F456056

General Info

Members Datasets Scaffolds Average Seq Length
503 257 1006 147

Family's Representative Sequence

Representative Sequence 3300041503|Ga0451847_0001261|Ga0451847_0001261_17_562
Length 181
Sequence MPDPVHQGAGNVPRGDDVFIDARLIVAHIESGGLMHFEGSVAINASREKVWAFVIDPDQVGQCGPGVEKIEVIDPTHFKATAKVGIGFISARFNVNMELAETDAPDRALIKAHGQAPGSAVDATAQMHLSDGEDGGTVMDWSADVNLSGTLASVGARMIEGTANKMIGQTFDCIKAKLEAG

Samples

Sample ID Description Type Environment
1 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
166 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 9.54
Rhizosphere 88.47
Stem 0
Stem Tuber 0
Unclassified 21.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451847_0001261 3300041503 Bacteria 852
2 JGI24746J21847_1043826 3300001977 Bacteria 624
3 JGI24743J22301_10111179 3300001991 Bacteria 595
4 rootH1_10195880 3300003323 Bacteria 2490
5 Ga0070683_100196702 3300005329 Bacteria 1914
6 Ga0070683_100589452 3300005329 Bacteria 1064
7 Ga0070683_101359271 3300005329 Unclassified 683
8 Ga0070690_100012801 3300005330 Bacteria 4942
9 Ga0070670_100027412 3300005331 Bacteria 4901
10 Ga0068869_100179339 3300005334 Bacteria 1660
11 Ga0068869_100942460 3300005334 Bacteria 749
12 Ga0068869_101909395 3300005334 Bacteria 532
13 Ga0070682_100012307 3300005337 Bacteria 4903
14 Ga0068868_100041676 3300005338 Bacteria 3578
15 Ga0068868_100320312 3300005338 Unclassified 1321
16 Ga0068868_100471610 3300005338 Bacteria 1095
17 Ga0068868_101249795 3300005338 Unclassified 688
18 Ga0068868_102060337 3300005338 Unclassified 542
19 Ga0070689_100004080 3300005340 Bacteria 9836
20 Ga0070689_100657700 3300005340 Bacteria 912
21 Ga0070661_100101245 3300005344 Bacteria 2143
22 Ga0070661_100780564 3300005344 Bacteria 783
23 Ga0070661_101161821 3300005344 Bacteria 645
24 Ga0070692_10007184 3300005345 Bacteria 4890
25 Ga0070669_100098704 3300005353 Bacteria 2200
26 Ga0070669_100810202 3300005353 Bacteria 796
27 Ga0070675_100004579 3300005354 Bacteria 10557
28 Ga0070675_100057125 3300005354 Bacteria 3217
29 Ga0070675_100167227 3300005354 Bacteria 1895
30 Ga0070675_100455951 3300005354 Unclassified 1147
31 Ga0070674_100028591 3300005356 Bacteria 3663
32 Ga0070674_100752011 3300005356 Unclassified 838
33 Ga0070674_101603675 3300005356 Bacteria 587
34 Ga0070674_101786478 3300005356 Unclassified 557
35 Ga0070673_100009835 3300005364 Bacteria 6442
36 Ga0070673_100892258 3300005364 Unclassified 824
37 Ga0070673_101083968 3300005364 Unclassified 748
38 Ga0070688_100009340 3300005365 Bacteria 5359
39 Ga0070688_100219826 3300005365 Unclassified 1338
40 Ga0070659_100075060 3300005366 Bacteria 2694
41 Ga0070701_10006207 3300005438 Bacteria 5012
42 Ga0070705_100060774 3300005440 Bacteria 2243
43 Ga0070705_100076956 3300005440 Bacteria 2036
44 Ga0070705_100081954 3300005440 Bacteria 1984
45 Ga0070705_100152430 3300005440 Bacteria 1535
46 Ga0070705_100480455 3300005440 Bacteria 939
