F456067

General Info

Members Datasets Scaffolds Average Seq Length
503 295 1006 325

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0005899|Ga0495603_0005899_1186_2319
Length 377
Sequence MSPRRKYGLLRRFAPRNGEANTRARVLLANADRFSDDGRANNKNGPGSALIMSTWIKSFCVVAALLGVSVAVDQAQAQNYPTRAITLVIPFAPGGSTSIVGRAIADKMSEVLGEKVVVDNRPGAGGTVGTKAVAKSDPDGYTLLLGYTGTLAIGPSLYKNPGYDPRKDFAPIGMIGNAPNSLVVHPSFPAKSVAELIAYAKANPDKVNFGSAGAGTASHITGEYFARAAGIKLVHIPYKGTGPALTDLLGGHIPMAFAPIPASHPNVSAGKLRALAVTSITRSGLLPDVPTMIEAGLSGFDASLYYGLVAPSGTPRPIIDKLNKALRDALASDEVKKQLGNDGTEITPGTPEDYVDFIDKDEKKWSQLVKTSGVEQE

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
170 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
265 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
269 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
270 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
275 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
276 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
277 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
278 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
279 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
280 2791355199
281 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
282 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
283 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
284 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
285 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
286 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
287 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
288 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
289 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
290 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
291 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
292 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
293 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
294 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
295 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.3
Nodule 2.78
Rhizoplane 6.76
Rhizosphere 67.99
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0005899 3300046455 Bacteria 7321
2 JGI25406J46586_10023425 3300003203 Bacteria 2440
3 JGI25153J46596_10000848 3300003215 Bacteria 18741
4 rootH2_10190596 3300003320 Bacteria 1454
5 JGI25404J52841_10000224 3300003659 Bacteria 6968
6 JGI25404J52841_10008656 3300003659 Bacteria 2172
7 JGI25404J52841_10022402 3300003659 Bacteria 1365
8 Ga0070658_10258973 3300005327 Bacteria 1477
9 Ga0070658_10342334 3300005327 Bacteria 1279
10 Ga0070658_10399759 3300005327 Bacteria 1180
11 Ga0070676_10001328 3300005328 Bacteria 12430
12 Ga0070683_100380429 3300005329 Bacteria 1345
13 Ga0070690_100205473 3300005330 Bacteria 1372
14 Ga0070677_10001696 3300005333 Bacteria 6967
15 Ga0068869_100034551 3300005334 Bacteria 3577
16 Ga0068869_100104866 3300005334 Bacteria 2143
17 Ga0068869_100114985 3300005334 Bacteria 2051
18 Ga0068869_100197163 3300005334 Bacteria 1586
19 Ga0070666_10059744 3300005335 Bacteria 2579
20 Ga0070682_100181181 3300005337 Bacteria 1472
21 Ga0068868_100105058 3300005338 Bacteria 2289
22 Ga0070660_100092168 3300005339 Bacteria 2391
23 Ga0070661_100148546 3300005344 Bacteria 1771
24 Ga0070668_100001020 3300005347 Bacteria 19602
25 Ga0070668_100287295 3300005347 Bacteria 1375
26 Ga0070675_100199376 3300005354 Bacteria 1737
27 Ga0070671_100108524 3300005355 Bacteria 2331
28 Ga0070671_100211282 3300005355 Bacteria 1646
29 Ga0070673_100001545 3300005364 Bacteria 13548
30 Ga0070688_100141245 3300005365 Bacteria 1636
31 Ga0070688_100154098 3300005365 Bacteria 1573
32 Ga0070667_100001177 3300005367 Bacteria 23791
33 Ga0070667_100360963 3300005367 Bacteria 1317
34 Ga0070709_10012977 3300005434 Bacteria 4673
35 Ga0070714_100029801 3300005435 Bacteria 4538
36 Ga0070713_100128641 3300005436 Bacteria 2231
37 Ga0070713_100176325 3300005436 Bacteria 1918
38 Ga0070710_10000566 3300005437 Bacteria 17559
39 Ga0070710_10016456 3300005437 Bacteria 3764
40 Ga0070701_10048554 3300005438 Bacteria 2191
41 Ga0070711_100051273 3300005439 Bacteria 2833
42 Ga0070711_100328415 3300005439 Bacteria 1224
43 Ga0070700_100237463 3300005441 Bacteria 1300
44 Ga0070663_100006160 3300005455 Bacteria 7184
45 Ga0070663_100047491 3300005455 Bacteria 3041
46 Ga0070663_100194995 3300005455 Bacteria 1578
47 Ga0070678_100001325 3300005456 Bacteria 13145
48 Ga0070678_100004899 3300005456 Bacteria 7657
49 Ga0070662_100029547 3300005457 Bacteria 3826
50 Ga0068867_100024014 3300005459 Bacteria 4369
51 Ga0068867_100119677 3300005459 Bacteria 2033
52 Ga0070698_100084473 3300005471 Bacteria 3163
53 Ga0070698_100102362 3300005471 Bacteria 2835
54 Ga0070698_100201790 3300005471 Bacteria 1924
55 Ga0070684_100134044 3300005535 Bacteria 2236
56 Ga0070697_100352163 3300005536 Bacteria 1272
