F456066

General Info

Members Datasets Scaffolds Average Seq Length
503 282 1006 153

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0343164|Ga0466958_0343164_274_744
Length 148
Sequence MYLVTESRPPFPPFTLETAIQKVQAAEDAWNTRDPHRVSLAYTPDSIVGRDEIVAFLTRKWERELDYSLRKSLWDFHDNRIAVRFQYECHDHAGQWYRSYGNELWEFTASGLMARREASINDVPIDESQRRYFGPRPASEHGQEIPLW

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
174 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
277 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
278 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
279 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
280 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
281 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
282 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 2.39
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 10.74
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0343164 3300045836 Bacteria 961
2 JGI24735J21928_10060422 3300002067 Bacteria 1089
3 JGI25406J46586_10013996 3300003203 Bacteria 3423
4 JGI25406J46586_10075452 3300003203 Bacteria 1046
5 JGI25407J50210_10003933 3300003373 Bacteria 3602
6 JGI25407J50210_10075645 3300003373 Bacteria 838
7 Ga0070676_10409840 3300005328 Bacteria 945
8 Ga0070683_100643053 3300005329 Bacteria 1015
9 Ga0070683_100754043 3300005329 Bacteria 933
10 Ga0070683_100796937 3300005329 Bacteria 906
11 Ga0070670_100017272 3300005331 Bacteria 6189
12 Ga0070670_100027537 3300005331 Bacteria 4888
13 Ga0068869_101169237 3300005334 Bacteria 675
14 Ga0070666_10005634 3300005335 Bacteria 7684
15 Ga0068868_100075036 3300005338 Bacteria 2702
16 Ga0068868_100106450 3300005338 Bacteria 2275
17 Ga0068868_100987619 3300005338 Bacteria 769
18 Ga0070660_100628100 3300005339 Bacteria 899
19 Ga0070689_100449213 3300005340 Bacteria 1097
20 Ga0070687_100075756 3300005343 Bacteria 1820
21 Ga0070687_100106835 3300005343 Bacteria 1577
22 Ga0070661_100014196 3300005344 Bacteria 5611
23 Ga0070692_10128303 3300005345 Bacteria 1423
24 Ga0070692_10160402 3300005345 Bacteria 1288
25 Ga0070669_100512041 3300005353 Bacteria 997
26 Ga0070675_100088111 3300005354 Bacteria 2596
27 Ga0070671_100050830 3300005355 Bacteria 3448
28 Ga0070671_100110749 3300005355 Bacteria 2306
29 Ga0070674_100012586 3300005356 Bacteria 5199
30 Ga0070674_100052985 3300005356 Bacteria 2800
31 Ga0070673_100082022 3300005364 Bacteria 2616
32 Ga0070673_100090543 3300005364 Bacteria 2499
33 Ga0070688_100011277 3300005365 Bacteria 4963
34 Ga0070688_100247273 3300005365 Bacteria 1268
35 Ga0070659_100564636 3300005366 Bacteria 975
36 Ga0070667_100001912 3300005367 Bacteria 18482
37 Ga0070667_100323859 3300005367 Bacteria 1391
38 Ga0070714_100265558 3300005435 Bacteria 1590
39 Ga0070714_100869312 3300005435 Bacteria 875
40 Ga0070713_100303214 3300005436 Bacteria 1471
41 Ga0070711_100169452 3300005439 Bacteria 1663
42 Ga0070705_100113788 3300005440 Bacteria 1734
43 Ga0070705_100209692 3300005440 Bacteria 1342
44 Ga0070705_100439552 3300005440 Bacteria 976
45 Ga0070694_100761506 3300005444 Bacteria 791
46 Ga0070663_100084514 3300005455 Bacteria 2339
47 Ga0070663_100408660 3300005455 Bacteria 1111
48 Ga0070663_100757666 3300005455 Bacteria 829
49 Ga0070663_100929502 3300005455 Bacteria 753
50 Ga0070678_100001193 3300005456 Bacteria 13832
51 Ga0070662_100081712 3300005457 Bacteria 2408
52 Ga0070662_100684776 3300005457 Bacteria 866
53 Ga0070681_10006088 3300005458 Bacteria 11702
54 Ga0070681_10117170 3300005458 Bacteria 2600
55 Ga0070681_11160512 3300005458 Bacteria 694
56 Ga0068867_100257234 3300005459 Bacteria 1422
57 Ga0070679_100103614 3300005530 Bacteria 2831
58 Ga0070679_100921242 3300005530 Bacteria 817
59 Ga0070679_101010149 3300005530 Bacteria 776
60 Ga0070684_100030889 3300005535 Bacteria 4555
61 Ga0070684_100041030 3300005535 Bacteria 3987
62 Ga0070684_100078252 3300005535 Bacteria 2921
63 Ga0070672_100090718 3300005543 Bacteria 2465
64 Ga0070672_100894554 3300005543 Bacteria 784
65 Ga0070686_100041679 3300005544 Bacteria 2871
66 Ga0070686_100562992 3300005544 Bacteria 893
67 Ga0070686_100578561 3300005544 Bacteria 882
68 Ga0070696_100100405 3300005546 Bacteria 2073
69 Ga0070693_100203978 3300005547 Bacteria 1286
70 Ga0070665_100346927 3300005548 Bacteria 1490
71 Ga0070665_100718805 3300005548 Bacteria 1012
72 Ga0070704_100142608 3300005549 Bacteria 1873
73 Ga0068855_101400209 3300005563 Bacteria 721
74 Ga0070664_100012724 3300005564 Bacteria 6849
75 Ga0070664_100116124 3300005564 Bacteria 2340
76 Ga0070664_100205603 3300005564 Bacteria 1758
77 Ga0070664_100455700 3300005564 Bacteria 1175
78 Ga0068857_100170754 3300005577 Bacteria 1977
79 Ga0068854_100117629 3300005578 Bacteria 2013