47 Ga0070705_100718054 3300005440 Bacteria 787
48 Ga0070705_101313977 3300005440 Bacteria 600
49 Ga0070700_100002416 3300005441 Bacteria 9520
50 Ga0070700_100035518 3300005441 Bacteria 3017
51 Ga0070700_101344193 3300005441 Bacteria 602
52 Ga0070694_100087312 3300005444 Bacteria 2181
53 Ga0070678_100037130 3300005456 Bacteria 3417
54 Ga0070678_100316635 3300005456 Bacteria 1331
55 Ga0070678_100677210 3300005456 Unclassified 927
56 Ga0070662_100011301 3300005457 Bacteria 5886
57 Ga0070662_100766124 3300005457 Unclassified 819
58 Ga0070662_101636384 3300005457 Unclassified 556
59 Ga0070681_10263864 3300005458 Bacteria 1634
60 Ga0070681_10280801 3300005458 Bacteria 1576
61 Ga0068867_100013600 3300005459 Bacteria 5763
62 Ga0068867_100670468 3300005459 Bacteria 912
63 Ga0070707_100011078 3300005468 Bacteria 8398
64 Ga0070698_100603946 3300005471 Bacteria 1037
65 Ga0070699_100012035 3300005518 Bacteria 7469
66 Ga0070679_100122089 3300005530 Bacteria 2589
67 Ga0070697_100269772 3300005536 Bacteria 1458
68 Ga0068853_100077859 3300005539 Unclassified 2897
69 Ga0070672_100058752 3300005543 Bacteria 3024
70 Ga0070672_101463246 3300005543 Bacteria 612
71 Ga0070686_100155030 3300005544 Bacteria 1607
72 Ga0070686_100237715 3300005544 Bacteria 1325
73 Ga0070686_100237740 3300005544 Bacteria 1325
74 Ga0070686_100835951 3300005544 Bacteria 745
75 Ga0070695_100033741 3300005545 Bacteria 3203
76 Ga0070695_101108597 3300005545 Bacteria 648
77 Ga0070696_100005510 3300005546 Bacteria 8444
78 Ga0070696_100020350 3300005546 Bacteria 4498
79 Ga0070696_100027383 3300005546 Bacteria 3883
80 Ga0070696_101274955 3300005546 Bacteria 623
81 Ga0070693_100009095 3300005547 Bacteria 4930
82 Ga0070704_100193467 3300005549 Bacteria 1637
83 Ga0070704_100220547 3300005549 Unclassified 1542
84 Ga0070704_100264392 3300005549 Bacteria 1418
85 Ga0068855_100657612 3300005563 Bacteria 1125
86 Ga0068855_101009284 3300005563 Unclassified 874
87 Ga0068857_100740691 3300005577 Bacteria 936
88 Ga0068854_100154660 3300005578 Bacteria 1771
89 Ga0070702_100006121 3300005615 Bacteria 5671
90 Ga0070702_100914100 3300005615 Bacteria 688
91 Ga0068852_100065153 3300005616 Bacteria 3178
92 Ga0068859_100050200 3300005617 Bacteria 4191
93 Ga0068859_100139377 3300005617 Unclassified 2499
94 Ga0068864_100019060 3300005618 Bacteria 5734
95 Ga0068864_100537127 3300005618 Unclassified 1129
96 Ga0068864_100613400 3300005618 Bacteria 1057
97 Ga0068864_101069413 3300005618 Bacteria 802
98 Ga0068866_10665846 3300005718 Bacteria 710
99 Ga0068861_100099114 3300005719 Unclassified 2314
100 Ga0068851_10654975 3300005834 Unclassified 643
101 Ga0068870_10553541 3300005840 Unclassified 775
102 Ga0068858_100166716 3300005842 Bacteria 2076
103 Ga0068858_100296491 3300005842 Bacteria 1542
104 Ga0068860_100008502 3300005843 Bacteria 10228
105 Ga0081455_10098050 3300005937 Bacteria 2360