57 Ga0068853_100006712 3300005539 Bacteria 9170
58 Ga0068853_100037105 3300005539 Bacteria 4145
59 Ga0070672_100028397 3300005543 Bacteria 4184
60 Ga0070672_100252621 3300005543 Bacteria 1485
61 Ga0070686_100052605 3300005544 Bacteria 2597
62 Ga0070665_100002603 3300005548 Bacteria 19699
63 Ga0070665_100005904 3300005548 Bacteria 12540
64 Ga0070665_100029096 3300005548 Bacteria 5561
65 Ga0070665_100035370 3300005548 Bacteria 5023
66 Ga0070665_100076724 3300005548 Bacteria 3348
67 Ga0070665_100087059 3300005548 Bacteria 3129
68 Ga0070665_100117060 3300005548 Bacteria 2667
69 Ga0070665_100126295 3300005548 Bacteria 2560
70 Ga0070665_100509378 3300005548 Bacteria 1215
71 Ga0068855_100245410 3300005563 Bacteria 1999
72 Ga0068856_100041165 3300005614 Bacteria 4539
73 Ga0070702_100025267 3300005615 Bacteria 3181
74 Ga0070702_100064557 3300005615 Bacteria 2142
75 Ga0070702_100127777 3300005615 Bacteria 1601
76 Ga0068859_100054600 3300005617 Bacteria 4018
77 Ga0068859_100391650 3300005617 Bacteria 1485
78 Ga0068864_100001880 3300005618 Bacteria 17239
79 Ga0068866_10047897 3300005718 Bacteria 2158
80 Ga0068866_10097686 3300005718 Bacteria 1614
81 Ga0068851_10000902 3300005834 Bacteria 12790
82 Ga0068863_100004156 3300005841 Bacteria 14294
83 Ga0068863_100261175 3300005841 Bacteria 1674
84 Ga0068860_100123513 3300005843 Bacteria 2480
85 Ga0068860_100225437 3300005843 Bacteria 1820
86 Ga0068862_100141010 3300005844 Bacteria 2139
87 Ga0081455_10002253 3300005937 Bacteria 22969
88 Ga0081455_10028225 3300005937 Bacteria 5130
89 Ga0081455_10036995 3300005937 Bacteria 4339
90 Ga0081455_10056366 3300005937 Bacteria 3337
91 Ga0081455_10129659 3300005937 Bacteria 1974
92 Ga0081540_1001425 3300005983 Bacteria 20682
93 Ga0081540_1004726 3300005983 Bacteria 10301
94 Ga0081540_1005173 3300005983 Bacteria 9765
95 Ga0081540_1006028 3300005983 Bacteria 8918
96 Ga0081540_1006241 3300005983 Bacteria 8732
97 Ga0081540_1006267 3300005983 Bacteria 8705
98 Ga0081540_1014663 3300005983 Bacteria 5009
99 Ga0081540_1021219 3300005983 Bacteria 3878
100 Ga0081540_1077134 3300005983 Bacteria 1516
101 Ga0081539_10000040 3300005985 Bacteria 292753
102 Ga0081539_10025601 3300005985 Bacteria 3793
103 Ga0070717_10045354 3300006028 Bacteria 3593
104 Ga0070717_10124716 3300006028 Bacteria 2210
105 Ga0075365_10004408 3300006038 Bacteria 7454
106 Ga0075365_10029168 3300006038 Bacteria 3524
107 Ga0075365_10034334 3300006038 Bacteria 3275
108 Ga0075365_10112662 3300006038 Bacteria 1871
109 Ga0075368_10016316 3300006042 Bacteria 2767
110 Ga0075363_100001722 3300006048 Bacteria 8505
111 Ga0075363_100011800 3300006048 Bacteria 4193
112 Ga0075364_10063250 3300006051 Bacteria 2429
113 Ga0070715_10006626 3300006163 Bacteria 3950
114 Ga0070716_100010683 3300006173 Bacteria 4611
115 Ga0075362_10006221 3300006177 Bacteria 4436
116 Ga0075367_10001823 3300006178 Bacteria 9381
117 Ga0075367_10006072 3300006178 Bacteria 6068
118 Ga0075367_10041655 3300006178 Bacteria 2685
119 Ga0075367_10258378 3300006178 Bacteria 1093
120 Ga0075369_10001202 3300006186 Bacteria 8777
121 Ga0075369_10002235 3300006186 Bacteria 6861
122 Ga0075369_10086113 3300006186 Bacteria 1398
123 Ga0075366_10000862 3300006195 Bacteria 14633
124 Ga0075366_10095915 3300006195 Bacteria 1778
125 Ga0097621_100343500 3300006237 Bacteria 1326
126 Ga0075370_10017848 3300006353 Bacteria 3839
127 Ga0075370_10029635 3300006353 Bacteria 3049
128 Ga0068871_100008125 3300006358 Bacteria 7533
129 Ga0068871_100260765 3300006358 Bacteria 1512
130 Ga0075428_100403914 3300006844 Bacteria 1464
131 Ga0075430_100000415 3300006846 Bacteria 31698
132 Ga0075433_10206947 3300006852 Bacteria 1744
133 Ga0075434_100037430 3300006871 Bacteria 4803
134 Ga0075434_100272490 3300006871 Bacteria 1712
135 Ga0097620_100054600 3300006931 Bacteria 4018
136 Ga0097620_100391721 3300006931 Bacteria 1485
137 Ga0075435_100012161 3300007076 Bacteria 6364
138 Ga0099794_10103384 3300007265 Bacteria 1423
139 Ga0099795_10004505 3300007788 Bacteria 3604
140 Ga0099795_10010133 3300007788 Bacteria 2763
141 Ga0105240_10417520 3300009093 Bacteria 1508
142 Ga0111539_10098733 3300009094 Bacteria 3429
143 Ga0105245_10104634 3300009098 Bacteria 2624
144 Ga0114129_10056391 3300009147 Bacteria 5503
145 Ga0114129_10126190 3300009147 Bacteria 3518
146 Ga0105243_10028125 3300009148 Bacteria 4313
147 Ga0105243_10347224 3300009148 Bacteria 1361
148 Ga0105243_10386252 3300009148 Bacteria 1296
149 Ga0105241_10089240 3300009174 Bacteria 2429
150 Ga0105248_10047297 3300009177 Bacteria 4824
151 Ga0105248_10180725 3300009177 Bacteria 2377
152 Ga0105237_10231819 3300009545 Bacteria 1847
153 Ga0105249_10090614 3300009553 Bacteria 2859
154 Ga0105249_10200179 3300009553 Bacteria 1954
155 Ga0105239_10113115 3300010375 Bacteria 3010
156 Ga0157374_10041743 3300013296 Bacteria 4229
157 Ga0157374_10195004 3300013296 Bacteria 1982