80 Ga0068856_100232693 3300005614 Bacteria 1858
81 Ga0068856_100416886 3300005614 Bacteria 1363
82 Ga0068856_101528927 3300005614 Bacteria 681
83 Ga0068856_102484108 3300005614 Bacteria 525
84 Ga0070702_100126169 3300005615 Bacteria 1610
85 Ga0068852_100051079 3300005616 Bacteria 3546
86 Ga0068852_100396364 3300005616 Bacteria 1357
87 Ga0068859_100053479 3300005617 Bacteria 4062
88 Ga0068859_100239554 3300005617 Bacteria 1903
89 Ga0068864_100001701 3300005618 Bacteria 18082
90 Ga0068864_100153845 3300005618 Bacteria 2086
91 Ga0068864_100296560 3300005618 Bacteria 1512
92 Ga0068864_100500393 3300005618 Bacteria 1169
93 Ga0068866_10056889 3300005718 Bacteria 2013
94 Ga0068861_100183864 3300005719 Bacteria 1742
95 Ga0068861_101107642 3300005719 Bacteria 761
96 Ga0068870_10054355 3300005840 Bacteria 2129
97 Ga0068863_100010707 3300005841 Bacteria 8908
98 Ga0068863_100232610 3300005841 Bacteria 1778
99 Ga0068863_101012385 3300005841 Bacteria 834
100 Ga0068858_100050833 3300005842 Bacteria 3836
101 Ga0068860_100026220 3300005843 Bacteria 5620
102 Ga0068860_100029375 3300005843 Bacteria 5287
103 Ga0081455_10013145 3300005937 Bacteria 8205
104 Ga0081455_10014262 3300005937 Bacteria 7799
105 Ga0081455_10126331 3300005937 Bacteria 2007
106 Ga0081455_10152253 3300005937 Bacteria 1782
107 Ga0081538_10000253 3300005981 Bacteria 60616
108 Ga0081538_10005432 3300005981 Bacteria 11444
109 Ga0081538_10019824 3300005981 Bacteria 4976
110 Ga0081538_10046076 3300005981 Bacteria 2694
111 Ga0081538_10075302 3300005981 Bacteria 1832
112 Ga0081540_1001577 3300005983 Bacteria 19486
113 Ga0081540_1178888 3300005983 Bacteria 797
114 Ga0081539_10004365 3300005985 Bacteria 15758
115 Ga0081539_10007251 3300005985 Bacteria 10188
116 Ga0081539_10020419 3300005985 Bacteria 4478
117 Ga0070717_10019514 3300006028 Bacteria 5318
118 Ga0075364_10668707 3300006051 Bacteria 709
119 Ga0070715_10005293 3300006163 Bacteria 4292
120 Ga0070716_100618923 3300006173 Bacteria 817
121 Ga0070712_100460974 3300006175 Bacteria 1060
122 Ga0097621_100006534 3300006237 Bacteria 8284
123 Ga0068871_100023180 3300006358 Bacteria 4796
124 Ga0075428_100429294 3300006844 Bacteria 1416
125 Ga0075431_100097904 3300006847 Bacteria 3029
126 Ga0075431_101448837 3300006847 Bacteria 646
127 Ga0068865_100020708 3300006881 Bacteria 4269
128 Ga0068865_100203378 3300006881 Bacteria 1539
129 Ga0068865_100668148 3300006881 Bacteria 885
130 Ga0097620_100053479 3300006931 Bacteria 4062
131 Ga0097620_100239531 3300006931 Bacteria 1903
132 Ga0105244_10171737 3300009036 Bacteria 1031
133 Ga0105240_10603481 3300009093 Bacteria 1208
134 Ga0105240_12251530 3300009093 Bacteria 565
135 Ga0111539_10515146 3300009094 Bacteria 1393
136 Ga0105245_10018866 3300009098 Bacteria 6036
137 Ga0105245_10181298 3300009098 Bacteria 2012
138 Ga0105247_10004302 3300009101 Bacteria 9105
139 Ga0105247_10046076 3300009101 Bacteria 2676
140 Ga0114129_12006662 3300009147 Bacteria 699
141 Ga0105243_10012448 3300009148 Bacteria 6430
142 Ga0105243_10590559 3300009148 Bacteria 1068
143 Ga0105241_10004216 3300009174 Bacteria 10619
144 Ga0105242_10004820 3300009176 Bacteria 10442
145 Ga0105242_10078894 3300009176 Bacteria 2749
146 Ga0105242_10103825 3300009176 Bacteria 2412
147 Ga0105242_10257416 3300009176 Bacteria 1575
148 Ga0105242_11384292 3300009176 Bacteria 730
149 Ga0105248_10012340 3300009177 Bacteria 9428
150 Ga0105248_10028394 3300009177 Bacteria 6233
151 Ga0105238_10031974 3300009551 Bacteria 5355
152 Ga0105238_11126148 3300009551 Bacteria 808
153 Ga0105249_10187823 3300009553 Bacteria 2015
154 Ga0105249_10337727 3300009553 Bacteria 1522
155 Ga0105249_10565293 3300009553 Bacteria 1189
156 Ga0105249_10689311 3300009553 Bacteria 1081
157 Ga0105249_11914329 3300009553 Bacteria 666
158 Ga0105239_10079114 3300010375 Bacteria 3618
159 Ga0105239_10508924 3300010375 Bacteria 1369
160 Ga0105239_10511889 3300010375 Bacteria 1365
161 Ga0105239_11599600 3300010375 Bacteria 754
162 Ga0105246_10013153 3300011119 Bacteria 5181
163 Ga0105246_10023210 3300011119 Bacteria 4011
164 Ga0105246_10096299 3300011119 Bacteria 2145
165 Ga0105246_12409867 3300011119 Bacteria 516
166 Ga0157373_11055906 3300013100 Bacteria 608
167 Ga0157370_10051315 3300013104 Bacteria 3940
168 Ga0157369_10169271 3300013105 Bacteria 2303
169 Ga0157369_10388257 3300013105 Bacteria 1449
170 Ga0157374_10013584 3300013296 Bacteria 7112
171 Ga0157374_10564199 3300013296 Bacteria 1147
172 Ga0157378_10075434 3300013297 Bacteria 3036
173 Ga0157372_10660016 3300013307 Bacteria 1218
174 Ga0157372_11829652 3300013307 Bacteria 698
175 Ga0157375_10002031 3300013308 Bacteria 17460
176 Ga0157375_10005942 3300013308 Bacteria 10638