106 Ga0081455_10529372 3300005937 Bacteria 784
107 Ga0081538_10121655 3300005981 Archaea 1252
108 Ga0075365_10144151 3300006038 Bacteria 1654
109 Ga0075432_10111233 3300006058 Bacteria 1021
110 Ga0097621_100082185 3300006237 Bacteria 2682
111 Ga0097621_100208293 3300006237 Bacteria 1700
112 Ga0068871_100480103 3300006358 Bacteria 1118
113 Ga0075428_100001431 3300006844 Bacteria 25463
114 Ga0075428_100249444 3300006844 Bacteria 1913
115 Ga0075431_100081686 3300006847 Bacteria 3337
116 Ga0075431_100983652 3300006847 Bacteria 811
117 Ga0075433_10222176 3300006852 Bacteria 1678
118 Ga0075433_10308904 3300006852 Bacteria 1400
119 Ga0075433_10453131 3300006852 Bacteria 1131
120 Ga0075433_10747190 3300006852 Bacteria 856
121 Ga0075434_100034478 3300006871 Bacteria 4997
122 Ga0075434_100366313 3300006871 Bacteria 1462
123 Ga0075429_100173823 3300006880 Bacteria 1887
124 Ga0068865_100002642 3300006881 Bacteria 10646
125 Ga0068865_101183977 3300006881 Unclassified 676
126 Ga0075436_100932427 3300006914 Unclassified 650
127 Ga0097620_100050201 3300006931 Bacteria 4191
128 Ga0097620_100139373 3300006931 Unclassified 2499
129 Ga0075435_100069177 3300007076 Archaea 2878
130 Ga0111539_10023130 3300009094 Bacteria 7632
131 Ga0111539_10158759 3300009094 Bacteria 2645
132 Ga0111539_10190534 3300009094 Bacteria 2393
133 Ga0111539_11182813 3300009094 Unclassified 888
134 Ga0111539_11411872 3300009094 Unclassified 808
135 Ga0111539_12066095 3300009094 Unclassified 661
136 Ga0105245_10017767 3300009098 Bacteria 6207
137 Ga0105245_10026928 3300009098 Bacteria 5062
138 Ga0105245_10428897 3300009098 Bacteria 1327
139 Ga0105245_11198964 3300009098 Bacteria 807
140 Ga0105245_12370590 3300009098 Bacteria 584
141 Ga0105247_10200560 3300009101 Bacteria 1340
142 Ga0114129_10001927 3300009147 Bacteria 28355
143 Ga0114129_10116850 3300009147 Bacteria 3676
144 Ga0114129_10352028 3300009147 Bacteria 1951
145 Ga0105243_10066945 3300009148 Bacteria 2890
146 Ga0105243_10324809 3300009148 Bacteria 1403
147 Ga0105243_10709663 3300009148 Bacteria 981
148 Ga0105243_11448386 3300009148 Bacteria 709
149 Ga0105243_12206166 3300009148 Unclassified 587
150 Ga0105241_10630415 3300009174 Bacteria 972
151 Ga0105241_11927413 3300009174 Unclassified 580
152 Ga0105242_10282108 3300009176 Bacteria 1509
153 Ga0105242_10959452 3300009176 Bacteria 860
154 Ga0105242_11549911 3300009176 Bacteria 695
155 Ga0105248_10244537 3300009177 Bacteria 2020
156 Ga0105238_10075788 3300009551 Bacteria 3355
157 Ga0105249_10003799 3300009553 Bacteria 13037
158 Ga0105249_10558272 3300009553 Unclassified 1196
159 Ga0105249_10715233 3300009553 Unclassified 1062
160 Ga0105249_11202522 3300009553 Bacteria 829
161 Ga0105249_11241841 3300009553 Bacteria 816
162 Ga0105239_10008935 3300010375 Bacteria 11337
163 Ga0105239_10734799 3300010375 Bacteria 1129
164 Ga0105239_10901926 3300010375 Unclassified 1015