158 Ga0157374_10259844 3300013296 Bacteria 1710
159 Ga0157378_10293129 3300013297 Bacteria 1572
160 Ga0157378_10480761 3300013297 Bacteria 1237
161 Ga0163162_10092170 3300013306 Bacteria 3113
162 Ga0163162_10135999 3300013306 Bacteria 2568
163 Ga0163162_10250234 3300013306 Bacteria 1904
164 Ga0157372_10058304 3300013307 Bacteria 4316
165 Ga0157375_10030482 3300013308 Bacteria 5086
166 Ga0157375_10173978 3300013308 Bacteria 2302
167 Ga0157375_10281338 3300013308 Bacteria 1826
168 Ga0157375_11208471 3300013308 Bacteria 887
169 Ga0163163_10012790 3300014325 Bacteria 7659
170 Ga0163163_10043007 3300014325 Bacteria 4427
171 Ga0163163_10050674 3300014325 Bacteria 4089
172 Ga0163163_10146483 3300014325 Bacteria 2405
173 Ga0163163_10161796 3300014325 Bacteria 2284
174 Ga0157379_10058491 3300014968 Bacteria 3447
175 Ga0157376_10105952 3300014969 Bacteria 2466
176 Ga0157376_10141262 3300014969 Bacteria 2161
177 Ga0157376_10384242 3300014969 Bacteria 1353
178 Ga0163161_10029435 3300017792 Bacteria 3905
179 Ga0163161_10115871 3300017792 Bacteria 2008
180 Ga0209564_1002206 3300025295 Bacteria 16240
181 Ga0209758_1001610 3300025297 Bacteria 25785
182 Ga0209758_1010893 3300025297 Bacteria 5358
183 Ga0209758_1018692 3300025297 Bacteria 3383
184 Ga0207697_10059746 3300025315 Bacteria 1585
185 Ga0207682_10000299 3300025893 Bacteria 22382
186 Ga0207692_10006279 3300025898 Bacteria 4816
187 Ga0207692_10054489 3300025898 Bacteria 2042
188 Ga0207642_10002988 3300025899 Bacteria 5295
189 Ga0207685_10008506 3300025905 Bacteria 2927
190 Ga0207699_10020798 3300025906 Bacteria 3524
191 Ga0207645_10001423 3300025907 Bacteria 19581
192 Ga0207643_10004064 3300025908 Bacteria 7869
193 Ga0207705_10226813 3300025909 Bacteria 1420
194 Ga0207654_10012862 3300025911 Bacteria 4294
195 Ga0207654_10091641 3300025911 Bacteria 1854
196 Ga0207671_10115789 3300025914 Bacteria 2044
197 Ga0207693_10000613 3300025915 Bacteria 31929
198 Ga0207693_10049853 3300025915 Unclassified 3288
199 Ga0207663_10000464 3300025916 Bacteria 17663
200 Ga0207663_10013082 3300025916 Bacteria 4502
201 Ga0207649_10154610 3300025920 Bacteria 1583
202 Ga0207649_10231343 3300025920 Bacteria 1322
203 Ga0207659_10001187 3300025926 Bacteria 15543
204 Ga0207659_10105968 3300025926 Bacteria 2128
205 Ga0207687_10017996 3300025927 Bacteria 4661
206 Ga0207687_10051950 3300025927 Bacteria 2859
207 Ga0207700_10054204 3300025928 Bacteria 3008
208 Ga0207700_10239601 3300025928 Bacteria 1545
209 Ga0207700_10256897 3300025928 Bacteria 1494
210 Ga0207664_10304223 3300025929 Bacteria 1403
211 Ga0207644_10036312 3300025931 Bacteria 3459
212 Ga0207644_10178786 3300025931 Bacteria 1661
213 Ga0207706_10010878 3300025933 Bacteria 8301
214 Ga0207706_10058318 3300025933 Bacteria 3400
215 Ga0207709_10045784 3300025935 Bacteria 2651
216 Ga0207670_10399382 3300025936 Bacteria 1099
217 Ga0207669_10015222 3300025937 Bacteria 3874
218 Ga0207669_10145727 3300025937 Bacteria 1651
219 Ga0207704_10122977 3300025938 Bacteria 1780
220 Ga0207704_10328468 3300025938 Bacteria 1182
221 Ga0207665_10000481 3300025939 Bacteria 27040
222 Ga0207691_10000016 3300025940 Bacteria 141024
223 Ga0207691_10060364 3300025940 Bacteria 3445
224 Ga0207691_10310058 3300025940 Bacteria 1354
225 Ga0207689_10064332 3300025942 Bacteria 3018
226 Ga0207689_10125387 3300025942 Bacteria 2113
227 Ga0207667_10190937 3300025949 Bacteria 2102
228 Ga0207651_10038049 3300025960 Bacteria 3157
229 Ga0207651_10083164 3300025960 Bacteria 2314
230 Ga0207712_10017211 3300025961 Bacteria 4692
231 Ga0207668_10026007 3300025972 Bacteria 3795
232 Ga0207668_10037542 3300025972 Bacteria 3243
233 Ga0207668_10114955 3300025972 Bacteria 2026
234 Ga0207668_10299152 3300025972 Bacteria 1327
235 Ga0207640_10238507 3300025981 Bacteria 1404
236 Ga0207640_10301258 3300025981 Bacteria 1268
237 Ga0207677_10005945 3300026023 Bacteria 6642
238 Ga0207677_10050354 3300026023 Bacteria 2817
239 Ga0207639_10020545 3300026041 Bacteria 4728
240 Ga0207639_10037896 3300026041 Bacteria 3584
241 Ga0207678_10000808 3300026067 Bacteria 28722
242 Ga0207678_10012849 3300026067 Bacteria 7350
243 Ga0207678_10083034 3300026067 Bacteria 2740
244 Ga0207678_10106245 3300026067 Bacteria 2395
245 Ga0207678_10249815 3300026067 Bacteria 1519
246 Ga0207678_10268815 3300026067 Bacteria 1462
247 Ga0207641_10241841 3300026088 Bacteria 1682
248 Ga0207676_10204906 3300026095 Bacteria 1745
249 Ga0207674_10071603 3300026116 Bacteria 3483
250 Ga0207675_100059521 3300026118 Bacteria 3564
251 Ga0207683_10000057 3300026121 Bacteria 84479
252 Ga0207683_10192307 3300026121 Bacteria 1853
253 Ga0209179_1005031 3300027512 Bacteria 2040
254 Ga0268266_10000936 3300028379 Bacteria 37196
255 Ga0268266_10002702 3300028379 Bacteria 18611
256 Ga0268266_10003236 3300028379 Bacteria 16447
257 Ga0268266_10003576 3300028379 Bacteria 15407