177 Ga0157375_10029495 3300013308 Bacteria 5160
178 Ga0163163_10005290 3300014325 Bacteria 11139
179 Ga0163163_10786167 3300014325 Bacteria 1015
180 Ga0157380_10063267 3300014326 Bacteria 2966
181 Ga0157380_11234946 3300014326 Bacteria 792
182 Ga0157380_12230710 3300014326 Bacteria 612
183 Ga0157377_10041060 3300014745 Bacteria 2565
184 Ga0157377_10112858 3300014745 Bacteria 1636
185 Ga0157379_10007397 3300014968 Bacteria 9504
186 Ga0157379_10007918 3300014968 Bacteria 9212
187 Ga0157379_10171271 3300014968 Bacteria 1960
188 Ga0157379_11523206 3300014968 Bacteria 651
189 Ga0157376_10003319 3300014969 Bacteria 11073
190 Ga0157376_10007961 3300014969 Bacteria 7604
191 Ga0163161_10109809 3300017792 Bacteria 2061
192 Ga0163161_10940268 3300017792 Bacteria 735
193 Ga0206356_11072694 3300020070 Bacteria 1394
194 Ga0206349_1853985 3300020075 Bacteria 809
195 Ga0206355_1375103 3300020076 Bacteria 514
196 Ga0206352_10852943 3300020078 Bacteria 667
197 Ga0206350_10006660 3300020080 Bacteria 1347
198 Ga0206350_10164371 3300020080 Bacteria 781
199 Ga0206350_10223693 3300020080 Bacteria 1659
200 Ga0206354_11457318 3300020081 Bacteria 1398
201 Ga0206353_10551325 3300020082 Bacteria 1503
202 Ga0154015_1282419 3300020610 Bacteria 679
203 Ga0207655_1112479 3300025728 Bacteria 917
204 Ga0207710_10156964 3300025900 Bacteria 1106
205 Ga0207688_10024099 3300025901 Bacteria 3336
206 Ga0207647_10026552 3300025904 Bacteria 3787
207 Ga0207645_10079207 3300025907 Bacteria 2106
208 Ga0207643_10034355 3300025908 Bacteria 2841
209 Ga0207643_10213651 3300025908 Bacteria 1178
210 Ga0207654_10109709 3300025911 Bacteria 1715
211 Ga0207707_10007049 3300025912 Bacteria 9801
212 Ga0207707_10271587 3300025912 Bacteria 1469
213 Ga0207695_10594338 3300025913 Bacteria 988
214 Ga0207693_10016401 3300025915 Bacteria 5922
215 Ga0207663_10492952 3300025916 Bacteria 951
216 Ga0207660_10337812 3300025917 Bacteria 1205
217 Ga0207660_10633646 3300025917 Bacteria 871
218 Ga0207662_10084129 3300025918 Bacteria 1946
219 Ga0207657_11181271 3300025919 Bacteria 582
220 Ga0207649_10050954 3300025920 Bacteria 2562
221 Ga0207649_10534709 3300025920 Bacteria 895
222 Ga0207652_10070964 3300025921 Bacteria 3025
223 Ga0207652_10570197 3300025921 Bacteria 1016
224 Ga0207652_10988727 3300025921 Bacteria 740
225 Ga0207681_10530315 3300025923 Bacteria 967
226 Ga0207694_11180433 3300025924 Bacteria 648
227 Ga0207694_11331173 3300025924 Bacteria 607
228 Ga0207650_10046731 3300025925 Bacteria 3188
229 Ga0207650_10263918 3300025925 Bacteria 1397
230 Ga0207659_10093818 3300025926 Bacteria 2247
231 Ga0207687_10597329 3300025927 Bacteria 930
232 Ga0207700_11037764 3300025928 Bacteria 733
233 Ga0207664_10564188 3300025929 Bacteria 1022
234 Ga0207644_10045118 3300025931 Bacteria 3134
235 Ga0207644_10439947 3300025931 Bacteria 1070
236 Ga0207644_10444755 3300025931 Bacteria 1064
237 Ga0207690_10393537 3300025932 Bacteria 1104
238 Ga0207690_10955929 3300025932 Bacteria 712
239 Ga0207686_10120906 3300025934 Bacteria 1782
240 Ga0207686_10419261 3300025934 Bacteria 1023
241 Ga0207686_10611797 3300025934 Bacteria 858
242 Ga0207709_10139771 3300025935 Bacteria 1663
243 Ga0207670_10437542 3300025936 Bacteria 1052
244 Ga0207670_10704160 3300025936 Bacteria 836
245 Ga0207669_10060701 3300025937 Bacteria 2319
246 Ga0207669_10068382 3300025937 Bacteria 2218
247 Ga0207704_10106664 3300025938 Bacteria 1882
248 Ga0207704_10290599 3300025938 Bacteria 1247
249 Ga0207704_10437965 3300025938 Bacteria 1040
250 Ga0207665_10316414 3300025939 Bacteria 1170
251 Ga0207691_10024581 3300025940 Bacteria 5666
252 Ga0207691_10056238 3300025940 Bacteria 3584
253 Ga0207711_10000578 3300025941 Bacteria 37304
254 Ga0207711_10078100 3300025941 Bacteria 2886
255 Ga0207661_10016110 3300025944 Bacteria 5510
256 Ga0207661_10332671 3300025944 Bacteria 1367
257 Ga0207661_10640812 3300025944 Bacteria 976
258 Ga0207661_11194081 3300025944 Bacteria 700
259 Ga0207661_11209581 3300025944 Bacteria 695
260 Ga0207679_10062128 3300025945 Bacteria 2782
261 Ga0207679_10248987 3300025945 Bacteria 1509
262 Ga0207679_10278909 3300025945 Bacteria 1432
263 Ga0207667_10457866 3300025949 Bacteria 1296
264 Ga0207651_10272617 3300025960 Bacteria 1394
265 Ga0207651_10983965 3300025960 Bacteria 753
266 Ga0207668_10071337 3300025972 Bacteria 2481
267 Ga0207640_10426836 3300025981 Bacteria 1086
268 Ga0207640_10662675 3300025981 Bacteria 890
269 Ga0207658_10025269 3300025986 Bacteria 4159
270 Ga0207677_10027609 3300026023 Bacteria 3578
271 Ga0207677_10168952 3300026023 Bacteria 1708
272 Ga0207677_10295409 3300026023 Bacteria 1336
273 Ga0207677_10642989 3300026023 Bacteria 935
274 Ga0207703_10610660 3300026035 Bacteria 1032
275 Ga0207703_11450826 3300026035 Bacteria 660
