 Ga0105238_10062208 3300009551 Bacteria 3733
145 Ga0105238_10064247 3300009551 Bacteria 3671
146 Ga0105238_10072227 3300009551 Bacteria 3447
147 Ga0105238_10144125 3300009551 Bacteria 2359
148 Ga0105238_11434845 3300009551 Bacteria 718
149 Ga0105249_10002504 3300009553 Bacteria 15901
150 Ga0105032_100001 3300009979 Bacteria 472394
151 Ga0105032_100018 3300009979 Bacteria 47684
152 Ga0105032_100148 3300009979 Bacteria 7474
153 Ga0105032_101686 3300009979 Unclassified 2001
154 Ga0105029_100904 3300009984 Bacteria 1722
155 Ga0105033_100258 3300009986 Bacteria 4151
156 Ga0105033_101513 3300009986 Bacteria 1904
157 Ga0105028_100019 3300009993 Bacteria 20066
158 Ga0105239_10001223 3300010375 Bacteria 35012
159 Ga0105239_10004383 3300010375 Bacteria 16901
160 Ga0105239_10042306 3300010375 Unclassified 4993
161 Ga0105246_10007613 3300011119 Bacteria 6643
162 Ga0105246_10168087 3300011119 Unclassified 1677
163 Ga0105246_10182970 3300011119 Bacteria 1615
164 Ga0157373_10000061 3300013100 Bacteria 95718
165 Ga0157373_10012323 3300013100 Bacteria 6288
166 Ga0157373_10064545 3300013100 Unclassified 2592
167 Ga0157373_10171934 3300013100 Bacteria 1524
168 Ga0157371_10000561 3300013102 Bacteria 43999
169 Ga0157371_10001961 3300013102 Bacteria 20429
170 Ga0157371_10037254 3300013102 Bacteria 3482
171 Ga0157371_10341881 3300013102 Bacteria 1088
172 Ga0157370_10002357 3300013104 Bacteria 22781
173 Ga0157370_10012318 3300013104 Bacteria 8877
174 Ga0157370_10035209 3300013104 Bacteria 4869
175 Ga0157370_10203627 3300013104 Bacteria 1835
176 Ga0157370_10332386 3300013104 Unclassified 1401
177 Ga0157369_10000029 3300013105 Bacteria 206955
178 Ga0157369_10000151 3300013105 Bacteria 98331
179 Ga0157369_10000413 3300013105 Bacteria 56589
180 Ga0157369_10000567 3300013105 Bacteria 48628
181 Ga0157369_10008576 3300013105 Bacteria 11723
182 Ga0157369_10013289 3300013105 Bacteria 9316
183 Ga0157369_10084691 3300013105 Bacteria 3388
184 Ga0157369_10112036 3300013105 Bacteria 2899
185 Ga0157369_10189191 3300013105 Bacteria 2163
186 Ga0157374_10000073 3300013296 Bacteria 100517
187 Ga0157374_10001423 3300013296 Bacteria 20253
188 Ga0157374_10004073 3300013296 Bacteria 12275
189 Ga0157374_10213119 3300013296 Bacteria 1894
190 Ga0157374_11338069 3300013296 Bacteria 739
191 Ga0157378_10642517 3300013297 Bacteria 1076
192 Ga0163162_11148948 3300013306 Bacteria 880
193 Ga0157372_10000002 3300013307 Bacteria 687862
194 Ga0157372_10000086 3300013307 Bacteria 96247
195 Ga0157372_10002447 3300013307 Bacteria 20124
196 Ga0157372_10046567 3300013307 Bacteria 4815
197 Ga0157372_10159836 3300013307 Bacteria 2603
198 Ga0157372_10305370 3300013307 Unclassified 1851
199 Ga0157372_10686043 3300013307 Bacteria 1192
200 Ga0163163_10026960 3300014325 Bacteria 5498
201 Ga0163163_10403719 3300014325 Unclassified 1425
202 Ga0157376_10000001 3300014969 Bacteria 842910
203 Ga0157376_10000027 3300014969 Bacteria 204157
204 Ga0157376_10150050 3300014969 Bacteria 2101
205 Ga0207688_10150178 3300025901 Bacteria 1376
206 Ga0207647_10001245 3300025904 Bacteria 19575
207 Ga0207647_10067177 3300025904 Bacteria 2174
208 Ga0207645_10010575 3300025907 Bacteria 6332
209 Ga0207705_10000047 3300025909 Bacteria 175887
210 Ga0207705_10000115 3300025909 Bacteria 89955
211 Ga0207705_10190644 3300025909 Unclassified 1550
212 Ga0207705_10198114 3300025909 Unclassified 1521
213 Ga0207705_10331988 3300025909 Bacteria 1170
214 Ga0207654_10012883 3300025911 Unclassified 4290
215 Ga0207654_10144880 3300025911 Bacteria 1519
216 Ga0207654_10173641 3300025911 Bacteria 1401
217 Ga0207695_10000009 3300025913 Bacteria 1034276
218 Ga0207695_10000158 3300025913 Bacteria 201891
219 Ga0207695_10012231 3300025913 Bacteria 10306
220 Ga0207695_10396347 3300025913 Bacteria 1265
221 Ga0207671_10000003 3300025914 Bacteria 1065461
222 Ga0207671_10000008 3300025914 Bacteria 798229
223 Ga0207671_10080255 3300025914 Bacteria 2445
224 Ga0207660_10085381 3300025917 Bacteria 2328
225 Ga0207657_10000712 3300025919 Bacteria 35358
226 Ga0207657_10002562 3300025919 Bacteria 19664
227 Ga0207657_10004361 3300025919 Bacteria 14986
228 Ga0207657_10044405 3300025919 Bacteria 3906
229 Ga0207657_10052585 3300025919 Bacteria 3534
230 Ga0207657_10061138 3300025919 Unclassified 3231
231 Ga0207649_10004926 3300025920 Bacteria 7218
232 Ga0207652_10019802 3300025921 Bacteria 5539
233 Ga0207652_10028902 3300025921 Bacteria 4628
234 Ga0207652_10542797 3300025921 Bacteria 1045
235 Ga0207694_10096061 3300025924 Bacteria 2344
236 Ga0207694_10157135 3300025924 Bacteria 1835
237 Ga0207694_10341208 3300025924 Bacteria 1239
238 Ga0207687_10000001 3300025927 Bacteria 1130810
239 Ga0207687_10000004 3300025927 Bacteria 841177
240 Ga0207690_10000527 3300025932 Bacteria 24894
241 Ga0207690_10002652 3300025932 Bacteria 10785
242 Ga0207706_10000073 3300025933 Bacteria 103803
243 Ga0207706_10840946 3300025933 Bacteria 778
244 Ga0207686_10017794 3300025934 Bacteria 4010
245 Ga0207669_10006666 3300025937 Bacteria 5292
246 Ga0207704_10001468 3300025938 Bacteria 10545
247 Ga0207661_10000077 3300025944 Bacteria 67190
248 Ga0207661_10002445 3300025944 Bacteria 12778
249 Ga0207679_10000124 3300025945 Bacteria 63038
250 Ga0207667_10000005 3300025949 Bacteria 715503
251 Ga0207667_10000060 3300025949 Bacteria 192320
252 Ga0207667_10000756 3300025949 Bacteria 42002
253 Ga0207667_10038991 3300025949 Bacteria 5066
254 Ga0207667_10123290 3300025949 Bacteria 2670
255 Ga0207651_10000141 3300025960 Bacteria 31367
256 Ga0207712_10003874 3300025961 Bacteria 9451
257 Ga0207640_10110274 3300025981 Bacteria 1949
258 Ga0207658_10009982 3300025986 Bacteria 6453
259 Ga0207658_10016737 3300025986 Bacteria 5046
260 Ga0207703_10114112 3300026035 Bacteria 2310
261 Ga0207702_10000001 3300026078 Bacteria 895738
262 Ga0207702_10000015 3300026078 Bacteria 250830
263 Ga0207702_10000034 3300026078 Bacteria 164965
264 Ga0207702_10000057 3300026078 Bacteria 131118
265 Ga0207702_10211055 3300026078 Bacteria 1805
266 Ga0207702_10746796 3300026078 Bacteria 966
267 Ga0207648_10026260 3300026089 Bacteria 5177
268 Ga0207674_10000001 3300026116 Bacteria 616581
269 Ga0207674_10000878 3300026116 Bacteria 39325
270 Ga0207674_10020195 3300026116 Bacteria 7203
271 Ga0207674_10025636 3300026116 Bacteria 6280
272 Ga0207674_10257702 3300026116 Bacteria 1691