258 Ga0268266_10031929 3300028379 Bacteria 4474
259 Ga0268266_10056313 3300028379 Bacteria 3382
260 Ga0268266_10232184 3300028379 Bacteria 1699
261 Ga0268265_10057596 3300028380 Bacteria 2962
262 Ga0268264_10126090 3300028381 Bacteria 2262
263 Ga0268264_10305194 3300028381 Bacteria 1500
264 Ga0307517_10001037 3300028786 Bacteria 47162
265 Ga0307515_10068899 3300028794 Bacteria 4849
266 Ga0265339_10007541 3300031249 Bacteria 7014
267 Ga0265331_10106780 3300031250 Bacteria 1285
268 Ga0307513_10045919 3300031456 Bacteria 4770
269 Ga0307508_10042505 3300031616 Bacteria 4077
270 Ga0307508_10083930 3300031616 Bacteria 2768
271 Ga0265314_10036699 3300031711 Bacteria 3558
272 Ga0265314_10065904 3300031711 Bacteria 2444
273 Ga0265314_10071781 3300031711 Bacteria 2315
274 Ga0307516_10097182 3300031730 Bacteria 2765
275 Ga0307405_10184956 3300031731 Bacteria 1499
276 Ga0307413_10024331 3300031824 Bacteria 3300
277 Ga0307410_10003450 3300031852 Bacteria 7933
278 Ga0307409_100337612 3300031995 Bacteria 1416
279 Ga0307416_100496004 3300032002 Bacteria 1284
280 Ga0307416_100671439 3300032002 Bacteria 1123
281 Ga0307510_10008288 3300033180 Bacteria 12388
282 Ga0307510_10023239 3300033180 Bacteria 7191
283 Ga0307510_10259239 3300033180 Bacteria 1221
284 Ga0373923_0030466 3300035111 Bacteria 2170
285 Ga0373939_0031598 3300035114 Bacteria 1532
286 Ga0373953_0031824 3300035117 Bacteria 2054
287 Ga0373946_0021546 3300035171 Bacteria 2500
288 Ga0373961_0057518 3300035241 Bacteria 1170
289 Ga0373931_0073464 3300035691 Bacteria 1871
290 Ga0373935_0002731 3300035692 Bacteria 10160
291 Ga0373927_0008451 3300035695 Bacteria 6924
292 Ga0373927_0025393 3300035695 Bacteria 3874
293 Ga0373927_0045319 3300035695 Bacteria 2845
294 Ga0373927_0054029 3300035695 Bacteria 2598
295 Ga0373933_0037585 3300035724 Bacteria 2841
296 Ga0373947_0012057 3300035725 Bacteria 4950
297 Ga0373947_0015148 3300035725 Bacteria 4426
298 Ga0373947_0123295 3300035725 Bacteria 1648
299 Ga0373925_0030036 3300037068 Bacteria 3987
300 Ga0373925_0425434 3300037068 Bacteria 1085
301 Ga0395898_0083897 3300037466 Bacteria 3071
302 Ga0395898_0234182 3300037466 Bacteria 1751
303 Ga0395905_0085268 3300037471 Bacteria 2960
304 Ga0395901_0176941 3300038443 Bacteria 2238
305 Ga0395901_0376522 3300038443 Bacteria 1462
306 Ga0450911_000517 3300042115 Bacteria 12187
307 Ga0450897_004219 3300042128 Bacteria 1191
308 Ga0450898_012168 3300042134 Bacteria 1419
309 Ga0466959_0204389 3300045049 Bacteria 1374
310 Ga0451576_0643751 3300045051 Bacteria 1114
311 Ga0495617_064855 3300046452 Bacteria 1205
312 Ga0495603_0017827 3300046455 Bacteria 4298
313 Ga0495603_0019452 3300046455 Bacteria 4109
314 Ga0495629_0000835 3300046459 Bacteria 24987
315 Ga0495638_0041834 3300046460 Bacteria 2896
316 Ga0495641_0006814 3300046461 Bacteria 7323
317 Ga0495651_0035101 3300046462 Bacteria 3906
318 Ga0495580_0138642 3300046472 Bacteria 1686
319 Ga0495639_0034884 3300046475 Bacteria 2250
320 Ga0495639_0058309 3300046475 Bacteria 1766
321 Ga0495662_0011413 3300046476 Bacteria 4341
322 Ga0495664_0004268 3300046477 Bacteria 7804
323 Ga0495594_0001566 3300046499 Bacteria 11876
324 Ga0495594_0155913 3300046499 Bacteria 1297
325 Ga0495606_0010481 3300046507 Bacteria 7684
326 Ga0495628_0029261 3300046516 Bacteria 4468
327 Ga0495630_0116626 3300046517 Bacteria 2024
328 Ga0495630_0170023 3300046517 Bacteria 1660
329 Ga0495632_0026379 3300046519 Bacteria 3059
330 Ga0495666_0042469 3300046526 Bacteria 2198
331 Ga0495652_0059512 3300046529 Bacteria 3232
332 Ga0495665_0002697 3300046531 Bacteria 9570
333 Ga0495665_0071861 3300046531 Bacteria 1822
334 Ga0495640_0012307 3300046533 Bacteria 6543
335 Ga0495598_0003337 3300046537 Bacteria 3401
336 Ga0495622_0021748 3300046557 Bacteria 2986
337 Ga0495622_0064503 3300046557 Bacteria 1694
338 Ga0495667_0017236 3300046559 Bacteria 4879
339 Ga0495656_0003876 3300046615 Bacteria 5087
340 Ga0495656_0050497 3300046615 Bacteria 1776
341 Ga0495656_0062185 3300046615 Bacteria 1632
342 Ga0495634_0001398 3300046642 Bacteria 21701
343 Ga0495635_0002091 3300046663 Bacteria 13550
344 Ga0495588_0193495 3300046674 Bacteria 1074
345 Ga0495623_0027111 3300046679 Bacteria 3685
346 Ga0495646_0011013 3300046680 Bacteria 5744
347 Ga0495647_0042498 3300046681 Bacteria 1736
348 Ga0495658_0235977 3300046683 Bacteria 1148
349 Ga0495669_0012886 3300046684 Bacteria 3559
350 Ga0495624_0055082 3300046690 Bacteria 2506
351 Ga0495624_0154899 3300046690 Bacteria 1401
352 Ga0495649_0105362 3300046694 Bacteria 1497
353 Ga0495581_0008143 3300047315 Bacteria 6070
354 Ga0495581_0035072 3300047315 Bacteria 2903
355 Ga0495581_0059401 3300047315 Bacteria 2210
356 Ga0495674_0008835 3300047319 Bacteria 9584
357 Ga0495672_0022887 3300047320 Bacteria 4054
358 Ga0495676_0121681 3300047321 Bacteria 1897
359 Ga0495677_0015899 3300047445 Bacteria 2732