165 Ga0105246_10449286 3300011119 Bacteria 1083
166 Ga0105246_11378271 3300011119 Unclassified 657
167 Ga0105246_12592336 3300011119 Unclassified 501
168 Ga0157371_11169924 3300013102 Unclassified 592
169 Ga0157374_10497556 3300013296 Bacteria 1223
170 Ga0157374_10518595 3300013296 Bacteria 1197
171 Ga0157374_11292733 3300013296 Bacteria 751
172 Ga0157378_10007754 3300013297 Bacteria 9368
173 Ga0157378_10420878 3300013297 Bacteria 1320
174 Ga0163162_10027318 3300013306 Bacteria 5643
175 Ga0163162_11524794 3300013306 Bacteria 762
176 Ga0157375_10027384 3300013308 Bacteria 5327
177 Ga0157375_11042767 3300013308 Bacteria 956
178 Ga0163163_10328666 3300014325 Bacteria 1583
179 Ga0163163_11016012 3300014325 Bacteria 892
180 Ga0163163_11119734 3300014325 Unclassified 850
181 Ga0163163_11371649 3300014325 Unclassified 769
182 Ga0163163_11803133 3300014325 Bacteria 672
183 Ga0157380_10058302 3300014326 Bacteria 3077
184 Ga0157380_10077846 3300014326 Bacteria 2704
185 Ga0157380_11667023 3300014326 Unclassified 694
186 Ga0182008_10094609 3300014497 Unclassified 1474
187 Ga0157377_10008485 3300014745 Bacteria 5012
188 Ga0157379_10079611 3300014968 Bacteria 2934
189 Ga0157376_10637728 3300014969 Bacteria 1064
190 Ga0157376_10656851 3300014969 Unclassified 1050
191 Ga0157376_11025961 3300014969 Bacteria 848
192 Ga0163161_10005304 3300017792 Bacteria 8974
193 Ga0163161_10132744 3300017792 Bacteria 1880
194 Ga0163161_11714400 3300017792 Unclassified 557
195 Ga0207656_10231977 3300025321 Bacteria 900
196 Ga0207642_10382206 3300025899 Bacteria 838
197 Ga0207642_10582007 3300025899 Unclassified 695
198 Ga0207688_10003628 3300025901 Bacteria 8430
199 Ga0207688_10754012 3300025901 Bacteria 616
200 Ga0207647_10356828 3300025904 Bacteria 827
201 Ga0207684_10130653 3300025910 Bacteria 2155
202 Ga0207684_10448783 3300025910 Bacteria 1107
203 Ga0207684_10690687 3300025910 Unclassified 868
204 Ga0207654_10481183 3300025911 Bacteria 874
205 Ga0207707_10547208 3300025912 Unclassified 984
206 Ga0207707_10784647 3300025912 Bacteria 795
207 Ga0207707_11029407 3300025912 Bacteria 674
208 Ga0207662_10001585 3300025918 Bacteria 11136
209 Ga0207662_10312020 3300025918 Bacteria 1048
210 Ga0207657_10985533 3300025919 Bacteria 647
211 Ga0207649_10109572 3300025920 Bacteria 1842
212 Ga0207649_10343572 3300025920 Bacteria 1103
213 Ga0207646_11251287 3300025922 Unclassified 649
214 Ga0207694_10047133 3300025924 Bacteria 3333
215 Ga0207650_10319187 3300025925 Bacteria 1272
216 Ga0207650_11100738 3300025925 Bacteria 676
217 Ga0207659_10020560 3300025926 Bacteria 4365
218 Ga0207659_10293059 3300025926 Unclassified 1334
219 Ga0207659_10305575 3300025926 Bacteria 1308
220 Ga0207659_10407639 3300025926 Bacteria 1138
221 Ga0207687_10029420 3300025927 Bacteria 3696
222 Ga0207687_10298090 3300025927 Bacteria 1298
223 Ga0207700_10792211 3300025928 Bacteria 848
224 Ga0207690_10077830 3300025932 Bacteria 2306