276 Ga0207678_10014699 3300026067 Bacteria 6887
277 Ga0207678_10136155 3300026067 Bacteria 2095
278 Ga0207678_10190122 3300026067 Bacteria 1754
279 Ga0207678_10764722 3300026067 Bacteria 852
280 Ga0207678_10931948 3300026067 Bacteria 768
281 Ga0207678_11082783 3300026067 Bacteria 710
282 Ga0207708_10446933 3300026075 Bacteria 1076
283 Ga0207708_10545807 3300026075 Bacteria 977
284 Ga0207708_11622978 3300026075 Bacteria 568
285 Ga0207702_10033350 3300026078 Bacteria 4301
286 Ga0207702_10522646 3300026078 Bacteria 1159
287 Ga0207641_10196779 3300026088 Bacteria 1856
288 Ga0207641_10396910 3300026088 Bacteria 1323
289 Ga0207648_10239432 3300026089 Bacteria 1615
290 Ga0207648_10316946 3300026089 Bacteria 1401
291 Ga0207648_12057398 3300026089 Bacteria 532
292 Ga0207676_10045044 3300026095 Bacteria 3406
293 Ga0207676_10675232 3300026095 Bacteria 999
294 Ga0207674_10101145 3300026116 Bacteria 2863
295 Ga0207674_10894571 3300026116 Bacteria 856
296 Ga0207675_100197448 3300026118 Bacteria 1931
297 Ga0207683_10000039 3300026121 Bacteria 99697
298 Ga0207698_10403445 3300026142 Bacteria 1307
299 Ga0207698_11166365 3300026142 Bacteria 784
300 Ga0207428_10575617 3300027907 Bacteria 813
301 Ga0268266_10093877 3300028379 Bacteria 2633
302 Ga0268264_10007411 3300028381 Bacteria 9159
303 Ga0268264_10119243 3300028381 Bacteria 2323
304 Ga0268264_12262333 3300028381 Bacteria 551
305 Ga0265334_10111139 3300028573 Bacteria 985
306 Ga0307511_10104286 3300030521 Bacteria 1842
307 Ga0307512_10013289 3300030522 Bacteria 7722
308 Ga0307512_10333752 3300030522 Bacteria 680
309 Ga0307413_10062486 3300031824 Bacteria 2304
310 Ga0307413_10632368 3300031824 Bacteria 880
311 Ga0307518_10004346 3300031838 Bacteria 10167
312 Ga0307410_10083910 3300031852 Bacteria 2245
313 Ga0307410_10297111 3300031852 Bacteria 1273
314 Ga0307406_10108157 3300031901 Bacteria 1908
315 Ga0307406_10176073 3300031901 Bacteria 1553
316 Ga0307406_10298221 3300031901 Bacteria 1237
317 Ga0307406_10568361 3300031901 Bacteria 930
318 Ga0307406_11583805 3300031901 Bacteria 578
319 Ga0307409_100070069 3300031995 Bacteria 2782
320 Ga0307409_100271988 3300031995 Bacteria 1561
321 Ga0307409_101395918 3300031995 Bacteria 727
322 Ga0307416_100093880 3300032002 Bacteria 2586
323 Ga0307416_100312393 3300032002 Bacteria 1569
324 Ga0307416_100407130 3300032002 Bacteria 1400
325 Ga0307414_11464465 3300032004 Bacteria 635
326 Ga0307415_100105023 3300032126 Bacteria 2082
327 Ga0307415_100421962 3300032126 Bacteria 1145
328 Ga0307415_101163828 3300032126 Bacteria 725
329 Ga0316214_1001932 3300033545 Bacteria 2503
330 Ga0316212_1009126 3300033547 Bacteria 1424
331 Ga0373934_0000043 3300035086 Bacteria 41885
332 Ga0373944_0205351 3300035089 Bacteria 715
333 Ga0373949_0217987 3300035090 Bacteria 579
334 Ga0373952_0129248 3300035092 Bacteria 692
335 Ga0373953_0000011 3300035117 Bacteria 45398
336 Ga0373954_0008879 3300035118 Bacteria 4422
337 Ga0373956_0001215 3300035119 Bacteria 10668
338 Ga0373957_0000354 3300035120 Bacteria 11692
339 Ga0373955_0000089 3300035172 Bacteria 36959
340 Ga0373924_0000028 3300035410 Bacteria 37098
341 Ga0373933_0000011 3300035724 Bacteria 110003
342 Ga0373937_0000021 3300036401 Bacteria 128447
343 Ga0372808_001326 3300036459 Bacteria 2518
344 Ga0372808_001388 3300036459 Bacteria 2494
345 Ga0373925_0000043 3300037068 Bacteria 134268
346 Ga0395899_0276784 3300037312 Bacteria 1143
347 Ga0395898_0232805 3300037466 Bacteria 1757
348 Ga0395901_0998483 3300038443 Bacteria 813
349 Ga0439439_0020109 3300041406 Bacteria 1659
350 Ga0439447_116540 3300041407 Bacteria 613
351 Ga0451795_0296746 3300041456 Bacteria 846
352 Ga0439452_027725 3300042010 Bacteria 1420
353 Ga0439462_0018118 3300042015 Bacteria 1828
354 Ga0451577_0979784 3300042876 Bacteria 760
355 Ga0466965_0133432 3300044683 Bacteria 1289
356 Ga0466965_0201087 3300044683 Bacteria 1057
357 Ga0466965_0519095 3300044683 Bacteria 670
358 Ga0466965_0721264 3300044683 Bacteria 573
359 Ga0466966_0356613 3300044684 Bacteria 879
360 Ga0466961_0161673 3300044693 Bacteria 1396
361 Ga0466961_0784540 3300044693 Bacteria 569
362 Ga0466963_0018187 3300044694 Bacteria 4389
363 Ga0466963_0116400 3300044694 Bacteria 1837
364 Ga0466963_0377387 3300044694 Bacteria 999
365 Ga0466964_0560557 3300044706 Bacteria 621
366 Ga0466971_0339769 3300044719 Bacteria 725
367 Ga0466970_0302367 3300044765 Bacteria 902
368 Ga0466957_0173568 3300044842 Bacteria 1405
369 Ga0466957_0756149 3300044842 Bacteria 688
370 Ga0466957_1000468 3300044842 Bacteria 600
371 Ga0466957_1002243 3300044842 Bacteria 600
372 Ga0466960_0062178 3300044901 Bacteria 1834
373 Ga0466960_0105559 3300044901 Bacteria 1456