273 Ga0207674_10341468 3300026116 Bacteria 1448
274 Ga0207674_10566842 3300026116 Unclassified 1097
275 Ga0207683_10003131 3300026121 Bacteria 14456
276 Ga0207683_10008126 3300026121 Bacteria 8974
277 Ga0207698_10000001 3300026142 Bacteria 625389
278 Ga0207698_10000048 3300026142 Bacteria 90201
279 Ga0207698_10014507 3300026142 Bacteria 5241
280 Ga0209813_10000001 3300027866 Bacteria 280406
281 Ga0209813_10000335 3300027866 Bacteria 12250
282 Ga0207428_10038033 3300027907 Bacteria 3914
283 Ga0268264_10022595 3300028381 Bacteria 5134
284 Ga0265326_10000530 3300028558 Bacteria 14529
285 Ga0265326_10001685 3300028558 Bacteria 7649
286 Ga0265334_10000115 3300028573 Bacteria 52649
287 Ga0265334_10002006 3300028573 Bacteria 9646
288 Ga0265334_10004363 3300028573 Bacteria 6287
289 Ga0265336_10000424 3300028666 Bacteria 26224
290 Ga0265336_10000652 3300028666 Bacteria 18911
291 Ga0265338_10000003 3300028800 Bacteria 733923
292 Ga0265338_10000039 3300028800 Bacteria 236135
293 Ga0265338_10000482 3300028800 Bacteria 71209
294 Ga0265338_10000625 3300028800 Bacteria 61650
295 Ga0265338_10012735 3300028800 Bacteria 9568
296 Ga0265324_10039495 3300029957 Bacteria 1636
297 Ga0314311_1023813 3300030733 Bacteria 1073
298 Ga0314311_1061458 3300030733 Bacteria 2888
299 Ga0316179_1064424 3300030734 Bacteria 12008
300 Ga0316178_1164474 3300030735 Bacteria 1441
301 Ga0316180_1178386 3300030736 Bacteria 3765
302 Ga0316183_1069499 3300030742 Bacteria 3281
303 Ga0316183_1103932 3300030742 Bacteria 7412
304 Ga0316183_1119405 3300030742 Bacteria 2821
305 Ga0316183_1192095 3300030742 Bacteria 16108
306 Ga0316181_1138937 3300030744 Bacteria 58229
307 Ga0316182_1000204 3300030745 Bacteria 16925
308 Ga0316182_1017501 3300030745 Bacteria 11122
309 Ga0316182_1107000 3300030745 Bacteria 3022
310 Ga0316182_1258468 3300030745 Bacteria 2309
311 Ga0265325_10034156 3300031241 Bacteria 2708
312 Ga0265327_10000017 3300031251 Bacteria 445264
313 Ga0307509_10019515 3300031507 Bacteria 7727
314 Ga0265313_10035909 3300031595 Bacteria 2491
315 Ga0265313_10146440 3300031595 Bacteria 1012
316 Ga0307516_10000078 3300031730 Bacteria 106523
317 Ga0307516_10008182 3300031730 Bacteria 11877
318 Ga0307406_10000001 3300031901 Bacteria 638191
319 Ga0307406_10000610 3300031901 Bacteria 20414
320 Ga0373959_0000052 3300034820 Bacteria 26566
321 Ga0395899_0003792 3300037312 Bacteria 11936
322 Ga0395899_0074289 3300037312 Unclassified 2484
323 Ga0395899_0147813 3300037312 Unclassified 1667
324 Ga0395900_0000001 3300037418 Bacteria 931146
325 Ga0395900_0208489 3300037418 Bacteria 1974
326 Ga0395900_0252072 3300037418 Unclassified 1766
327 Ga0395900_0464753 3300037418 Unclassified 1219
328 Ga0395900_0610166 3300037418 Bacteria 1031
329 Ga0395898_0000002 3300037466 Bacteria 931013
330 Ga0395898_0015984 3300037466 Bacteria 7689
331 Ga0395898_0038110 3300037466 Bacteria 4766
332 Ga0395905_0002429 3300037471 Bacteria 20672
333 Ga0395901_0000006 3300038443 Bacteria 514112
334 Ga0395901_0006327 3300038443 Bacteria 11992
335 Ga0395901_0010187 3300038443 Bacteria 9524
336 Ga0395901_0036009 3300038443 Bacteria 5114
337 Ga0439438_017103 3300041405 Unclassified 2095
338 Ga0439461_0005440 3300041410 Bacteria 2169
339 Ga0451853_0989547 3300041512 Unclassified 1467
340 Ga0439431_0036841 3300041997 Unclassified 1233
341 Ga0439442_014942 3300042002 Bacteria 1599
342 Ga0439445_0001581 3300042004 Bacteria 4962
343 Ga0439432_041379 3300042006 Unclassified 1459
344 Ga0439463_003406 3300042016 Bacteria 4030
345 Ga0450920_002665 3300042122 Bacteria 3057
346 Ga0450906_002227 3300042145 Bacteria 4238
347 Ga0439446_0000001 3300042156 Bacteria 275840
348 Ga0439446_0000974 3300042156 Bacteria 6228
349 Ga0450909_001464 3300042185 Bacteria 3290
350 Ga0439434_0017929 3300042435 Unclassified 2119
351 Ga0439464_0001074 3300042439 Bacteria 6281
352 Ga0450918_005396 3300042531 Bacteria 2301
353 Ga0466972_0069662 3300044658 Bacteria 1679
354 Ga0466965_0000206 3300044683 Bacteria 18416
355 Ga0466963_0120632 3300044694 Bacteria 1804
356 Ga0453684_0264865 3300044712 Bacteria 1967
357 Ga0453684_0463256 3300044712 Bacteria 1409
358 Ga0451576_0034967 3300045051 Bacteria 5333
359 Ga0466958_0267103 3300045836 Unclassified 1095
360 Ga0495638_0000132 3300046460 Bacteria 120039
361 Ga0495638_0000551 3300046460 Bacteria 42775
362 Ga0495583_0003976 3300046506 Bacteria 10912
363 Ga0495583_0088037 3300046506 Unclassified 1341
364 Ga0495588_0000171 3300046674 Bacteria 83176
365 Ga0495671_0103574 3300046692 Bacteria 1390
366 Ga0495660_0000005 3300046810 Bacteria 574567
367 Ga0495672_0021011 3300047320 Bacteria 4264
368 Ga0496100_0184354 3300048903 Bacteria 1511
369 Ga0496100_0225338 3300048903 Bacteria 1377
370 Ga0496105_0387534 3300048908 Unclassified 1111
371 Ga0496112_0025793 3300048915 Bacteria 5646
372 Ga0496113_0289238 3300048916 Unclassified 1311
373 Ga0496115_0000405 3300048918 Bacteria 35545
374 Ga0496124_0126158 3300048927 Bacteria 2038
375 Ga0496126_0031280 3300048929 Bacteria 5031
376 Ga0501031_0002442 3300049568 Bacteria 11833
377 Ga0501032_0000624 3300049569 Bacteria 28751
378 Ga0501034_0013740 3300049571 Bacteria 8329
379 Ga0501034_0037263 3300049571 Bacteria 4923
380 Ga0501034_0043701 3300049571 Bacteria 4533
381 Ga0501036_0001666 3300049572 Bacteria 17221
382 Ga0501037_0000001 3300049573 Bacteria 753276
383 Ga0501037_0000031 3300049573 Bacteria 133137
384 Ga0501038_0080347 3300049574 Unclassified 2748
385 Ga0501040_0103327 3300049576 Unclassified 1989
386 Ga0501042_0052896 3300049578 Bacteria 2897
387 Ga0501043_0000366 3300049579 Bacteria 40919
388 Ga0501046_0000138 3300049580 Bacteria 77052
389 Ga0501047_0000032 3300049581 Bacteria 208294
390 Ga0501047_0000310 3300049581 Bacteria 56101
391 Ga0501048_0000013 3300049582 Bacteria 76554
392 Ga0501069_0220897 3300049585 Bacteria 1101
393 Ga0501070_0120791 3300049586 Unclassified 2165
394 Ga0501073_0054298 3300049589 Bacteria 2805
395 Ga0501083_0037527 3300049744 Bacteria 3300
396 Ga0501035_0000033 3300049822 Bacteria 175087
397 Ga0501035_0000799 3300049822 Bacteria 33519
398 Ga0501044_0085458 3300049823 Bacteria 3188
399 Ga0501045_0209784 3300049824 Bacteria 1451
400 nmdc:mga03683_191874_c1 3300050489 Bacteria 935
401 nmdc:mga03683_22837_c1 3300050489 Bacteria 2429