225 Ga0207706_10005959 3300025933 Bacteria 11338
226 Ga0207706_10275316 3300025933 Bacteria 1468
227 Ga0207706_10399058 3300025933 Unclassified 1192
228 Ga0207686_10127265 3300025934 Bacteria 1742
229 Ga0207709_10088532 3300025935 Bacteria 2016
230 Ga0207670_10039467 3300025936 Bacteria 3092
231 Ga0207669_10036875 3300025937 Bacteria 2799
232 Ga0207669_10071046 3300025937 Bacteria 2185
233 Ga0207669_10994081 3300025937 Unclassified 705
234 Ga0207704_10595569 3300025938 Bacteria 904
235 Ga0207691_10037929 3300025940 Bacteria 4460
236 Ga0207691_10229459 3300025940 Unclassified 1608
237 Ga0207691_10965068 3300025940 Bacteria 712
238 Ga0207711_10108898 3300025941 Bacteria 2461
239 Ga0207711_11135824 3300025941 Bacteria 722
240 Ga0207689_10069826 3300025942 Bacteria 2886
241 Ga0207689_10583551 3300025942 Bacteria 940
242 Ga0207689_10682565 3300025942 Bacteria 866
243 Ga0207689_10913139 3300025942 Unclassified 741
244 Ga0207661_10680082 3300025944 Bacteria 946
245 Ga0207661_11360321 3300025944 Bacteria 652
246 Ga0207679_10072833 3300025945 Bacteria 2597
247 Ga0207679_10432629 3300025945 Bacteria 1163
248 Ga0207679_10442308 3300025945 Bacteria 1151
249 Ga0207679_10852885 3300025945 Unclassified 832
250 Ga0207667_10409244 3300025949 Bacteria 1381
251 Ga0207651_10717962 3300025960 Unclassified 882
252 Ga0207651_10876816 3300025960 Bacteria 798
253 Ga0207712_10008577 3300025961 Bacteria 6461
254 Ga0207668_10385523 3300025972 Unclassified 1181
255 Ga0207640_10051540 3300025981 Bacteria 2676
256 Ga0207677_10032075 3300026023 Bacteria 3374
257 Ga0207677_10493311 3300026023 Bacteria 1057
258 Ga0207639_11605507 3300026041 Bacteria 610
259 Ga0207678_10009395 3300026067 Bacteria 8605
260 Ga0207708_10009990 3300026075 Bacteria 7047
261 Ga0207708_10318826 3300026075 Unclassified 1268
262 Ga0207648_10006662 3300026089 Bacteria 11462
263 Ga0207648_10673680 3300026089 Unclassified 957
264 Ga0207648_10988491 3300026089 Bacteria 788
265 Ga0207676_10041874 3300026095 Bacteria 3519
266 Ga0207676_10564889 3300026095 Unclassified 1089
267 Ga0207676_11093508 3300026095 Bacteria 788
268 Ga0207674_10014503 3300026116 Bacteria 8702
269 Ga0207674_10436964 3300026116 Bacteria 1265
270 Ga0207675_100125522 3300026118 Bacteria 2431
271 Ga0207675_100428217 3300026118 Bacteria 1308
272 Ga0207675_101003713 3300026118 Unclassified 853
273 Ga0207675_101035587 3300026118 Bacteria 840
274 Ga0207683_10024564 3300026121 Bacteria 5191
275 Ga0207683_10033577 3300026121 Bacteria 4457
276 Ga0207683_10330397 3300026121 Bacteria 1397
277 Ga0207683_10344811 3300026121 Bacteria 1366
278 Ga0209969_1081075 3300027360 Bacteria 519
279 Ga0209974_10014463 3300027876 Bacteria 2626
280 Ga0207428_10096388 3300027907 Bacteria 2291
281 Ga0207428_10866336 3300027907 Bacteria 639
282 Ga0268264_10013364 3300028381 Bacteria 6756
283 Ga0265334_10069256 3300028573 Bacteria 1317