360 Ga0495684_0057343 3300047471 Bacteria 2968
361 Ga0495593_0011900 3300047673 Bacteria 4989
362 Ga0495602_0238788 3300048088 Bacteria 1361
363 Ga0495614_0139593 3300048089 Bacteria 1076
364 Ga0496101_0111737 3300048904 Bacteria 2057
365 Ga0496102_0001416 3300048905 Bacteria 21268
366 Ga0496102_0442611 3300048905 Bacteria 1219
367 Ga0496102_0608972 3300048905 Bacteria 1015
368 Ga0496103_0221075 3300048906 Bacteria 1218
369 Ga0496104_0012329 3300048907 Bacteria 7684
370 Ga0496104_0060885 3300048907 Bacteria 3577
371 Ga0496105_0051631 3300048908 Bacteria 3397
372 Ga0496105_0063092 3300048908 Bacteria 3057
373 Ga0496105_0088599 3300048908 Bacteria 2556
374 Ga0496106_0005613 3300048909 Bacteria 9285
375 Ga0496106_0015784 3300048909 Bacteria 5586
376 Ga0496107_0243809 3300048910 Bacteria 1337
377 Ga0496108_0020610 3300048911 Bacteria 5417
378 Ga0496108_0033925 3300048911 Bacteria 4239
379 Ga0496108_0062017 3300048911 Bacteria 3148
380 Ga0496109_0048826 3300048912 Bacteria 3850
381 Ga0496109_0173684 3300048912 Bacteria 2022
382 Ga0496109_0281224 3300048912 Bacteria 1568
383 Ga0496110_0007702 3300048913 Bacteria 8619
384 Ga0496110_0041921 3300048913 Bacteria 3995
385 Ga0496111_0046881 3300048914 Bacteria 3113
386 Ga0496111_0055238 3300048914 Bacteria 2872
387 Ga0496111_0148205 3300048914 Bacteria 1740
388 Ga0496112_0000244 3300048915 Bacteria 34762
389 Ga0496112_0036311 3300048915 Bacteria 4807
390 Ga0496112_0039535 3300048915 Bacteria 4610
391 Ga0496113_0010085 3300048916 Bacteria 6231
392 Ga0496113_0134816 3300048916 Bacteria 1939
393 Ga0496114_0070836 3300048917 Bacteria 2929
394 Ga0496114_0365022 3300048917 Bacteria 1277
395 Ga0496115_0018078 3300048918 Bacteria 5403
396 Ga0496115_0060617 3300048918 Bacteria 3049
397 Ga0496115_0135049 3300048918 Bacteria 2034
398 Ga0496117_0140539 3300048920 Bacteria 1447
399 Ga0496118_0110572 3300048921 Bacteria 1825
400 Ga0496119_0066656 3300048922 Bacteria 2126
401 Ga0496121_0000214 3300048924 Bacteria 127349
402 Ga0496121_0000559 3300048924 Bacteria 70325
403 Ga0496121_0003476 3300048924 Bacteria 22431
404 Ga0496121_0068818 3300048924 Bacteria 2861
405 Ga0496124_0092113 3300048927 Bacteria 2469
406 Ga0496124_0136444 3300048927 Bacteria 1942
407 Ga0496124_0152969 3300048927 Bacteria 1807
408 Ga0496125_0043095 3300048928 Bacteria 3836
409 Ga0496125_0075363 3300048928 Bacteria 2611
410 Ga0496125_0133654 3300048928 Bacteria 1740
411 Ga0496126_0004022 3300048929 Bacteria 17912
412 Ga0496126_0014474 3300048929 Bacteria 7973
413 Ga0496126_0086281 3300048929 Bacteria 2766
414 Ga0495682_0071388 3300049460 Bacteria 1250
415 Ga0501034_0209476 3300049571 Bacteria 1905
416 Ga0501042_0282437 3300049578 Bacteria 1199
417 Ga0501067_0029566 3300049583 Bacteria 3037
418 Ga0501076_0110337 3300049592 Bacteria 2224
419 nmdc:mga03683_3343_c1 3300050489 Bacteria 5155
420 nmdc:mga03n38_143517_c1 3300050490 Bacteria 1195
421 nmdc:mga03n38_269_c1 3300050490 Bacteria 12311
422 nmdc:mga00v17_13584_c1 3300050491 Bacteria 4524
423 nmdc:mga00v17_40041_c1 3300050491 Bacteria 2810
424 nmdc:mga00v17_77751_c1 3300050491 Unclassified 2067
425 nmdc:mga0yw44_25671_c1 3300050492 Bacteria 3355
426 nmdc:mga0yw44_259992_c1 3300050492 Bacteria 1157
427 nmdc:mga0yw44_33063_c1 3300050492 Bacteria 3019
428 nmdc:mga0yw44_5570_c1 3300050492 Bacteria 5975
429 nmdc:mga0k408_1020_c1 3300050493 Bacteria 15354
430 nmdc:mga06z11_13317_c1 3300050494 Bacteria 3608
431 nmdc:mga06z11_21420_c1 3300050494 Bacteria 3004
432 nmdc:mga06z11_30370_c1 3300050494 Bacteria 2614
433 nmdc:mga06z11_42089_c1 3300050494 Bacteria 2289
434 nmdc:mga06z11_6441_c1 3300050494 Bacteria 4777
435 nmdc:mga04h51_12652_c1 3300050495 Bacteria 2373
436 nmdc:mga04h51_18907_c1 3300050495 Bacteria 2036
437 nmdc:mga04h51_19347_c1 3300050495 Bacteria 2018
438 nmdc:mga07m45_8101_c1 3300050496 Bacteria 5387
439 nmdc:mga05p37_45529_c1 3300050507 Bacteria 5395
440 nmdc:mga05p37_60780_c1 3300050507 Bacteria 4652
441 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
442 nmdc:mga08y16_293568_c1 3300050511 Bacteria 1676
443 nmdc:mga0n895_13622_c1 3300050512 Bacteria 7348
444 nmdc:mga0rr50_7052_c1 3300050513 Bacteria 6898
445 nmdc:mga0sz30_1072_c1 3300050516 Bacteria 9854
446 nmdc:mga0sz30_1429_c1 3300050516 Bacteria 8530
447 Ga0500635_0001155 3300053080 Bacteria 6328
448 Ga0495655_0006764 3300053083 Bacteria 2101
449 Ga0495595_0005067 3300053084 Bacteria 5323
450 Ga0500651_0020446 3300053093 Bacteria 4120
451 Ga0500651_0050139 3300053093 Bacteria 2621
452 Ga0500566_0001423 3300053094 Bacteria 14009
453 Ga0500566_0001533 3300053094 Bacteria 13563
454 Ga0500641_0005284 3300053096 Bacteria 4574
455 Ga0500641_0009952 3300053096 Bacteria 3428
456 Ga0500641_0033902 3300053096 Bacteria 2029
457 Ga0500641_0048643 3300053096 Bacteria 1737
458 Ga0500554_001968 3300053102 Bacteria 3988
459 Ga0500595_000123 3300053119 Bacteria 51077