402 nmdc:mga03683_80_c1 3300050489 Bacteria 35991
403 nmdc:mga03n38_142_c1 3300050490 Bacteria 15721
404 nmdc:mga03n38_83781_c1 3300050490 Bacteria 1504
405 nmdc:mga00v17_10757_c1 3300050491 Bacteria 5012
406 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
407 nmdc:mga00v17_1693_c1 3300050491 Bacteria 11473
408 nmdc:mga00v17_182905_c1 3300050491 Bacteria 1352
409 nmdc:mga00v17_2126_c1 3300050491 Bacteria 10185
410 nmdc:mga00v17_221460_c1 3300050491 Bacteria 1225
411 nmdc:mga00v17_27256_c1 3300050491 Bacteria 3335
412 nmdc:mga00v17_401052_c1 3300050491 Bacteria 891
413 nmdc:mga0yw44_100729_c1 3300050492 Unclassified 1840
414 nmdc:mga0yw44_14057_c1 3300050492 Bacteria 4236
415 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
416 nmdc:mga0yw44_185144_c1 3300050492 Bacteria 1372
417 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
418 nmdc:mga0yw44_248569_c1 3300050492 Unclassified 1183
419 nmdc:mga0yw44_25522_c1 3300050492 Unclassified 3362
420 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
421 nmdc:mga0yw44_38391_c1 3300050492 Bacteria 2833
422 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
423 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
424 nmdc:mga0k408_13_c1 3300050493 Bacteria 48149
425 nmdc:mga0k408_214_c1 3300050493 Bacteria 31125
426 nmdc:mga0k408_2723_c1 3300050493 Bacteria 9384
427 nmdc:mga0k408_2889_c1 3300050493 Bacteria 9112
428 nmdc:mga0k408_3696_c1 3300050493 Bacteria 7332
429 nmdc:mga0k408_6247_c1 3300050493 Bacteria 6358
430 nmdc:mga06z11_127_c1 3300050494 Bacteria 25603
431 nmdc:mga06z11_15_c1 3300050494 Bacteria 82672
432 nmdc:mga06z11_198_c1 3300050494 Bacteria 24266
433 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
434 nmdc:mga04h51_251_c1 3300050495 Bacteria 14040
435 nmdc:mga04h51_9766_c1 3300050495 Unclassified 2614
436 nmdc:mga07m45_104556_c1 3300050496 Bacteria 1628
437 nmdc:mga07m45_20643_c1 3300050496 Bacteria 2952
438 nmdc:mga07m45_37131_c1 3300050496 Bacteria 2717
439 nmdc:mga07m45_5621_c1 3300050496 Bacteria 6264
440 nmdc:mga08y16_5295_c1 3300050511 Bacteria 13491
441 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
442 nmdc:mga0sz30_48939_c1 3300050516 Bacteria 1790
443 Ga0500610_0000006 3300053079 Bacteria 134304
444 Ga0500610_0051502 3300053079 Bacteria 2144
445 Ga0500643_000043 3300053087 Bacteria 157905
446 Ga0500643_006482 3300053087 Unclassified 4880
447 Ga0500643_013335 3300053087 Unclassified 2906
448 Ga0500644_0000471 3300053088 Bacteria 17804
449 Ga0500644_0000594 3300053088 Bacteria 13826
450 Ga0500644_0008359 3300053088 Bacteria 2730
451 Ga0500644_0023408 3300053088 Bacteria 1876
452 Ga0500644_0029433 3300053088 Bacteria 1727
453 Ga0500646_0000007 3300053090 Bacteria 115744
454 Ga0500646_0000490 3300053090 Bacteria 11629
455 Ga0500583_0000082 3300053092 Bacteria 54810
456 Ga0500583_0006482 3300053092 Bacteria 4034
457 Ga0500651_0000001 3300053093 Bacteria 529808
458 Ga0500651_0000447 3300053093 Bacteria 22020
459 Ga0500651_0002954 3300053093 Bacteria 9156
460 Ga0500651_0042370 3300053093 Bacteria 2868
461 Ga0500651_0057950 3300053093 Bacteria 2423
462 Ga0500641_0000001 3300053096 Bacteria 1115973
463 Ga0500650_0000001 3300053098 Bacteria 818797
464 Ga0500650_0034484 3300053098 Bacteria 2313
465 Ga0500555_000001 3300053103 Bacteria 1353713
466 Ga0500555_000002 3300053103 Bacteria 1314346
467 Ga0500555_000009 3300053103 Bacteria 263998
468 Ga0500556_0012414 3300053104 Bacteria 2545
469 Ga0500562_000002 3300053108 Bacteria 977234
470 Ga0500562_004711 3300053108 Bacteria 3436
471 Ga0500569_000018 3300053109 Bacteria 42775
472 Ga0500593_017808 3300053117 Bacteria 3089
473 Ga0500594_0000001 3300053118 Bacteria 1178472
474 Ga0500594_0000018 3300053118 Bacteria 61549
475 Ga0500614_000001 3300053123 Bacteria 1274484
476 Ga0500614_000921 3300053123 Bacteria 7378
477 Ga0500628_000028 3300053129 Bacteria 59993
478 Ga0500642_0003187 3300053130 Bacteria 4922
479 Ga0500652_000001 3300053131 Bacteria 946868
480 Ga0500652_000022 3300053131 Bacteria 118313
481 Ga0500655_001382 3300053133 Bacteria 4597
482 Ga0500577_0000124 3300053142 Bacteria 18743
483 Ga0500577_0000996 3300053142 Bacteria 7296
484 Ga0500577_0001222 3300053142 Bacteria 6572
485 Ga0500577_0006182 3300053142 Bacteria 3283
486 Ga0500577_0018811 3300053142 Bacteria 2228
487 Ga0500577_0029402 3300053142 Bacteria 1902
488 Ga0500577_0030703 3300053142 Bacteria 1873
489 Ga0500579_000781 3300053143 Bacteria 18261
490 Ga0500588_0000557 3300053146 Bacteria 6064
491 Ga0500589_000013 3300053147 Bacteria 109118
492 Ga0500603_160325 3300053150 Bacteria 701
493 Ga0500604_0002568 3300053151 Bacteria 4949
494 Ga0500616_0000012 3300053153 Bacteria 681798
495 Ga0500620_030693 3300053155 Bacteria 1699
496 Ga0500649_000004 3300053722 Bacteria 139374
497 Ga0500570_002919 3300053724 Bacteria 8651
498 Ga0500570_112686 3300053724 Bacteria 1097
499 Ga0500611_020486 3300053727 Bacteria 1249
500 Ga0500613_004749 3300053738 Unclassified 1270
501 Ga0501084_0311515 3300054114 Bacteria 1329
502 Ga0501082_0510640 3300060353 Bacteria 1050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10064545 Ga0157373_100645453 191
2 3300009174 Ga0105241_10000842 Ga0105241_1000084216 200
3 3300009551 Ga0105238_11434845 Ga0105238_114348451 200
4 3300025911 Ga0207654_10012883 Ga0207654_100128833 200
5 3300005339 Ga0070660_100000298 Ga0070660_10000029814 202
6 3300005341 Ga0070691_10011663 Ga0070691_100116631 202
7 3300005366 Ga0070659_100000672 Ga0070659_1000006729 202
8 3300005530 Ga0070679_100124601 Ga0070679_1001246012 202
9 3300005563 Ga0068855_100000558 Ga0068855_10000055828 202
10 3300005577 Ga0068857_100000002 Ga0068857_100000002146 202
11 3300009986 Ga0105033_100258 Ga0105033_1002581 202
12 3300013105 Ga0157369_10008576 Ga0157369_100085766 202
13 3300025909 Ga0207705_10190644 Ga0207705_101906442 202
14 3300025919 Ga0207657_10004361 Ga0207657_100043613 202
15 3300025932 Ga0207690_10000527 Ga0207690_100005279 202
16 3300025949 Ga0207667_10000060 Ga0207667_10000060184 202
17 3300026116 Ga0207674_10000001 Ga0207674_10000001569 202
18 3300026116 Ga0207674_10566842 Ga0207674_105668422 202
19 3300044712 Ga0453684_0264865 Ga0453684_0264865_132_842 202
20 3300044712 Ga0453684_0463256 Ga0453684_0463256_640_1326 202
21 3300005544 Ga0070686_100143965 Ga0070686_1001439653 203