284 Ga0265318_10017973 3300028577 Bacteria 2893
285 Ga0265318_10083572 3300028577 Bacteria 1178
286 Ga0265318_10139076 3300028577 Bacteria 892
287 Ga0265328_10303238 3300031239 Unclassified 617
288 Ga0265320_10070048 3300031240 Bacteria 1654
289 Ga0265325_10151401 3300031241 Bacteria 1097
290 Ga0265329_10048091 3300031242 Bacteria 1361
291 Ga0265339_10047606 3300031249 Bacteria 2354
292 Ga0265313_10010958 3300031595 Bacteria 5676
293 Ga0265314_10011353 3300031711 Bacteria 7361
294 Ga0265342_10254182 3300031712 Bacteria 937
295 Ga0307405_10877163 3300031731 Unclassified 757
296 Ga0307413_11002784 3300031824 Bacteria 716
297 Ga0307406_10026839 3300031901 Bacteria 3464
298 Ga0307407_10285625 3300031903 Unclassified 1145
299 Ga0307412_11768233 3300031911 Unclassified 568
300 Ga0307409_101168359 3300031995 Unclassified 792
301 Ga0307416_100032238 3300032002 Bacteria 3956
302 Ga0307416_101163646 3300032002 Bacteria 876
303 Ga0307411_10796609 3300032005 Unclassified 832
304 Ga0307415_100018279 3300032126 Bacteria 4229
305 Ga0316583_10050317 3300032133 Unclassified 1467
306 Ga0373952_0041826 3300035092 Bacteria 1062
307 Ga0373947_1081224 3300035725 Unclassified 547
308 Ga0373937_0543652 3300036401 Bacteria 1103
309 Ga0395898_0609336 3300037466 Viruses 1035
310 Ga0395901_0578431 3300038443 Bacteria 1135
311 Ga0439465_0418462 3300041413 Unclassified 511
312 Ga0451800_0918433 3300041459 Bacteria 1020
313 Ga0451833_0294531 3300041491 Archaea 939
314 Ga0451845_0549168 3300041501 Bacteria 824
315 Ga0451851_0283305 3300041507 Bacteria 822
316 Ga0451855_2021748 3300041511 Bacteria 937
317 Ga0451853_0174659 3300041512 Unclassified 849
318 Ga0451853_1579347 3300041512 Unclassified 1071
319 Ga0451853_2997398 3300041512 Bacteria 1588
320 Ga0439441_055993 3300042001 Unclassified 821
321 Ga0451577_0025844 3300042876 Bacteria 5324
322 Ga0495603_0318357 3300046455 Bacteria 893
323 Ga0495629_0131863 3300046459 Bacteria 1741
324 Ga0495641_0222538 3300046461 Unclassified 847
325 Ga0495641_0243062 3300046461 Unclassified 809
326 Ga0495651_0049756 3300046462 Bacteria 3235
327 Ga0495653_0143339 3300046463 Bacteria 1678
328 Ga0495664_0451730 3300046477 Unclassified 769
329 Ga0495584_0330875 3300046491 Unclassified 774
330 Ga0495584_0436752 3300046491 Bacteria 666
331 Ga0495596_0275125 3300046500 Bacteria 654
332 Ga0495628_0376785 3300046516 Bacteria 1040
333 Ga0495630_0162075 3300046517 Bacteria 1703
334 Ga0495644_0154488 3300046523 Bacteria 879
335 Ga0495640_0326625 3300046533 Unclassified 949
336 Ga0495586_0086870 3300046535 Bacteria 1724
337 Ga0495587_0181132 3300046536 Bacteria 1195
338 Ga0495587_0277653 3300046536 Bacteria 939
339 Ga0495609_0284515 3300046538 Bacteria 676
340 Ga0495667_0259079 3300046559 Unclassified 1106
341 Ga0495656_0217528 3300046615 Unclassified 954
342 Ga0495634_0350487 3300046642 Bacteria 884
343 Ga0495634_0595435 3300046642 Unclassified 642