460 Ga0500595_002684 3300053119 Bacteria 8647
461 Ga0500595_008869 3300053119 Bacteria 4086
462 Ga0500595_016137 3300053119 Bacteria 2787
463 Ga0500595_019064 3300053119 Bacteria 2496
464 Ga0500595_021790 3300053119 Bacteria 2281
465 Ga0500607_078453 3300053121 Bacteria 1688
466 Ga0500608_006438 3300053122 Bacteria 4780
467 Ga0500652_000003 3300053131 Bacteria 221528
468 Ga0500652_000011 3300053131 Bacteria 160704
469 Ga0500568_0006268 3300053139 Bacteria 6002
470 Ga0500568_0024795 3300053139 Bacteria 2537
471 Ga0500568_0052526 3300053139 Bacteria 1600
472 Ga0500568_0079390 3300053139 Bacteria 1247
473 Ga0500586_012545 3300053145 Bacteria 2469
474 Ga0500603_000079 3300053150 Bacteria 22213
475 Ga0500603_004758 3300053150 Bacteria 2906
476 Ga0500638_017743 3300053162 Bacteria 3309
477 Ga0500636_0001654 3300053177 Bacteria 12187
478 Ga0500636_0104629 3300053177 Bacteria 1605
479 Ga0500637_0000980 3300053178 Bacteria 11644
480 Ga0500637_0017438 3300053178 Bacteria 3845
481 Ga0500645_020472 3300053730 Bacteria 2051
482 Ga0500609_003747 3300053731 Bacteria 2119
483 Ga0500661_001237 3300055283 Bacteria 4768
484 2513678711 2513237098 Bacteria 9902361
485 2513694506 2513237101 Bacteria 7952346
486 2524465446 2524023210 Bacteria 9029266
487 2587758491 2585428062 Bacteria 6842168
488 2793079062
489 2874607087 2874604998 Bacteria 7834745
490 2879117069 2879110137 Bacteria 8907982
491 2885390509 2885383462 Bacteria 9473874
492 2889034769 2889033259 Bacteria 9099371
493 2903776173 2903768456 Bacteria 9749579
494 2904695523 2904690495 Bacteria 9412302
495 2908764177 2908756301 Bacteria 8864324
496 2922364760 2922361189 Bacteria 7436256
497 2922391782 2922386360 Bacteria 7017218
498 8006965094 8006964411 Bacteria 8966052
499 8006993205 8006984368 Bacteria 9651211
500 8006995342 8006994254 Bacteria 8309700
501 8056679150 8056673599 Bacteria 7871253
502 8056681511 8056681323 Bacteria 8472857
503 8056694165 8056689827 Bacteria 6712655
504 Ga0495603_0005899
505 JGI25406J46586_10023425
506 JGI25153J46596_10000848
507 rootH2_10190596
508 JGI25404J52841_10000224
509 JGI25404J52841_10008656
510 JGI25404J52841_10022402
511 Ga0070658_10258973
512 Ga0070658_10342334
513 Ga0070658_10399759
514 Ga0070676_10001328
515 Ga0070683_100380429
516 Ga0070690_100205473
517 Ga0070677_10001696
518 Ga0068869_100034551
519 Ga0068869_100104866
520 Ga0068869_100114985
521 Ga0068869_100197163
522 Ga0070666_10059744
523 Ga0070682_100181181
524 Ga0068868_100105058
525 Ga0070660_100092168
526 Ga0070661_100148546
527 Ga0070668_100001020
528 Ga0070668_100287295
529 Ga0070675_100199376
530 Ga0070671_100108524
531 Ga0070671_100211282
532 Ga0070673_100001545
533 Ga0070688_100141245
534 Ga0070688_100154098
535 Ga0070667_100001177
536 Ga0070667_100360963
537 Ga0070709_10012977
538 Ga0070714_100029801
539 Ga0070713_100128641
540 Ga0070713_100176325
541 Ga0070710_10000566
542 Ga0070710_10016456
543 Ga0070701_10048554
544 Ga0070711_100051273
545 Ga0070711_100328415
546 Ga0070700_100237463
547 Ga0070663_100006160
548 Ga0070663_100047491
549 Ga0070663_100194995
550 Ga0070678_100001325
551 Ga0070678_100004899
552 Ga0070662_100029547
553 Ga0068867_100024014
554 Ga0068867_100119677
555 Ga0070698_100084473
556 Ga0070698_100102362
557 Ga0070698_100201790
558 Ga0070684_100134044
559 Ga0070697_100352163
560 Ga0068853_100006712
561 Ga0068853_100037105
562 Ga0070672_100028397
563 Ga0070672_100252621
564 Ga0070686_100052605
565 Ga0070665_100002603
566 Ga0070665_100005904
567 Ga0070665_100029096
568 Ga0070665_100035370
569 Ga0070665_100076724
570 Ga0070665_100087059
571 Ga0070665_100117060
572 Ga0070665_100126295
573 Ga0070665_100509378
574 Ga0068855_100245410
575 Ga0068856_100041165
576 Ga0070702_100025267
577 Ga0070702_100064557
578 Ga0070702_100127777
579 Ga0068859_100054600
580 Ga0068859_100391650
581 Ga0068864_100001880
582 Ga0068866_10047897
583 Ga0068866_10097686
584 Ga0068851_10000902
585 Ga0068863_100004156
586 Ga0068863_100261175
587 Ga0068860_100123513
588 Ga0068860_100225437
589 Ga0068862_100141010
590 Ga0081455_10002253
591 Ga0081455_10028225
592 Ga0081455_10036995
593 Ga0081455_10056366
594 Ga0081455_10129659
595 Ga0081540_1001425
596 Ga0081540_1004726
597 Ga0081540_1005173
598 Ga0081540_1006028
599 Ga0081540_1006241
600 Ga0081540_1006267
601 Ga0081540_1014663
602 Ga0081540_1021219
603 Ga0081540_1077134
604 Ga0081539_10000040
605 Ga0081539_10025601
606 Ga0070717_10045354
607 Ga0070717_10124716
608 Ga0075365_10004408
609 Ga0075365_10029168
610 Ga0075365_10034334
611 Ga0075365_10112662
612 Ga0075368_10016316
613 Ga0075363_100001722
614 Ga0075363_100011800
615 Ga0075364_10063250
616 Ga0070715_10006626
617 Ga0070716_100010683
618 Ga0075362_10006221
619 Ga0075367_10001823
620 Ga0075367_10006072
621 Ga0075367_10041655
622 Ga0075367_10258378
623 Ga0075369_10001202
624 Ga0075369_10002235
625 Ga0075369_10086113