22 3300005544 Ga0070686_100470098 Ga0070686_1004700982 203
23 3300006195 Ga0075366_10000001 Ga0075366_10000001555 203
24 3300006353 Ga0075370_10187760 Ga0075370_101877602 203
25 3300009094 Ga0111539_10001451 Ga0111539_1000145137 203
26 3300009174 Ga0105241_10169893 Ga0105241_101698932 203
27 3300013100 Ga0157373_10000061 Ga0157373_1000006156 203
28 3300013104 Ga0157370_10203627 Ga0157370_102036272 203
29 3300027907 Ga0207428_10038033 Ga0207428_100380332 203
30 3300050511 nmdc:mga08y16_5295_c1 nmdc:mga08y16_5295_c1_10133_10789 203
31 3300003322 rootL2_10094401 rootL2_100944012 204
32 3300003322 rootL2_10315181 rootL2_103151814 204
33 3300005329 Ga0070683_100000112 Ga0070683_10000011210 204
34 3300005367 Ga0070667_100026048 Ga0070667_1000260485 204
35 3300005535 Ga0070684_100000049 Ga0070684_10000004910 204
36 3300005544 Ga0070686_100019349 Ga0070686_1000193495 204
37 3300005563 Ga0068855_100003761 Ga0068855_10000376125 204
38 3300005563 Ga0068855_100042951 Ga0068855_1000429513 204
39 3300005564 Ga0070664_100033858 Ga0070664_1000338582 204
40 3300005578 Ga0068854_100130351 Ga0068854_1001303512 204
41 3300005614 Ga0068856_100000001 Ga0068856_10000000160 204
42 3300005614 Ga0068856_100593876 Ga0068856_1005938762 204
43 3300005843 Ga0068860_100013616 Ga0068860_1000136169 204
44 3300006038 Ga0075365_10042374 Ga0075365_100423744 204
45 3300006051 Ga0075364_10009765 Ga0075364_100097655 204
46 3300006177 Ga0075362_10000063 Ga0075362_1000006314 204
47 3300006195 Ga0075366_10000138 Ga0075366_1000013832 204
48 3300006195 Ga0075366_10001938 Ga0075366_100019388 204
49 3300006195 Ga0075366_10002568 Ga0075366_100025684 204
50 3300006237 Ga0097621_100000001 Ga0097621_100000001681 204
51 3300006358 Ga0068871_100000002 Ga0068871_100000002157 204
52 3300009093 Ga0105240_10032247 Ga0105240_100322471 204
53 3300009984 Ga0105029_100904 Ga0105029_1009041 204
54 3300009993 Ga0105028_100019 Ga0105028_1000192 204
55 3300010375 Ga0105239_10004383 Ga0105239_100043835 204
56 3300013105 Ga0157369_10000151 Ga0157369_1000015174 204
57 3300013105 Ga0157369_10112036 Ga0157369_101120363 204
58 3300013296 Ga0157374_11338069 Ga0157374_113380691 204
59 3300013307 Ga0157372_10002447 Ga0157372_1000244718 204
60 3300014325 Ga0163163_10026960 Ga0163163_100269608 204
61 3300014325 Ga0163163_10403719 Ga0163163_104037192 204
62 3300025913 Ga0207695_10396347 Ga0207695_103963472 204
63 3300025917 Ga0207660_10085381 Ga0207660_100853813 204
64 3300025944 Ga0207661_10000077 Ga0207661_1000007749 204
65 3300025949 Ga0207667_10123290 Ga0207667_101232905 204
66 3300025981 Ga0207640_10110274 Ga0207640_101102742 204
67 3300025986 Ga0207658_10016737 Ga0207658_100167376 204
68 3300026035 Ga0207703_10114112 Ga0207703_101141123 204
69 3300026078 Ga0207702_10000001 Ga0207702_10000001609 204
70 3300026078 Ga0207702_10746796 Ga0207702_107467962 204
71 3300028381 Ga0268264_10022595 Ga0268264_100225956 204
72 3300028800 Ga0265338_10000625 Ga0265338_1000062539 204
73 3300031251 Ga0265327_10000017 Ga0265327_1000001710 204
74 3300037418 Ga0395900_0208489 Ga0395900_0208489_1046_1696 204
75 3300038443 Ga0395901_0006327 Ga0395901_0006327_5174_5824 204
76 3300041512 Ga0451853_0989547 Ga0451853_0989547_101_751 204
77 3300046506 Ga0495583_0088037 Ga0495583_0088037_425_1072 204
78 3300046674 Ga0495588_0000171 Ga0495588_0000171_8382_9032 204
79 3300048903 Ga0496100_0225338 Ga0496100_0225338_77_784 204
80 3300048929 Ga0496126_0031280 Ga0496126_0031280_2778_3428 204
81 3300050489 nmdc:mga03683_80_c1 nmdc:mga03683_80_c1_13721_14371 204
82 3300050491 nmdc:mga00v17_10757_c1 nmdc:mga00v17_10757_c1_4124_4777 204
83 3300050491 nmdc:mga00v17_221460_c1 nmdc:mga00v17_221460_c1_409_1062 204
84 3300050492 nmdc:mga0yw44_185144_c1 nmdc:mga0yw44_185144_c1_661_1317 204
85 3300050493 nmdc:mga0k408_13_c1 nmdc:mga0k408_13_c1_21817_22467 204
86 3300050493 nmdc:mga0k408_214_c1 nmdc:mga0k408_214_c1_5957_6613 204
87 3300050493 nmdc:mga0k408_2723_c1 nmdc:mga0k408_2723_c1_1412_2065 204
88 3300050493 nmdc:mga0k408_2889_c1 nmdc:mga0k408_2889_c1_6174_6827 204
89 3300053087 Ga0500643_000043 Ga0500643_000043_74649_75299 204
90 3300053088 Ga0500644_0000471 Ga0500644_0000471_5934_6584 204
91 3300053093 Ga0500651_0002954 Ga0500651_0002954_5870_6520 204
92 3300053108 Ga0500562_000002 Ga0500562_000002_779840_780490 204
93 3300053123 Ga0500614_000001 Ga0500614_000001_433158_433808 204
94 3300053123 Ga0500614_000921 Ga0500614_000921_728_1378 204
95 3300053142 Ga0500577_0000124 Ga0500577_0000124_1481_2131 204
96 3300053722 Ga0500649_000004 Ga0500649_000004_101559_102209 204
97 3300053727 Ga0500611_020486 Ga0500611_020486_519_1169 204
98 3300001979 JGI24740J21852_10027231 JGI24740J21852_100272312 205
99 3300001990 JGI24737J22298_10002203 JGI24737J22298_100022034 205
100 3300002067 JGI24735J21928_10000149 JGI24735J21928_1000014911 205
101 3300002075 JGI24738J21930_10001791 JGI24738J21930_100017914 205
102 3300003320 rootH2_10006847 rootH2_1000684726 205
103 3300003322 rootL2_10168822 rootL2_101688223 205
104 3300003322 rootL2_10256332 rootL2_102563322 205
105 3300003323 rootH1_10131014 rootH1_101310142 205
106 3300005327 Ga0070658_10000024 Ga0070658_10000024149 205
107 3300005329 Ga0070683_100010750 Ga0070683_1000107508 205
108 3300005336 Ga0070680_100012114 Ga0070680_1000121148 205
109 3300005337 Ga0070682_100006184 Ga0070682_1000061843 205
110 3300005339 Ga0070660_100000316 Ga0070660_10000031610 205
111 3300005339 Ga0070660_100096723 Ga0070660_1000967233 205
112 3300005339 Ga0070660_100336081 Ga0070660_1003360812 205
113 3300005344 Ga0070661_100093549 Ga0070661_1000935493 205
114 3300005356 Ga0070674_100005409 Ga0070674_1000054098 205
115 3300005366 Ga0070659_100089113 Ga0070659_1000891134 205
116 3300005457 Ga0070662_100009029 Ga0070662_10000902910 205
117 3300005457 Ga0070662_100369986 Ga0070662_1003699861 205
118 3300005458 Ga0070681_10030790 Ga0070681_100307906 205
119 3300005459 Ga0068867_100008780 Ga0068867_1000087802 205
120 3300005530 Ga0070679_100020035 Ga0070679_1000200354 205
121 3300005530 Ga0070679_100170654 Ga0070679_1001706542 205
122 3300005563 Ga0068855_100000002 Ga0068855_100000002282 205
123 3300005563 Ga0068855_101133363 Ga0068855_1011333632 205
124 3300005564 Ga0070664_100000123 Ga0070664_1000001234 205
125 3300005577 Ga0068857_100000441 Ga0068857_10000044119 205