344 Ga0495635_0896505 3300046663 Bacteria 568
345 Ga0495659_0171456 3300046664 Unclassified 880
346 Ga0495657_0352105 3300046675 Unclassified 871
347 Ga0495599_0108157 3300046678 Bacteria 1733
348 Ga0495623_0150866 3300046679 Archaea 1374
349 Ga0495613_0197724 3300046689 Bacteria 1419
350 Ga0495604_0604587 3300047317 Bacteria 703
351 Ga0495674_0421373 3300047319 Unclassified 1075
352 Ga0495680_0193468 3300047322 Bacteria 1462
353 Ga0495675_0724368 3300047444 Unclassified 555
354 Ga0495684_0403673 3300047471 Bacteria 959
355 Ga0495593_0068892 3300047673 Bacteria 1841
356 Ga0495602_0055407 3300048088 Bacteria 3492
357 Ga0495602_0378666 3300048088 Bacteria 1014
358 Ga0496100_0269539 3300048903 Bacteria 1265
359 Ga0496102_0154153 3300048905 Bacteria 2159
360 Ga0496102_0212294 3300048905 Bacteria 1825
361 Ga0496102_0236081 3300048905 Bacteria 1724
362 Ga0496102_0661845 3300048905 Bacteria 967
363 Ga0496103_0020044 3300048906 Bacteria 4015
364 Ga0496103_0055185 3300048906 Bacteria 2464
365 Ga0496103_0215075 3300048906 Bacteria 1236
366 Ga0496103_0629404 3300048906 Unclassified 682
367 Ga0496103_1039317 3300048906 Unclassified 509
368 Ga0496104_0003954 3300048907 Bacteria 12835
369 Ga0496104_0211988 3300048907 Bacteria 1849
370 Ga0496104_0569842 3300048907 Bacteria 1043
371 Ga0496104_0577489 3300048907 Bacteria 1035
372 Ga0496105_0006660 3300048908 Bacteria 8893
373 Ga0496105_0163000 3300048908 Bacteria 1830
374 Ga0496105_0381234 3300048908 Unclassified 1122
375 Ga0496105_0523270 3300048908 Bacteria 929
376 Ga0496106_0023810 3300048909 Bacteria 4551
377 Ga0496106_0046832 3300048909 Bacteria 3252
378 Ga0496106_0394301 3300048909 Bacteria 1112
379 Ga0496107_0097325 3300048910 Bacteria 2154
380 Ga0496107_0225578 3300048910 Bacteria 1394
381 Ga0496107_0264728 3300048910 Unclassified 1279
382 Ga0496108_0014114 3300048911 Bacteria 6516
383 Ga0496108_0027207 3300048911 Bacteria 4720
384 Ga0496108_1245822 3300048911 Bacteria 627
385 Ga0496109_0004962 3300048912 Bacteria 11115
386 Ga0496109_0005482 3300048912 Bacteria 10617
387 Ga0496109_0058301 3300048912 Bacteria 3527
388 Ga0496109_0130587 3300048912 Bacteria 2344
389 Ga0496109_1001023 3300048912 Bacteria 773
390 Ga0496110_0031586 3300048913 Bacteria 4570
391 Ga0496110_0274011 3300048913 Bacteria 1536
392 Ga0496110_0304527 3300048913 Bacteria 1451
393 Ga0496111_0019483 3300048914 Bacteria 4713
394 Ga0496111_0042776 3300048914 Bacteria 3253
395 Ga0496112_0059381 3300048915 Bacteria 3768
396 Ga0496112_0164473 3300048915 Bacteria 2185
397 Ga0496112_0641786 3300048915 Bacteria 992
398 Ga0496113_0006076 3300048916 Bacteria 7613
399 Ga0496113_0008015 3300048916 Bacteria 6850
400 Ga0496113_0012411 3300048916 Bacteria 5726
401 Ga0496113_0158970 3300048916 Bacteria 1786
402 Ga0496114_0020078 3300048917 Bacteria 5420
403 Ga0496114_0200961 3300048917 Bacteria 1746
404 Ga0496114_0278264 3300048917 Bacteria 1475