374 Ga0451576_0078705 3300045051 Bacteria 3430
375 Ga0466958_0015375 3300045836 Bacteria 4386
376 Ga0466967_0012870 3300045976 Bacteria 6430
377 Ga0466967_0091269 3300045976 Bacteria 2768
378 Ga0466967_0244082 3300045976 Bacteria 1714
379 Ga0466967_0269816 3300045976 Bacteria 1630
380 Ga0466967_0431261 3300045976 Bacteria 1286
381 Ga0466967_0910082 3300045976 Bacteria 875
382 Ga0466967_0913917 3300045976 Bacteria 873
383 Ga0466967_0978309 3300045976 Bacteria 842
384 Ga0466967_1438764 3300045976 Bacteria 686
385 Ga0495592_0000013 3300046454 Bacteria 151780
386 Ga0495603_0065007 3300046455 Bacteria 2150
387 Ga0495629_0056335 3300046459 Bacteria 2749
388 Ga0495629_0108536 3300046459 Bacteria 1936
389 Ga0495641_0113636 3300046461 Bacteria 1208
390 Ga0495651_0000022 3300046462 Bacteria 118601
391 Ga0495653_0001350 3300046463 Bacteria 19054
392 Ga0495582_0611976 3300046473 Bacteria 630
393 Ga0495639_0544738 3300046475 Bacteria 594
394 Ga0495594_0739444 3300046499 Bacteria 555
395 Ga0495596_0385715 3300046500 Bacteria 546
396 Ga0495583_0129670 3300046506 Bacteria 1056
397 Ga0495608_0000029 3300046511 Bacteria 151790
398 Ga0495628_0000192 3300046516 Bacteria 53360
399 Ga0495652_0000083 3300046529 Bacteria 102109
400 Ga0495652_0234184 3300046529 Bacteria 1371
401 Ga0495587_0000022 3300046536 Bacteria 151790
402 Ga0495645_0205889 3300046543 Bacteria 1331
403 Ga0495667_0000028 3300046559 Bacteria 151705
404 Ga0495657_0000036 3300046675 Bacteria 118645
405 Ga0495599_0000587 3300046678 Bacteria 20764
406 Ga0495623_0000084 3300046679 Bacteria 55932
407 Ga0495647_0103497 3300046681 Bacteria 1181
408 Ga0495658_0901349 3300046683 Bacteria 565
409 Ga0495600_0165956 3300046809 Bacteria 1426
410 Ga0495581_0146284 3300047315 Bacteria 1379
411 Ga0495581_0299220 3300047315 Bacteria 940
412 Ga0495604_0000023 3300047317 Bacteria 151689
413 Ga0495674_0485354 3300047319 Bacteria 990
414 Ga0495676_0171017 3300047321 Bacteria 1529
415 Ga0495680_0000466 3300047322 Bacteria 45567
416 Ga0495675_0001572 3300047444 Bacteria 13782
417 Ga0495602_0000121 3300048088 Bacteria 73145
418 Ga0496100_0007765 3300048903 Bacteria 5945
419 Ga0496100_0644502 3300048903 Bacteria 824
420 Ga0496101_0004608 3300048904 Bacteria 8707
421 Ga0496101_0006253 3300048904 Bacteria 7660
422 Ga0496102_0010658 3300048905 Bacteria 7918
423 Ga0496102_0069314 3300048905 Bacteria 3237
424 Ga0496102_1639781 3300048905 Bacteria 561
425 Ga0496102_1752396 3300048905 Bacteria 539
426 Ga0496103_0007146 3300048906 Bacteria 6662
427 Ga0496103_0369969 3300048906 Bacteria 921
428 Ga0496104_0001559 3300048907 Bacteria 19737
429 Ga0496104_0002995 3300048907 Bacteria 14561
430 Ga0496104_0543930 3300048907 Bacteria 1072
431 Ga0496104_1339699 3300048907 Bacteria 619
432 Ga0496105_0003650 3300048908 Bacteria 11439
433 Ga0496105_0111177 3300048908 Bacteria 2261
434 Ga0496106_0011272 3300048909 Bacteria 6617
435 Ga0496106_0013955 3300048909 Bacteria 5941
436 Ga0496106_0459219 3300048909 Bacteria 1023
437 Ga0496106_0813635 3300048909 Bacteria 741
438 Ga0496107_0001527 3300048910 Bacteria 14376
439 Ga0496107_0009278 3300048910 Bacteria 6821
440 Ga0496107_0081507 3300048910 Bacteria 2360
441 Ga0496108_0021510 3300048911 Bacteria 5301
442 Ga0496108_0085463 3300048911 Bacteria 2678
443 Ga0496108_0089576 3300048911 Bacteria 2615
444 Ga0496108_0620455 3300048911 Bacteria 941
445 Ga0496109_0002884 3300048912 Bacteria 14387
446 Ga0496109_0034559 3300048912 Bacteria 4554
447 Ga0496109_0080165 3300048912 Bacteria 3008
448 Ga0496109_0095492 3300048912 Bacteria 2753
449 Ga0496109_1074462 3300048912 Bacteria 742
450 Ga0496110_0062736 3300048913 Bacteria 3283
451 Ga0496110_0123541 3300048913 Bacteria 2334
452 Ga0496110_0162637 3300048913 Bacteria 2024
453 Ga0496110_0315866 3300048913 Bacteria 1423
454 Ga0496110_0348446 3300048913 Bacteria 1349
455 Ga0496111_0063683 3300048914 Bacteria 2674
456 Ga0496111_0137285 3300048914 Bacteria 1812
457 Ga0496111_0233850 3300048914 Bacteria 1365
458 Ga0496112_0082029 3300048915 Bacteria 3189
459 Ga0496112_0344848 3300048915 Bacteria 1432
460 Ga0496112_0368646 3300048915 Bacteria 1378
461 Ga0496112_0383820 3300048915 Bacteria 1346
462 Ga0496113_0134052 3300048916 Bacteria 1945
463 Ga0496114_0001078 3300048917 Bacteria 20543
464 Ga0496114_0003716 3300048917 Bacteria 11751
465 Ga0496114_0017529 3300048917 Bacteria 5782
466 Ga0496115_0012796 3300048918 Bacteria 6325
467 Ga0496115_0053828 3300048918 Bacteria 3231
468 Ga0496115_0222849 3300048918 Bacteria 1556
469 Ga0496115_0365284 3300048918 Bacteria 1175
470 Ga0496115_0396521 3300048918 Bacteria 1120
471 Ga0496126_0001758 3300048929 Bacteria 32053
472 Ga0501032_0520237 3300049569 Bacteria 760
473 Ga0501033_0010021 3300049570 Bacteria 7278