126 3300005577 Ga0068857_100067343 Ga0068857_1000673435 205
127 3300005578 Ga0068854_100097044 Ga0068854_1000970443 205
128 3300005614 Ga0068856_100000200 Ga0068856_1000002008 205
129 3300005614 Ga0068856_100088978 Ga0068856_1000889786 205
130 3300005618 Ga0068864_100497451 Ga0068864_1004974511 205
131 3300005985 Ga0081539_10003201 Ga0081539_1000320115 205
132 3300006038 Ga0075365_10000014 Ga0075365_1000001421 205
133 3300006038 Ga0075365_10029935 Ga0075365_100299353 205
134 3300006038 Ga0075365_10093438 Ga0075365_100934382 205
135 3300006038 Ga0075365_10127123 Ga0075365_101271233 205
136 3300006042 Ga0075368_10002082 Ga0075368_100020828 205
137 3300006048 Ga0075363_100018117 Ga0075363_1000181172 205
138 3300006051 Ga0075364_10002663 Ga0075364_100026639 205
139 3300006051 Ga0075364_10002700 Ga0075364_1000270010 205
140 3300006177 Ga0075362_10084474 Ga0075362_100844743 205
141 3300006177 Ga0075362_10216418 Ga0075362_102164181 205
142 3300006186 Ga0075369_10000181 Ga0075369_1000018126 205
143 3300006195 Ga0075366_10239071 Ga0075366_102390712 205
144 3300006353 Ga0075370_10006270 Ga0075370_100062707 205
145 3300006353 Ga0075370_10052787 Ga0075370_100527872 205
146 3300006844 Ga0075428_100001999 Ga0075428_10000199916 205
147 3300006881 Ga0068865_100000307 Ga0068865_10000030718 205
148 3300009093 Ga0105240_10000003 Ga0105240_10000003608 205
149 3300009093 Ga0105240_10000004 Ga0105240_10000004172 205
150 3300009093 Ga0105240_10233925 Ga0105240_102339252 205
151 3300009098 Ga0105245_10000001 Ga0105245_10000001497 205
152 3300009098 Ga0105245_10000200 Ga0105245_1000020044 205
153 3300009148 Ga0105243_10000001 Ga0105243_10000001685 205
154 3300009176 Ga0105242_10000001 Ga0105242_10000001578 205
155 3300009176 Ga0105242_10002087 Ga0105242_1000208720 205
156 3300009545 Ga0105237_10000001 Ga0105237_10000001605 205
157 3300009545 Ga0105237_10009293 Ga0105237_100092937 205
158 3300009551 Ga0105238_10062208 Ga0105238_100622082 205
159 3300009551 Ga0105238_10064247 Ga0105238_100642472 205
160 3300009551 Ga0105238_10144125 Ga0105238_101441252 205
161 3300009979 Ga0105032_100001 Ga0105032_100001310 205
162 3300009979 Ga0105032_100018 Ga0105032_1000181 205
163 3300009986 Ga0105033_101513 Ga0105033_1015133 205
164 3300010375 Ga0105239_10001223 Ga0105239_1000122328 205
165 3300010375 Ga0105239_10042306 Ga0105239_100423067 205
166 3300011119 Ga0105246_10007613 Ga0105246_100076139 205
167 3300011119 Ga0105246_10168087 Ga0105246_101680871 205
168 3300013100 Ga0157373_10171934 Ga0157373_101719341 205
169 3300013102 Ga0157371_10001961 Ga0157371_1000196119 205
170 3300013102 Ga0157371_10037254 Ga0157371_100372541 205
171 3300013102 Ga0157371_10341881 Ga0157371_103418811 205
172 3300013104 Ga0157370_10002357 Ga0157370_1000235710 205
173 3300013104 Ga0157370_10035209 Ga0157370_100352092 205
174 3300013105 Ga0157369_10000413 Ga0157369_100004135 205
175 3300013105 Ga0157369_10000567 Ga0157369_1000056748 205
176 3300013105 Ga0157369_10084691 Ga0157369_100846913 205
177 3300013296 Ga0157374_10004073 Ga0157374_1000407311 205
178 3300013297 Ga0157378_10642517 Ga0157378_106425172 205
179 3300013307 Ga0157372_10000002 Ga0157372_10000002150 205
180 3300013307 Ga0157372_10000086 Ga0157372_1000008625 205
181 3300013307 Ga0157372_10046567 Ga0157372_100465675 205
182 3300013307 Ga0157372_10159836 Ga0157372_101598362 205
183 3300013307 Ga0157372_10686043 Ga0157372_106860431 205
184 3300014969 Ga0157376_10150050 Ga0157376_101500503 205
185 3300025901 Ga0207688_10150178 Ga0207688_101501782 205
186 3300025904 Ga0207647_10001245 Ga0207647_1000124516 205
187 3300025909 Ga0207705_10000047 Ga0207705_1000004758 205
188 3300025909 Ga0207705_10198114 Ga0207705_101981142 205
189 3300025913 Ga0207695_10000009 Ga0207695_10000009552 205
190 3300025914 Ga0207671_10000003 Ga0207671_10000003608 205
191 3300025919 Ga0207657_10002562 Ga0207657_1000256210 205
192 3300025919 Ga0207657_10044405 Ga0207657_100444057 205
193 3300025919 Ga0207657_10061138 Ga0207657_100611381 205
194 3300025920 Ga0207649_10004926 Ga0207649_100049262 205
195 3300025921 Ga0207652_10019802 Ga0207652_100198025 205
196 3300025921 Ga0207652_10542797 Ga0207652_105427971 205
197 3300025924 Ga0207694_10096061 Ga0207694_100960614 205
198 3300025924 Ga0207694_10157135 Ga0207694_101571352 205
199 3300025924 Ga0207694_10341208 Ga0207694_103412082 205
200 3300025927 Ga0207687_10000001 Ga0207687_1000000159 205
201 3300025927 Ga0207687_10000004 Ga0207687_10000004774 205
202 3300025932 Ga0207690_10002652 Ga0207690_1000265210 205
203 3300025933 Ga0207706_10000073 Ga0207706_1000007356 205
204 3300025933 Ga0207706_10840946 Ga0207706_108409461 205
205 3300025934 Ga0207686_10017794 Ga0207686_100177943 205
206 3300025937 Ga0207669_10006666 Ga0207669_100066664 205
207 3300025938 Ga0207704_10001468 Ga0207704_1000146811 205
208 3300025944 Ga0207661_10002445 Ga0207661_1000244513 205
209 3300025945 Ga0207679_10000124 Ga0207679_1000012459 205
210 3300025949 Ga0207667_10000005 Ga0207667_10000005392 205
211 3300026078 Ga0207702_10000057 Ga0207702_10000057101 205
212 3300026089 Ga0207648_10026260 Ga0207648_100262607 205
213 3300026116 Ga0207674_10000878 Ga0207674_1000087819 205
214 3300026116 Ga0207674_10341468 Ga0207674_103414682 205
215 3300026142 Ga0207698_10014507 Ga0207698_100145072 205
216 3300027866 Ga0209813_10000335 Ga0209813_1000033513 205
217 3300030733 Ga0314311_1023813 Ga0314311_10238131 205
218 3300030733 Ga0314311_1061458 Ga0314311_10614585 205
219 3300030734 Ga0316179_1064424 Ga0316179_106442413 205
220 3300030735 Ga0316178_1164474 Ga0316178_11644742 205
221 3300030736 Ga0316180_1178386 Ga0316180_11783866 205
222 3300030742 Ga0316183_1069499 Ga0316183_10694993 205
223 3300030742 Ga0316183_1103932 Ga0316183_11039323 205
224 3300030742 Ga0316183_1119405 Ga0316183_11194053 205
225 3300030742 Ga0316183_1192095 Ga0316183_119209513 205
226 3300030744 Ga0316181_1138937 Ga0316181_11389373 205
227 3300030745 Ga0316182_1000204 Ga0316182_10002042 205
228 3300030745 Ga0316182_1107000 Ga0316182_11070005 205
229 3300030745 Ga0316182_1258468 Ga0316182_12584683 205
230 3300031730 Ga0307516_10000078 Ga0307516_1000007879 205
231 3300031730 Ga0307516_10008182 Ga0307516_1000818211 205
232 3300031901 Ga0307406_10000610 Ga0307406_1000061026 205