626 Ga0075366_10000862
627 Ga0075366_10095915
628 Ga0097621_100343500
629 Ga0075370_10017848
630 Ga0075370_10029635
631 Ga0068871_100008125
632 Ga0068871_100260765
633 Ga0075428_100403914
634 Ga0075430_100000415
635 Ga0075433_10206947
636 Ga0075434_100037430
637 Ga0075434_100272490
638 Ga0097620_100054600
639 Ga0097620_100391721
640 Ga0075435_100012161
641 Ga0099794_10103384
642 Ga0099795_10004505
643 Ga0099795_10010133
644 Ga0105240_10417520
645 Ga0111539_10098733
646 Ga0105245_10104634
647 Ga0114129_10056391
648 Ga0114129_10126190
649 Ga0105243_10028125
650 Ga0105243_10347224
651 Ga0105243_10386252
652 Ga0105241_10089240
653 Ga0105248_10047297
654 Ga0105248_10180725
655 Ga0105237_10231819
656 Ga0105249_10090614
657 Ga0105249_10200179
658 Ga0105239_10113115
659 Ga0157374_10041743
660 Ga0157374_10195004
661 Ga0157374_10259844
662 Ga0157378_10293129
663 Ga0157378_10480761
664 Ga0163162_10092170
665 Ga0163162_10135999
666 Ga0163162_10250234
667 Ga0157372_10058304
668 Ga0157375_10030482
669 Ga0157375_10173978
670 Ga0157375_10281338
671 Ga0157375_11208471
672 Ga0163163_10012790
673 Ga0163163_10043007
674 Ga0163163_10050674
675 Ga0163163_10146483
676 Ga0163163_10161796
677 Ga0157379_10058491
678 Ga0157376_10105952
679 Ga0157376_10141262
680 Ga0157376_10384242
681 Ga0163161_10029435
682 Ga0163161_10115871
683 Ga0209564_1002206
684 Ga0209758_1001610
685 Ga0209758_1010893
686 Ga0209758_1018692
687 Ga0207697_10059746
688 Ga0207682_10000299
689 Ga0207692_10006279
690 Ga0207692_10054489
691 Ga0207642_10002988
692 Ga0207685_10008506
693 Ga0207699_10020798
694 Ga0207645_10001423
695 Ga0207643_10004064
696 Ga0207705_10226813
697 Ga0207654_10012862
698 Ga0207654_10091641
699 Ga0207671_10115789
700 Ga0207693_10000613
701 Ga0207693_10049853
702 Ga0207663_10000464
703 Ga0207663_10013082
704 Ga0207649_10154610
705 Ga0207649_10231343
706 Ga0207659_10001187
707 Ga0207659_10105968
708 Ga0207687_10017996
709 Ga0207687_10051950
710 Ga0207700_10054204
711 Ga0207700_10239601
712 Ga0207700_10256897
713 Ga0207664_10304223
714 Ga0207644_10036312
715 Ga0207644_10178786
716 Ga0207706_10010878
717 Ga0207706_10058318
718 Ga0207709_10045784
719 Ga0207670_10399382
720 Ga0207669_10015222
721 Ga0207669_10145727
722 Ga0207704_10122977
723 Ga0207704_10328468
724 Ga0207665_10000481
725 Ga0207691_10000016
726 Ga0207691_10060364
727 Ga0207691_10310058
728 Ga0207689_10064332
729 Ga0207689_10125387
730 Ga0207667_10190937
731 Ga0207651_10038049
732 Ga0207651_10083164
733 Ga0207712_10017211
734 Ga0207668_10026007
735 Ga0207668_10037542
736 Ga0207668_10114955
737 Ga0207668_10299152
738 Ga0207640_10238507
739 Ga0207640_10301258
740 Ga0207677_10005945
741 Ga0207677_10050354
742 Ga0207639_10020545
743 Ga0207639_10037896
744 Ga0207678_10000808
745 Ga0207678_10012849
746 Ga0207678_10083034
747 Ga0207678_10106245
748 Ga0207678_10249815
749 Ga0207678_10268815
750 Ga0207641_10241841
751 Ga0207676_10204906
752 Ga0207674_10071603
753 Ga0207675_100059521
754 Ga0207683_10000057
755 Ga0207683_10192307
756 Ga0209179_1005031
757 Ga0268266_10000936
758 Ga0268266_10002702
759 Ga0268266_10003236
760 Ga0268266_10003576
761 Ga0268266_10031929
762 Ga0268266_10056313
763 Ga0268266_10232184
764 Ga0268265_10057596
765 Ga0268264_10126090
766 Ga0268264_10305194
767 Ga0307517_10001037
768 Ga0307515_10068899
769 Ga0265339_10007541
770 Ga0265331_10106780
771 Ga0307513_10045919
772 Ga0307508_10042505
773 Ga0307508_10083930
774 Ga0265314_10036699
775 Ga0265314_10065904
776 Ga0265314_10071781
777 Ga0307516_10097182
778 Ga0307405_10184956
779 Ga0307413_10024331
780 Ga0307410_10003450
781 Ga0307409_100337612
782 Ga0307416_100496004
783 Ga0307416_100671439
784 Ga0307510_10008288
785 Ga0307510_10023239
786 Ga0307510_10259239
787 Ga0373923_0030466
788 Ga0373939_0031598
789 Ga0373953_0031824
790 Ga0373946_0021546
791 Ga0373961_0057518
792 Ga0373931_0073464
793 Ga0373935_0002731
794 Ga0373927_0008451
795 Ga0373927_0025393
796 Ga0373927_0045319
797 Ga0373927_0054029
798 Ga0373933_0037585
799 Ga0373947_0012057
800 Ga0373947_0015148
801 Ga0373947_0123295
802 Ga0373925_0030036
803 Ga0373925_0425434
804 Ga0395898_0083897
805 Ga0395898_0234182
806 Ga0395905_0085268
807 Ga0395901_0176941
808 Ga0395901_0376522
809 Ga0450911_000517
810 Ga0450897_004219
811 Ga0450898_012168
812 Ga0466959_0204389
813 Ga0451576_0643751
814 Ga0495617_064855
815 Ga0495603_0017827
816 Ga0495603_0019452
817 Ga0495629_0000835
818 Ga0495638_0041834
819 Ga0495641_0006814
820 Ga0495651_0035101
821 Ga0495580_0138642
822 Ga0495639_0034884
823 Ga0495639_0058309
824 Ga0495662_0011413
825 Ga0495664_0004268
826 Ga0495594_0001566
827 Ga0495594_0155913
828 Ga0495606_0010481
829 Ga0495628_0029261
830 Ga0495630_0116626
831 Ga0495630_0170023
832 Ga0495632_0026379
833 Ga0495666_0042469
834 Ga0495652_0059512
835 Ga0495665_0002697
836 Ga0495665_0071861
837 Ga0495640_0012307