474 Ga0501033_0236394 3300049570 Bacteria 1297
475 Ga0501036_0860403 3300049572 Bacteria 745
476 Ga0501038_0020802 3300049574 Bacteria 5897
477 Ga0501043_0129482 3300049579 Bacteria 1978
478 Ga0501046_0521971 3300049580 Bacteria 849
479 Ga0501047_0087706 3300049581 Bacteria 2989
480 Ga0501069_0044249 3300049585 Bacteria 2465
481 Ga0501073_0343849 3300049589 Bacteria 1030
482 Ga0501074_0024284 3300049590 Bacteria 4405
483 Ga0501080_0056362 3300049742 Bacteria 3660
484 Ga0501080_0774978 3300049742 Bacteria 842
485 Ga0501035_0166826 3300049822 Bacteria 1904
486 nmdc:mga0n895_103650_c1 3300050512 Bacteria 2856
487 nmdc:mga0rr50_941213_c1 3300050513 Bacteria 736
488 nmdc:mga0a205_888167_c1 3300050515 Bacteria 738
489 Ga0495601_0011478 3300053077 Bacteria 5301
490 Ga0495601_0169592 3300053077 Bacteria 1427
491 Ga0495595_0000114 3300053084 Bacteria 36294
492 Ga0500577_0142849 3300053142 Bacteria 1010
493 Ga0590077_094537 3300059426 Bacteria 696
494 Ga0466962_0073431 3300061719 Bacteria 1635
495 Ga0466962_0138095 3300061719 Bacteria 1180
496 Ga0466962_0677189 3300061719 Bacteria 528
497 2586061053 2585427649 Bacteria 9053857
498 2791915306 2791354901 Bacteria 8322202
499 2808915529 2808606375 Bacteria 9466072
500 2809589901 2808606522 Bacteria 9488490
501 2812372855 2811994882 Bacteria 4688362
502 2990088735 2990088156 Bacteria 6657676
503 8056061388 8056060235 Bacteria 7259403
504 Ga0466958_0343164
505 JGI24735J21928_10060422
506 JGI25406J46586_10013996
507 JGI25406J46586_10075452
508 JGI25407J50210_10003933
509 JGI25407J50210_10075645
510 Ga0070676_10409840
511 Ga0070683_100643053
512 Ga0070683_100754043
513 Ga0070683_100796937
514 Ga0070670_100017272
515 Ga0070670_100027537
516 Ga0068869_101169237
517 Ga0070666_10005634
518 Ga0068868_100075036
519 Ga0068868_100106450
520 Ga0068868_100987619
521 Ga0070660_100628100
522 Ga0070689_100449213
523 Ga0070687_100075756
524 Ga0070687_100106835
525 Ga0070661_100014196
526 Ga0070692_10128303
527 Ga0070692_10160402
528 Ga0070669_100512041
529 Ga0070675_100088111
530 Ga0070671_100050830
531 Ga0070671_100110749
532 Ga0070674_100012586
533 Ga0070674_100052985
534 Ga0070673_100082022
535 Ga0070673_100090543
536 Ga0070688_100011277
537 Ga0070688_100247273
538 Ga0070659_100564636
539 Ga0070667_100001912
540 Ga0070667_100323859
541 Ga0070714_100265558
542 Ga0070714_100869312
543 Ga0070713_100303214
544 Ga0070711_100169452
545 Ga0070705_100113788
546 Ga0070705_100209692
547 Ga0070705_100439552
548 Ga0070694_100761506
549 Ga0070663_100084514
550 Ga0070663_100408660
551 Ga0070663_100757666
552 Ga0070663_100929502
553 Ga0070678_100001193
554 Ga0070662_100081712
555 Ga0070662_100684776
556 Ga0070681_10006088
557 Ga0070681_10117170
558 Ga0070681_11160512
559 Ga0068867_100257234
560 Ga0070679_100103614
561 Ga0070679_100921242
562 Ga0070679_101010149
563 Ga0070684_100030889
564 Ga0070684_100041030
565 Ga0070684_100078252
566 Ga0070672_100090718
567 Ga0070672_100894554
568 Ga0070686_100041679
569 Ga0070686_100562992
570 Ga0070686_100578561
571 Ga0070696_100100405
572 Ga0070693_100203978
573 Ga0070665_100346927
574 Ga0070665_100718805
575 Ga0070704_100142608
576 Ga0068855_101400209
577 Ga0070664_100012724
578 Ga0070664_100116124
579 Ga0070664_100205603
580 Ga0070664_100455700
581 Ga0068857_100170754
582 Ga0068854_100117629
583 Ga0068856_100232693
584 Ga0068856_100416886
585 Ga0068856_101528927
586 Ga0068856_102484108
587 Ga0070702_100126169
588 Ga0068852_100051079
589 Ga0068852_100396364
590 Ga0068859_100053479
591 Ga0068859_100239554
592 Ga0068864_100001701
593 Ga0068864_100153845
594 Ga0068864_100296560
595 Ga0068864_100500393
596 Ga0068866_10056889
597 Ga0068861_100183864
598 Ga0068861_101107642
599 Ga0068870_10054355
600 Ga0068863_100010707
601 Ga0068863_100232610
602 Ga0068863_101012385
603 Ga0068858_100050833
604 Ga0068860_100026220
605 Ga0068860_100029375
606 Ga0081455_10013145
607 Ga0081455_10014262
608 Ga0081455_10126331
609 Ga0081455_10152253
610 Ga0081538_10000253
611 Ga0081538_10005432
612 Ga0081538_10019824
613 Ga0081538_10046076
614 Ga0081538_10075302
615 Ga0081540_1001577
616 Ga0081540_1178888
617 Ga0081539_10004365
618 Ga0081539_10007251
619 Ga0081539_10020419
620 Ga0070717_10019514
621 Ga0075364_10668707
622 Ga0070715_10005293
623 Ga0070716_100618923
624 Ga0070712_100460974
625 Ga0097621_100006534
626 Ga0068871_100023180
627 Ga0075428_100429294
628 Ga0075431_100097904
629 Ga0075431_101448837
630 Ga0068865_100020708
631 Ga0068865_100203378
632 Ga0068865_100668148
633 Ga0097620_100053479
634 Ga0097620_100239531
635 Ga0105244_10171737
636 Ga0105240_10603481
637 Ga0105240_12251530
638 Ga0111539_10515146
639 Ga0105245_10018866
640 Ga0105245_10181298