233 3300034820 Ga0373959_0000052 Ga0373959_0000052_19315_19974 205
234 3300037312 Ga0395899_0003792 Ga0395899_0003792_5971_6624 205
235 3300037312 Ga0395899_0074289 Ga0395899_0074289_635_1288 205
236 3300037312 Ga0395899_0147813 Ga0395899_0147813_712_1365 205
237 3300037418 Ga0395900_0000001 Ga0395900_0000001_258266_258919 205
238 3300037418 Ga0395900_0464753 Ga0395900_0464753_56_709 205
239 3300037466 Ga0395898_0000002 Ga0395898_0000002_847087_847740 205
240 3300037466 Ga0395898_0015984 Ga0395898_0015984_5154_5819 205
241 3300037466 Ga0395898_0038110 Ga0395898_0038110_195_848 205
242 3300037471 Ga0395905_0002429 Ga0395905_0002429_11099_11752 205
243 3300038443 Ga0395901_0000006 Ga0395901_0000006_492763_493416 205
244 3300038443 Ga0395901_0010187 Ga0395901_0010187_1586_2251 205
245 3300038443 Ga0395901_0036009 Ga0395901_0036009_1888_2541 205
246 3300041405 Ga0439438_017103 Ga0439438_017103_844_1497 205
247 3300041410 Ga0439461_0005440 Ga0439461_0005440_549_1232 205
248 3300042002 Ga0439442_014942 Ga0439442_014942_51_704 205
249 3300042004 Ga0439445_0001581 Ga0439445_0001581_2381_3034 205
250 3300042006 Ga0439432_041379 Ga0439432_041379_68_721 205
251 3300042016 Ga0439463_003406 Ga0439463_003406_726_1379 205
252 3300042122 Ga0450920_002665 Ga0450920_002665_945_1598 205
253 3300042145 Ga0450906_002227 Ga0450906_002227_2643_3296 205
254 3300042156 Ga0439446_0000001 Ga0439446_0000001_19305_19958 205
255 3300042156 Ga0439446_0000974 Ga0439446_0000974_3800_4453 205
256 3300042185 Ga0450909_001464 Ga0450909_001464_1083_1736 205
257 3300042435 Ga0439434_0017929 Ga0439434_0017929_795_1448 205
258 3300042439 Ga0439464_0001074 Ga0439464_0001074_5252_5905 205
259 3300042531 Ga0450918_005396 Ga0450918_005396_492_1145 205
260 3300045051 Ga0451576_0034967 Ga0451576_0034967_2978_3631 205
261 3300046460 Ga0495638_0000132 Ga0495638_0000132_98700_99356 205
262 3300046460 Ga0495638_0000551 Ga0495638_0000551_39461_40114 205
263 3300046506 Ga0495583_0003976 Ga0495583_0003976_2003_2656 205
264 3300046692 Ga0495671_0103574 Ga0495671_0103574_684_1337 205
265 3300046810 Ga0495660_0000005 Ga0495660_0000005_123785_124438 205
266 3300047320 Ga0495672_0021011 Ga0495672_0021011_2062_2679 205
267 3300048916 Ga0496113_0289238 Ga0496113_0289238_519_1172 205
268 3300048927 Ga0496124_0126158 Ga0496124_0126158_750_1403 205
269 3300050489 nmdc:mga03683_191874_c1 nmdc:mga03683_191874_c1_107_766 205
270 3300050489 nmdc:mga03683_22837_c1 nmdc:mga03683_22837_c1_1577_2230 205
271 3300050490 nmdc:mga03n38_83781_c1 nmdc:mga03n38_83781_c1_647_1300 205
272 3300050491 nmdc:mga00v17_120_c1 nmdc:mga00v17_120_c1_23607_24260 205
273 3300050491 nmdc:mga00v17_2126_c1 nmdc:mga00v17_2126_c1_5427_6080 205
274 3300050491 nmdc:mga00v17_27256_c1 nmdc:mga00v17_27256_c1_867_1526 205
275 3300050491 nmdc:mga00v17_401052_c1 nmdc:mga00v17_401052_c1_213_866 205
276 3300050492 nmdc:mga0yw44_100729_c1 nmdc:mga0yw44_100729_c1_843_1496 205
277 3300050492 nmdc:mga0yw44_14057_c1 nmdc:mga0yw44_14057_c1_1607_2260 205
278 3300050492 nmdc:mga0yw44_16_c1 nmdc:mga0yw44_16_c1_63761_64414 205
279 3300050492 nmdc:mga0yw44_248569_c1 nmdc:mga0yw44_248569_c1_32_685 205
280 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_85324_85977 205
281 3300050492 nmdc:mga0yw44_38391_c1 nmdc:mga0yw44_38391_c1_26_679 205
282 3300050492 nmdc:mga0yw44_3_c1 nmdc:mga0yw44_3_c1_5427_6080 205
283 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_323241_323894 205
284 3300050493 nmdc:mga0k408_3696_c1 nmdc:mga0k408_3696_c1_3742_4395 205
285 3300050494 nmdc:mga06z11_198_c1 nmdc:mga06z11_198_c1_15984_16637 205
286 3300050495 nmdc:mga04h51_251_c1 nmdc:mga04h51_251_c1_10120_10773 205
287 3300050496 nmdc:mga07m45_104556_c1 nmdc:mga07m45_104556_c1_812_1465 205
288 3300050496 nmdc:mga07m45_20643_c1 nmdc:mga07m45_20643_c1_2248_2901 205
289 3300050496 nmdc:mga07m45_37131_c1 nmdc:mga07m45_37131_c1_1928_2581 205
290 3300050516 nmdc:mga0sz30_48939_c1 nmdc:mga0sz30_48939_c1_228_881 205
291 3300053087 Ga0500643_013335 Ga0500643_013335_1846_2499 205
292 3300053088 Ga0500644_0023408 Ga0500644_0023408_343_996 205
293 3300053090 Ga0500646_0000007 Ga0500646_0000007_24102_24755 205
294 3300053092 Ga0500583_0006482 Ga0500583_0006482_2636_3295 205
295 3300053093 Ga0500651_0042370 Ga0500651_0042370_545_1198 205
296 3300053096 Ga0500641_0000001 Ga0500641_0000001_74724_75377 205
297 3300053098 Ga0500650_0034484 Ga0500650_0034484_472_1125 205
298 3300053103 Ga0500555_000009 Ga0500555_000009_260570_261223 205
299 3300053109 Ga0500569_000018 Ga0500569_000018_39461_40114 205
300 3300053117 Ga0500593_017808 Ga0500593_017808_1997_2650 205
301 3300053131 Ga0500652_000001 Ga0500652_000001_287096_287749 205
302 3300053142 Ga0500577_0000996 Ga0500577_0000996_5972_6634 205
303 3300053142 Ga0500577_0018811 Ga0500577_0018811_1527_2180 205
304 3300053146 Ga0500588_0000557 Ga0500588_0000557_2761_3414 205
305 3300053151 Ga0500604_0002568 Ga0500604_0002568_3154_3771 205
306 3300053153 Ga0500616_0000012 Ga0500616_0000012_399403_400056 205
307 3300053724 Ga0500570_002919 Ga0500570_002919_7315_7998 205
308 3300053724 Ga0500570_112686 Ga0500570_112686_135_788 205
309 3300053738 Ga0500613_004749 Ga0500613_004749_90_749 205
310 3300002244 JGI24742J22300_10000035 JGI24742J22300_1000003513 206
311 3300003316 rootH1_10002936 rootH1_1000293632 206
312 3300003322 rootL2_10202443 rootL2_102024432 206
313 3300003323 rootH1_10311088 rootH1_103110884 206
314 3300005327 Ga0070658_10568127 Ga0070658_105681272 206
315 3300005328 Ga0070676_10004851 Ga0070676_100048518 206
316 3300005364 Ga0070673_100000033 Ga0070673_10000003346 206
317 3300005456 Ga0070678_100000201 Ga0070678_10000020113 206
318 3300005466 Ga0070685_10000690 Ga0070685_100006908 206
319 3300005530 Ga0070679_100023675 Ga0070679_1000236758 206
320 3300005535 Ga0070684_100046576 Ga0070684_1000465762 206
321 3300005577 Ga0068857_100137169 Ga0068857_1001371693 206
322 3300005614 Ga0068856_100000027 Ga0068856_10000002710 206
323 3300005614 Ga0068856_100124656 Ga0068856_1001246563 206
324 3300005616 Ga0068852_100000155 Ga0068852_10000015558 206
325 3300006051 Ga0075364_10006382 Ga0075364_100063826 206
326 3300006186 Ga0075369_10000001 Ga0075369_100000014 206
327 3300006237 Ga0097621_100043685 Ga0097621_1000436854 206
328 3300009098 Ga0105245_10006834 Ga0105245_1000683411 206