838 Ga0495598_0003337
839 Ga0495622_0021748
840 Ga0495622_0064503
841 Ga0495667_0017236
842 Ga0495656_0003876
843 Ga0495656_0050497
844 Ga0495656_0062185
845 Ga0495634_0001398
846 Ga0495635_0002091
847 Ga0495588_0193495
848 Ga0495623_0027111
849 Ga0495646_0011013
850 Ga0495647_0042498
851 Ga0495658_0235977
852 Ga0495669_0012886
853 Ga0495624_0055082
854 Ga0495624_0154899
855 Ga0495649_0105362
856 Ga0495581_0008143
857 Ga0495581_0035072
858 Ga0495581_0059401
859 Ga0495674_0008835
860 Ga0495672_0022887
861 Ga0495676_0121681
862 Ga0495677_0015899
863 Ga0495684_0057343
864 Ga0495593_0011900
865 Ga0495602_0238788
866 Ga0495614_0139593
867 Ga0496101_0111737
868 Ga0496102_0001416
869 Ga0496102_0442611
870 Ga0496102_0608972
871 Ga0496103_0221075
872 Ga0496104_0012329
873 Ga0496104_0060885
874 Ga0496105_0051631
875 Ga0496105_0063092
876 Ga0496105_0088599
877 Ga0496106_0005613
878 Ga0496106_0015784
879 Ga0496107_0243809
880 Ga0496108_0020610
881 Ga0496108_0033925
882 Ga0496108_0062017
883 Ga0496109_0048826
884 Ga0496109_0173684
885 Ga0496109_0281224
886 Ga0496110_0007702
887 Ga0496110_0041921
888 Ga0496111_0046881
889 Ga0496111_0055238
890 Ga0496111_0148205
891 Ga0496112_0000244
892 Ga0496112_0036311
893 Ga0496112_0039535
894 Ga0496113_0010085
895 Ga0496113_0134816
896 Ga0496114_0070836
897 Ga0496114_0365022
898 Ga0496115_0018078
899 Ga0496115_0060617
900 Ga0496115_0135049
901 Ga0496117_0140539
902 Ga0496118_0110572
903 Ga0496119_0066656
904 Ga0496121_0000214
905 Ga0496121_0000559
906 Ga0496121_0003476
907 Ga0496121_0068818
908 Ga0496124_0092113
909 Ga0496124_0136444
910 Ga0496124_0152969
911 Ga0496125_0043095
912 Ga0496125_0075363
913 Ga0496125_0133654
914 Ga0496126_0004022
915 Ga0496126_0014474
916 Ga0496126_0086281
917 Ga0495682_0071388
918 Ga0501034_0209476
919 Ga0501042_0282437
920 Ga0501067_0029566
921 Ga0501076_0110337
922 nmdc:mga03683_3343_c1
923 nmdc:mga03n38_143517_c1
924 nmdc:mga03n38_269_c1
925 nmdc:mga00v17_13584_c1
926 nmdc:mga00v17_40041_c1
927 nmdc:mga00v17_77751_c1
928 nmdc:mga0yw44_25671_c1
929 nmdc:mga0yw44_259992_c1
930 nmdc:mga0yw44_33063_c1
931 nmdc:mga0yw44_5570_c1
932 nmdc:mga0k408_1020_c1
933 nmdc:mga06z11_13317_c1
934 nmdc:mga06z11_21420_c1
935 nmdc:mga06z11_30370_c1
936 nmdc:mga06z11_42089_c1
937 nmdc:mga06z11_6441_c1
938 nmdc:mga04h51_12652_c1
939 nmdc:mga04h51_18907_c1
940 nmdc:mga04h51_19347_c1
941 nmdc:mga07m45_8101_c1
942 nmdc:mga05p37_45529_c1
943 nmdc:mga05p37_60780_c1
944 nmdc:mga0qj67_19_c1
945 nmdc:mga08y16_293568_c1
946 nmdc:mga0n895_13622_c1
947 nmdc:mga0rr50_7052_c1
948 nmdc:mga0sz30_1072_c1
949 nmdc:mga0sz30_1429_c1
950 Ga0500635_0001155
951 Ga0495655_0006764
952 Ga0495595_0005067
953 Ga0500651_0020446
954 Ga0500651_0050139
955 Ga0500566_0001423
956 Ga0500566_0001533
957 Ga0500641_0005284
958 Ga0500641_0009952
959 Ga0500641_0033902
960 Ga0500641_0048643
961 Ga0500554_001968
962 Ga0500595_000123
963 Ga0500595_002684
964 Ga0500595_008869
965 Ga0500595_016137
966 Ga0500595_019064
967 Ga0500595_021790
968 Ga0500607_078453
969 Ga0500608_006438
970 Ga0500652_000003
971 Ga0500652_000011
972 Ga0500568_0006268
973 Ga0500568_0024795
974 Ga0500568_0052526
975 Ga0500568_0079390
976 Ga0500586_012545
977 Ga0500603_000079
978 Ga0500603_004758
979 Ga0500638_017743
980 Ga0500636_0001654
981 Ga0500636_0104629
982 Ga0500637_0000980
983 Ga0500637_0017438
984 Ga0500645_020472
985 Ga0500609_003747
986 Ga0500661_001237
987 2513678711
988 2513694506
989 2524465446
990 2587758491
991 2793079062
992 2874607087
993 2879117069
994 2885390509
995 2889034769
996 2903776173
997 2904695523
998 2908764177
999 2922364760
1000 2922391782
1001 8006965094
1002 8006993205
1003 8006995342
1004 8056679150
1005 8056681511
1006 8056694165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

100

374

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.97 29 321
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9691 26 321
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9676 26 323
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9593 26 321
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9583 26 315
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9632 125 247 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9628 125 243 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9516 126 244 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9482 125 247 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.947 125 247 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W0X4R0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9904 26 321
AF-A0A849MZ44-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9865 27 323
AF-A0A5N7RZ89-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9831 25 321
AF-A0A5C8A5A1-F1-model_v4 deleted 0.9831 25 285
AF-A0A1Q4BG09-F1-model_v4 ABC transporter substrate-binding protein 0.9812 20 321

Map