641 Ga0105247_10004302
642 Ga0105247_10046076
643 Ga0114129_12006662
644 Ga0105243_10012448
645 Ga0105243_10590559
646 Ga0105241_10004216
647 Ga0105242_10004820
648 Ga0105242_10078894
649 Ga0105242_10103825
650 Ga0105242_10257416
651 Ga0105242_11384292
652 Ga0105248_10012340
653 Ga0105248_10028394
654 Ga0105238_10031974
655 Ga0105238_11126148
656 Ga0105249_10187823
657 Ga0105249_10337727
658 Ga0105249_10565293
659 Ga0105249_10689311
660 Ga0105249_11914329
661 Ga0105239_10079114
662 Ga0105239_10508924
663 Ga0105239_10511889
664 Ga0105239_11599600
665 Ga0105246_10013153
666 Ga0105246_10023210
667 Ga0105246_10096299
668 Ga0105246_12409867
669 Ga0157373_11055906
670 Ga0157370_10051315
671 Ga0157369_10169271
672 Ga0157369_10388257
673 Ga0157374_10013584
674 Ga0157374_10564199
675 Ga0157378_10075434
676 Ga0157372_10660016
677 Ga0157372_11829652
678 Ga0157375_10002031
679 Ga0157375_10005942
680 Ga0157375_10029495
681 Ga0163163_10005290
682 Ga0163163_10786167
683 Ga0157380_10063267
684 Ga0157380_11234946
685 Ga0157380_12230710
686 Ga0157377_10041060
687 Ga0157377_10112858
688 Ga0157379_10007397
689 Ga0157379_10007918
690 Ga0157379_10171271
691 Ga0157379_11523206
692 Ga0157376_10003319
693 Ga0157376_10007961
694 Ga0163161_10109809
695 Ga0163161_10940268
696 Ga0206356_11072694
697 Ga0206349_1853985
698 Ga0206355_1375103
699 Ga0206352_10852943
700 Ga0206350_10006660
701 Ga0206350_10164371
702 Ga0206350_10223693
703 Ga0206354_11457318
704 Ga0206353_10551325
705 Ga0154015_1282419
706 Ga0207655_1112479
707 Ga0207710_10156964
708 Ga0207688_10024099
709 Ga0207647_10026552
710 Ga0207645_10079207
711 Ga0207643_10034355
712 Ga0207643_10213651
713 Ga0207654_10109709
714 Ga0207707_10007049
715 Ga0207707_10271587
716 Ga0207695_10594338
717 Ga0207693_10016401
718 Ga0207663_10492952
719 Ga0207660_10337812
720 Ga0207660_10633646
721 Ga0207662_10084129
722 Ga0207657_11181271
723 Ga0207649_10050954
724 Ga0207649_10534709
725 Ga0207652_10070964
726 Ga0207652_10570197
727 Ga0207652_10988727
728 Ga0207681_10530315
729 Ga0207694_11180433
730 Ga0207694_11331173
731 Ga0207650_10046731
732 Ga0207650_10263918
733 Ga0207659_10093818
734 Ga0207687_10597329
735 Ga0207700_11037764
736 Ga0207664_10564188
737 Ga0207644_10045118
738 Ga0207644_10439947
739 Ga0207644_10444755
740 Ga0207690_10393537
741 Ga0207690_10955929
742 Ga0207686_10120906
743 Ga0207686_10419261
744 Ga0207686_10611797
745 Ga0207709_10139771
746 Ga0207670_10437542
747 Ga0207670_10704160
748 Ga0207669_10060701
749 Ga0207669_10068382
750 Ga0207704_10106664
751 Ga0207704_10290599
752 Ga0207704_10437965
753 Ga0207665_10316414
754 Ga0207691_10024581
755 Ga0207691_10056238
756 Ga0207711_10000578
757 Ga0207711_10078100
758 Ga0207661_10016110
759 Ga0207661_10332671
760 Ga0207661_10640812
761 Ga0207661_11194081
762 Ga0207661_11209581
763 Ga0207679_10062128
764 Ga0207679_10248987
765 Ga0207679_10278909
766 Ga0207667_10457866
767 Ga0207651_10272617
768 Ga0207651_10983965
769 Ga0207668_10071337
770 Ga0207640_10426836
771 Ga0207640_10662675
772 Ga0207658_10025269
773 Ga0207677_10027609
774 Ga0207677_10168952
775 Ga0207677_10295409
776 Ga0207677_10642989
777 Ga0207703_10610660
778 Ga0207703_11450826
779 Ga0207678_10014699
780 Ga0207678_10136155
781 Ga0207678_10190122
782 Ga0207678_10764722
783 Ga0207678_10931948
784 Ga0207678_11082783
785 Ga0207708_10446933
786 Ga0207708_10545807
787 Ga0207708_11622978
788 Ga0207702_10033350
789 Ga0207702_10522646
790 Ga0207641_10196779
791 Ga0207641_10396910
792 Ga0207648_10239432
793 Ga0207648_10316946
794 Ga0207648_12057398
795 Ga0207676_10045044
796 Ga0207676_10675232
797 Ga0207674_10101145
798 Ga0207674_10894571
799 Ga0207675_100197448
800 Ga0207683_10000039
801 Ga0207698_10403445
802 Ga0207698_11166365
803 Ga0207428_10575617
804 Ga0268266_10093877
805 Ga0268264_10007411
806 Ga0268264_10119243
807 Ga0268264_12262333
808 Ga0265334_10111139
809 Ga0307511_10104286
810 Ga0307512_10013289
811 Ga0307512_10333752
812 Ga0307413_10062486
813 Ga0307413_10632368
814 Ga0307518_10004346
815 Ga0307410_10083910
816 Ga0307410_10297111
817 Ga0307406_10108157
818 Ga0307406_10176073
819 Ga0307406_10298221
820 Ga0307406_10568361
821 Ga0307406_11583805
822 Ga0307409_100070069
823 Ga0307409_100271988
824 Ga0307409_101395918
825 Ga0307416_100093880
826 Ga0307416_100312393
827 Ga0307416_100407130
828 Ga0307414_11464465
829 Ga0307415_100105023
830 Ga0307415_100421962
831 Ga0307415_101163828
832 Ga0316214_1001932
833 Ga0316212_1009126
834 Ga0373934_0000043
835 Ga0373944_0205351
836 Ga0373949_0217987
837 Ga0373952_0129248
838 Ga0373953_0000011
839 Ga0373954_0008879
840 Ga0373956_0001215
841 Ga0373957_0000354
842 Ga0373955_0000089
843 Ga0373924_0000028
844 Ga0373933_0000011