329 3300009174 Ga0105241_10126007 Ga0105241_101260072 206
330 3300009545 Ga0105237_10838583 Ga0105237_108385832 206
331 3300009553 Ga0105249_10002504 Ga0105249_1000250414 206
332 3300009979 Ga0105032_101686 Ga0105032_1016863 206
333 3300011119 Ga0105246_10182970 Ga0105246_101829702 206
334 3300013100 Ga0157373_10012323 Ga0157373_100123232 206
335 3300013102 Ga0157371_10000561 Ga0157371_100005616 206
336 3300013104 Ga0157370_10012318 Ga0157370_100123187 206
337 3300013104 Ga0157370_10332386 Ga0157370_103323862 206
338 3300013105 Ga0157369_10000029 Ga0157369_10000029219 206
339 3300013105 Ga0157369_10013289 Ga0157369_1001328912 206
340 3300013296 Ga0157374_10001423 Ga0157374_1000142328 206
341 3300013306 Ga0163162_11148948 Ga0163162_111489481 206
342 3300014969 Ga0157376_10000027 Ga0157376_100000278 206
343 3300025907 Ga0207645_10010575 Ga0207645_100105753 206
344 3300025909 Ga0207705_10000115 Ga0207705_1000011541 206
345 3300025909 Ga0207705_10331988 Ga0207705_103319882 206
346 3300025911 Ga0207654_10144880 Ga0207654_101448801 206
347 3300025919 Ga0207657_10000712 Ga0207657_1000071210 206
348 3300025919 Ga0207657_10052585 Ga0207657_100525854 206
349 3300025921 Ga0207652_10028902 Ga0207652_100289022 206
350 3300025949 Ga0207667_10038991 Ga0207667_100389917 206
351 3300025960 Ga0207651_10000141 Ga0207651_1000014114 206
352 3300025961 Ga0207712_10003874 Ga0207712_100038747 206
353 3300026078 Ga0207702_10000015 Ga0207702_10000015109 206
354 3300026078 Ga0207702_10000034 Ga0207702_10000034109 206
355 3300026078 Ga0207702_10211055 Ga0207702_102110552 206
356 3300026116 Ga0207674_10257702 Ga0207674_102577022 206
357 3300026121 Ga0207683_10003131 Ga0207683_1000313119 206
358 3300026142 Ga0207698_10000048 Ga0207698_1000004810 206
359 3300028558 Ga0265326_10001685 Ga0265326_100016857 206
360 3300028573 Ga0265334_10004363 Ga0265334_100043636 206
361 3300028666 Ga0265336_10000652 Ga0265336_100006525 206
362 3300028800 Ga0265338_10000482 Ga0265338_1000048280 206
363 3300028800 Ga0265338_10012735 Ga0265338_1001273510 206
364 3300030745 Ga0316182_1017501 Ga0316182_10175012 206
365 3300031507 Ga0307509_10019515 Ga0307509_100195152 206
366 3300031901 Ga0307406_10000001 Ga0307406_10000001203 206
367 3300037418 Ga0395900_0252072 Ga0395900_0252072_726_1382 206
368 3300037418 Ga0395900_0610166 Ga0395900_0610166_258_914 206
369 3300041997 Ga0439431_0036841 Ga0439431_0036841_181_840 206
370 3300044658 Ga0466972_0069662 Ga0466972_0069662_1013_1666 206
371 3300044683 Ga0466965_0000206 Ga0466965_0000206_7479_8132 206
372 3300045836 Ga0466958_0267103 Ga0466958_0267103_185_850 206
373 3300048918 Ga0496115_0000405 Ga0496115_0000405_25686_26342 206
374 3300049568 Ga0501031_0002442 Ga0501031_0002442_5452_6108 206
375 3300049569 Ga0501032_0000624 Ga0501032_0000624_341_997 206
376 3300049571 Ga0501034_0013740 Ga0501034_0013740_5238_5894 206
377 3300049571 Ga0501034_0037263 Ga0501034_0037263_3806_4462 206
378 3300049571 Ga0501034_0043701 Ga0501034_0043701_2866_3522 206
379 3300049572 Ga0501036_0001666 Ga0501036_0001666_6603_7259 206
380 3300049573 Ga0501037_0000001 Ga0501037_0000001_193141_193797 206
381 3300049573 Ga0501037_0000031 Ga0501037_0000031_118371_119027 206
382 3300049574 Ga0501038_0080347 Ga0501038_0080347_1657_2313 206
383 3300049576 Ga0501040_0103327 Ga0501040_0103327_63_719 206
384 3300049578 Ga0501042_0052896 Ga0501042_0052896_900_1556 206
385 3300049579 Ga0501043_0000366 Ga0501043_0000366_6922_7578 206
386 3300049580 Ga0501046_0000138 Ga0501046_0000138_6839_7495 206
387 3300049581 Ga0501047_0000032 Ga0501047_0000032_31396_32052 206
388 3300049581 Ga0501047_0000310 Ga0501047_0000310_46074_46730 206
389 3300049582 Ga0501048_0000013 Ga0501048_0000013_38983_39639 206
390 3300049585 Ga0501069_0220897 Ga0501069_0220897_33_689 206
391 3300049586 Ga0501070_0120791 Ga0501070_0120791_360_1016 206
392 3300049589 Ga0501073_0054298 Ga0501073_0054298_1795_2451 206
393 3300049744 Ga0501083_0037527 Ga0501083_0037527_1276_1932 206
394 3300049822 Ga0501035_0000033 Ga0501035_0000033_39227_39883 206
395 3300049822 Ga0501035_0000799 Ga0501035_0000799_20457_21113 206
396 3300049823 Ga0501044_0085458 Ga0501044_0085458_1337_1993 206
397 3300049824 Ga0501045_0209784 Ga0501045_0209784_120_776 206
398 3300050491 nmdc:mga00v17_1693_c1 nmdc:mga00v17_1693_c1_8520_9185 206
399 3300050491 nmdc:mga00v17_182905_c1 nmdc:mga00v17_182905_c1_48_707 206
400 3300050492 nmdc:mga0yw44_25522_c1 nmdc:mga0yw44_25522_c1_409_1074 206
401 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_72248_72916 206
402 3300053079 Ga0500610_0051502 Ga0500610_0051502_17_676 206
403 3300053088 Ga0500644_0008359 Ga0500644_0008359_943_1605 206
404 3300053092 Ga0500583_0000082 Ga0500583_0000082_26259_26918 206
405 3300053093 Ga0500651_0000001 Ga0500651_0000001_337835_338491 206
406 3300053093 Ga0500651_0000447 Ga0500651_0000447_15954_16619 206
407 3300053093 Ga0500651_0057950 Ga0500651_0057950_704_1363 206
408 3300053118 Ga0500594_0000018 Ga0500594_0000018_4753_5409 206
409 3300053129 Ga0500628_000028 Ga0500628_000028_33390_34052 206
410 3300053130 Ga0500642_0003187 Ga0500642_0003187_1388_2047 206
411 3300053142 Ga0500577_0006182 Ga0500577_0006182_209_865 206
412 3300053142 Ga0500577_0029402 Ga0500577_0029402_851_1516 206
413 3300053142 Ga0500577_0030703 Ga0500577_0030703_350_1006 206
414 3300053147 Ga0500589_000013 Ga0500589_000013_70612_71271 206
415 3300054114 Ga0501084_0311515 Ga0501084_0311515_527_1183 206
416 3300060353 Ga0501082_0510640 Ga0501082_0510640_83_739 206
417 2162886012 MBSR1b_contig_6117524 MBSR1b_0919.00004750 207
418 3300003322 rootL2_10079259 rootL2_100792593 207
419 3300003323 rootH1_10030295 rootH1_1003029513 207
420 3300005293 Ga0065715_10003451 Ga0065715_100034515 207
421 3300005456 Ga0070678_100003010 Ga0070678_1000030109 207
422 3300005563 Ga0068855_100000663 Ga0068855_10000066351 207
423 3300005577 Ga0068857_100021011 Ga0068857_1000210115 207
424 3300005616 Ga0068852_100000001 Ga0068852_100000001464 207
425 3300005616 Ga0068852_100127692 Ga0068852_1001276923 207
426 3300005842 Ga0068858_100261066 Ga0068858_1002610661 207
427 3300005937 Ga0081455_10000001 Ga0081455_10000001313 207
428 3300006038 Ga0075365_10000001 Ga0075365_1000000192 207
429 3300006042 Ga0075368_10000065 Ga0075368_1000006529 207
430 3300006048 Ga0075363_100160372 Ga0075363_1001603722 207
431 3300006178 Ga0075367_10000093 Ga0075367_1000009326 207
432 3300006178 Ga0075367_10009612 Ga0075367_100096124 207
433 3300006195 Ga0075366_10001109 Ga0075366_1000110912 207
434 3300006195 Ga0075366_10246603 Ga0075366_102466032 207
435 3300006353 Ga0075370_10000462 Ga0075370_1000046212 207
436 3300006358 Ga0068871_100000232 Ga0068871_10000023217 207
437 3300009093 Ga0105240_10000050 Ga0105240_10000050120 207
438 3300009093 Ga0105240_10001357 Ga0105240_1000135750 207
439 3300009098 Ga0105245_10000002 Ga0105245_1000000218 207
440 3300009174 Ga0105241_10257938 Ga0105241_102579382 207
441 3300009177 Ga0105248_10830652 Ga0105248_108306521 207
442 3300009545 Ga0105237_10000002 Ga0105237_10000002358 207
443 3300009545 Ga0105237_10114986 Ga0105237_101149864 207
444 3300009551 Ga0105238_10072227 Ga0105238_100722273 207
445 3300009979 Ga0105032_100148 Ga0105032_1001485 207
446 3300013105 Ga0157369_10189191 Ga0157369_101891913 207
447 3300013296 Ga0157374_10000073 Ga0157374_1000007385 207
448 3300013296 Ga0157374_10213119 Ga0157374_102131193 207
449 3300013307 Ga0157372_10305370 Ga0157372_103053703 207
450 3300014969 Ga0157376_10000001 Ga0157376_10000001357 207
451 3300025904 Ga0207647_10067177 Ga0207647_100671774 207
452 3300025911 Ga0207654_10173641 Ga0207654_101736412 207
453 3300025913 Ga0207695_10000158 Ga0207695_10000158111 207
454 3300025913 Ga0207695_10012231 Ga0207695_100122319 207
455 3300025914 Ga0207671_10000008 Ga0207671_10000008462 207
456 3300025914 Ga0207671_10080255 Ga0207671_100802553 207
457 3300025927 Ga0207687_10000001 Ga0207687_100000011192 207
458 3300025949 Ga0207667_10000756 Ga0207667_1000075650 207
459 3300025986 Ga0207658_10009982 Ga0207658_1000998211 207
460 3300026116 Ga0207674_10020195 Ga0207674_100201957 207
461 3300026116 Ga0207674_10025636 Ga0207674_100256363 207
462 3300026121 Ga0207683_10008126 Ga0207683_100081269 207
463 3300026142 Ga0207698_10000001 Ga0207698_10000001415 207
464 3300027866 Ga0209813_10000001 Ga0209813_10000001288 207
465 3300028558 Ga0265326_10000530 Ga0265326_1000053013 207
466 3300028573 Ga0265334_10000115 Ga0265334_100001156 207
467 3300028573 Ga0265334_10002006 Ga0265334_1000200610 207
468 3300028666 Ga0265336_10000424 Ga0265336_1000042423 207
469 3300028800 Ga0265338_10000003 Ga0265338_10000003355 207
470 3300028800 Ga0265338_10000039 Ga0265338_10000039156 207
471 3300029957 Ga0265324_10039495 Ga0265324_100394952 207
472 3300031241 Ga0265325_10034156 Ga0265325_100341562 207
473 3300031595 Ga0265313_10035909 Ga0265313_100359094 207
474 3300031595 Ga0265313_10146440 Ga0265313_101464402 207
475 3300044694 Ga0466963_0120632 Ga0466963_0120632_112_774 207
476 3300048903 Ga0496100_0184354 Ga0496100_0184354_557_1216 207
477 3300048908 Ga0496105_0387534 Ga0496105_0387534_348_1016 207
478 3300048915 Ga0496112_0025793 Ga0496112_0025793_3519_4187 207
479 3300050490 nmdc:mga03n38_142_c1 nmdc:mga03n38_142_c1_188_859 207
480 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_185030_185689 207
481 3300050493 nmdc:mga0k408_6247_c1 nmdc:mga0k408_6247_c1_3016_3699 207
482 3300050494 nmdc:mga06z11_127_c1 nmdc:mga06z11_127_c1_2432_3115 207
483 3300050494 nmdc:mga06z11_15_c1 nmdc:mga06z11_15_c1_5000_5671 207
484 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_260774_261445 207
485 3300050495 nmdc:mga04h51_9766_c1 nmdc:mga04h51_9766_c1_846_1529 207
486 3300050496 nmdc:mga07m45_5621_c1 nmdc:mga07m45_5621_c1_3323_3994 207
487 3300053079 Ga0500610_0000006 Ga0500610_0000006_66715_67383 207
488 3300053087 Ga0500643_006482 Ga0500643_006482_3661_4329 207
489 3300053088 Ga0500644_0000594 Ga0500644_0000594_11611_12279 207
490 3300053088 Ga0500644_0029433 Ga0500644_0029433_202_861 207
491 3300053090 Ga0500646_0000490 Ga0500646_0000490_2731_3390 207
492 3300053098 Ga0500650_0000001 Ga0500650_0000001_301283_301942 207
493 3300053103 Ga0500555_000001 Ga0500555_000001_577909_578571 207
494 3300053103 Ga0500555_000002 Ga0500555_000002_703244_703912 207
495 3300053104 Ga0500556_0012414 Ga0500556_0012414_1167_1826 207
496 3300053108 Ga0500562_004711 Ga0500562_004711_1165_1824 207
497 3300053118 Ga0500594_0000001 Ga0500594_0000001_963274_963933 207
498 3300053131 Ga0500652_000022 Ga0500652_000022_44867_45535 207
499 3300053133 Ga0500655_001382 Ga0500655_001382_2355_3014 207
500 3300053142 Ga0500577_0001222 Ga0500577_0001222_457_1116 207
501 3300053143 Ga0500579_000781 Ga0500579_000781_12802_13461 207
502 3300053150 Ga0500603_160325 Ga0500603_160325_17_679 207
503 3300053155 Ga0500620_030693 Ga0500620_030693_647_1327 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

23

218

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8byh-assembly1.cif.gz_A crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9258 1 201
8byh-assembly1.cif.gz_B crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9227 1 201
8b1n-assembly1.cif.gz_B crystal structure of trmd-tm1570 from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9213 1 197
8apt-assembly1.cif.gz_A crystal structure of h. influenzae trmd in complex with compound 13 0.9202 1 201
6jki-assembly1.cif.gz_B crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa 0.9196 1 197
ID Description Score Start End Superfamily
3knuD02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9824 167 199 1.10.1270.20
3knuB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9816 167 199 1.10.1270.20
5zhjA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9646 166 199 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9482 165 201 1.10.1270.20
3ky7A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9479 164 199 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A7C3K4Y8-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9825 2 138 GO:0002939
GO:0005829
GO:0052906
AF-A0A563CP47-F1-model_v4 deleted 0.977 1 154
AF-A0A661TIM6-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9715 1 149 GO:0002939
GO:0005829
GO:0052906
AF-A0A7V1U7T3-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9566 2 146 GO:0002939
GO:0005829
GO:0052906
AF-A0A661I5S3-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9554 3 149 GO:0002939
GO:0005829
GO:0052906

Feature Viewer

pLDDT pTM Quality
88.44 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map