845 Ga0373937_0000021
846 Ga0372808_001326
847 Ga0372808_001388
848 Ga0373925_0000043
849 Ga0395899_0276784
850 Ga0395898_0232805
851 Ga0395901_0998483
852 Ga0439439_0020109
853 Ga0439447_116540
854 Ga0451795_0296746
855 Ga0439452_027725
856 Ga0439462_0018118
857 Ga0451577_0979784
858 Ga0466965_0133432
859 Ga0466965_0201087
860 Ga0466965_0519095
861 Ga0466965_0721264
862 Ga0466966_0356613
863 Ga0466961_0161673
864 Ga0466961_0784540
865 Ga0466963_0018187
866 Ga0466963_0116400
867 Ga0466963_0377387
868 Ga0466964_0560557
869 Ga0466971_0339769
870 Ga0466970_0302367
871 Ga0466957_0173568
872 Ga0466957_0756149
873 Ga0466957_1000468
874 Ga0466957_1002243
875 Ga0466960_0062178
876 Ga0466960_0105559
877 Ga0451576_0078705
878 Ga0466958_0015375
879 Ga0466967_0012870
880 Ga0466967_0091269
881 Ga0466967_0244082
882 Ga0466967_0269816
883 Ga0466967_0431261
884 Ga0466967_0910082
885 Ga0466967_0913917
886 Ga0466967_0978309
887 Ga0466967_1438764
888 Ga0495592_0000013
889 Ga0495603_0065007
890 Ga0495629_0056335
891 Ga0495629_0108536
892 Ga0495641_0113636
893 Ga0495651_0000022
894 Ga0495653_0001350
895 Ga0495582_0611976
896 Ga0495639_0544738
897 Ga0495594_0739444
898 Ga0495596_0385715
899 Ga0495583_0129670
900 Ga0495608_0000029
901 Ga0495628_0000192
902 Ga0495652_0000083
903 Ga0495652_0234184
904 Ga0495587_0000022
905 Ga0495645_0205889
906 Ga0495667_0000028
907 Ga0495657_0000036
908 Ga0495599_0000587
909 Ga0495623_0000084
910 Ga0495647_0103497
911 Ga0495658_0901349
912 Ga0495600_0165956
913 Ga0495581_0146284
914 Ga0495581_0299220
915 Ga0495604_0000023
916 Ga0495674_0485354
917 Ga0495676_0171017
918 Ga0495680_0000466
919 Ga0495675_0001572
920 Ga0495602_0000121
921 Ga0496100_0007765
922 Ga0496100_0644502
923 Ga0496101_0004608
924 Ga0496101_0006253
925 Ga0496102_0010658
926 Ga0496102_0069314
927 Ga0496102_1639781
928 Ga0496102_1752396
929 Ga0496103_0007146
930 Ga0496103_0369969
931 Ga0496104_0001559
932 Ga0496104_0002995
933 Ga0496104_0543930
934 Ga0496104_1339699
935 Ga0496105_0003650
936 Ga0496105_0111177
937 Ga0496106_0011272
938 Ga0496106_0013955
939 Ga0496106_0459219
940 Ga0496106_0813635
941 Ga0496107_0001527
942 Ga0496107_0009278
943 Ga0496107_0081507
944 Ga0496108_0021510
945 Ga0496108_0085463
946 Ga0496108_0089576
947 Ga0496108_0620455
948 Ga0496109_0002884
949 Ga0496109_0034559
950 Ga0496109_0080165
951 Ga0496109_0095492
952 Ga0496109_1074462
953 Ga0496110_0062736
954 Ga0496110_0123541
955 Ga0496110_0162637
956 Ga0496110_0315866
957 Ga0496110_0348446
958 Ga0496111_0063683
959 Ga0496111_0137285
960 Ga0496111_0233850
961 Ga0496112_0082029
962 Ga0496112_0344848
963 Ga0496112_0368646
964 Ga0496112_0383820
965 Ga0496113_0134052
966 Ga0496114_0001078
967 Ga0496114_0003716
968 Ga0496114_0017529
969 Ga0496115_0012796
970 Ga0496115_0053828
971 Ga0496115_0222849
972 Ga0496115_0365284
973 Ga0496115_0396521
974 Ga0496126_0001758
975 Ga0501032_0520237
976 Ga0501033_0010021
977 Ga0501033_0236394
978 Ga0501036_0860403
979 Ga0501038_0020802
980 Ga0501043_0129482
981 Ga0501046_0521971
982 Ga0501047_0087706
983 Ga0501069_0044249
984 Ga0501073_0343849
985 Ga0501074_0024284
986 Ga0501080_0056362
987 Ga0501080_0774978
988 Ga0501035_0166826
989 nmdc:mga0n895_103650_c1
990 nmdc:mga0rr50_941213_c1
991 nmdc:mga0a205_888167_c1
992 Ga0495601_0011478
993 Ga0495601_0169592
994 Ga0495595_0000114
995 Ga0500577_0142849
996 Ga0590077_094537
997 Ga0466962_0073431
998 Ga0466962_0138095
999 Ga0466962_0677189
1000 2586061053
1001 2791915306
1002 2808915529
1003 2809589901
1004 2812372855
1005 2990088735
1006 8056061388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

12

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9847 1 143
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.894 11 123
7epn-assembly1.cif.gz_B ketosteroid isomerase ksi native 0.8869 16 126
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.8859 14 126
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8809 16 126
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9755 12 143 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9135 12 143 3.10.450.50
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8753 39 126 3.10.450.50
3ebtA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8701 16 126 3.10.450.50
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8682 16 126 3.10.450.50
ID Description Score Start End GO Terms
AF-V6KW34-F1-model_v4 deleted 1.003 5 113
AF-A0A418M5M4-F1-model_v4 Nuclear transport factor 2 family protein 1.001 4 137
AF-A0A1H4QTG3-F1-model_v4 SnoaL-like domain-containing protein 1.001 4 137
AF-A0A5C5XZB0-F1-model_v4 SnoaL-like domain protein 1.001 8 137
AF-A0A7Y7B283-F1-model_v4 Nuclear transport factor 2 family protein 1.001 11 138

Map