405 Ga0501031_0084630 3300049568 Bacteria 2067
406 Ga0501031_0391395 3300049568 Bacteria 899
407 Ga0501031_0562954 3300049568 Unclassified 734
408 Ga0501036_0097338 3300049572 Bacteria 2487
409 Ga0501037_1130119 3300049573 Unclassified 507
410 Ga0501038_0680059 3300049574 Bacteria 773
411 Ga0501039_0175276 3300049575 Bacteria 1686
412 Ga0501040_0049165 3300049576 Bacteria 2883
413 Ga0501040_0228327 3300049576 Bacteria 1325
414 Ga0501040_0650874 3300049576 Bacteria 762
415 Ga0501042_0140753 3300049578 Bacteria 1740
416 Ga0501042_0187721 3300049578 Bacteria 1491
417 Ga0501042_0434921 3300049578 Bacteria 951
418 Ga0501042_0837108 3300049578 Bacteria 670
419 Ga0501046_0175350 3300049580 Bacteria 1606
420 Ga0501046_0825686 3300049580 Bacteria 649
421 Ga0501048_0049921 3300049582 Bacteria 2981
422 Ga0501048_0086116 3300049582 Unclassified 2216
423 Ga0501067_0019084 3300049583 Bacteria 3795
424 Ga0501067_0277007 3300049583 Unclassified 934
425 Ga0501068_0035767 3300049584 Bacteria 2966
426 Ga0501068_0051391 3300049584 Unclassified 2493
427 Ga0501068_0133928 3300049584 Unclassified 1551
428 Ga0501068_0200168 3300049584 Bacteria 1267
429 Ga0501069_0050333 3300049585 Bacteria 2316
430 Ga0501069_0132498 3300049585 Bacteria 1428
431 Ga0501069_0715990 3300049585 Bacteria 604
432 Ga0501070_0759417 3300049586 Bacteria 764
433 Ga0501070_0807480 3300049586 Unclassified 736
434 Ga0501071_0399360 3300049587 Bacteria 1049
435 Ga0501071_1122019 3300049587 Bacteria 607
436 Ga0501072_0558797 3300049588 Unclassified 903
437 Ga0501072_0606585 3300049588 Bacteria 863
438 Ga0501072_0903000 3300049588 Bacteria 690
439 Ga0501073_0803172 3300049589 Unclassified 648
440 Ga0501073_0933987 3300049589 Bacteria 597
441 Ga0501074_0052873 3300049590 Bacteria 2931
442 Ga0501075_0024061 3300049591 Bacteria 4459
443 Ga0501075_0080111 3300049591 Bacteria 2472
444 Ga0501075_0537800 3300049591 Bacteria 892
445 Ga0501076_0159626 3300049592 Bacteria 1836
446 Ga0501077_0089974 3300049593 Bacteria 1945
447 Ga0501077_0102968 3300049593 Bacteria 1809
448 Ga0501077_0332662 3300049593 Bacteria 969
449 Ga0501077_0351770 3300049593 Bacteria 940
450 Ga0501077_0450063 3300049593 Unclassified 825
451 Ga0501079_0743165 3300049741 Bacteria 772
452 Ga0501080_0769713 3300049742 Bacteria 846
453 Ga0501081_0015916 3300049743 Bacteria 4966
454 Ga0501081_0160440 3300049743 Bacteria 1620
455 Ga0501081_0708734 3300049743 Unclassified 756
456 Ga0501083_0355124 3300049744 Unclassified 953
457 Ga0501083_0362332 3300049744 Bacteria 943
458 Ga0501083_0533536 3300049744 Unclassified 764
459 Ga0501035_0148672 3300049822 Unclassified 2034
460 Ga0501045_0020293 3300049824 Bacteria 4746
461 Ga0501045_0218190 3300049824 Bacteria 1420
462 Ga0501045_0416484 3300049824 Bacteria 1000
463 Ga0501045_0602443 3300049824 Bacteria 813
464 Ga0501045_0820797 3300049824 Bacteria 684
465 nmdc:mga05p37_59417_c1 3300050507 Bacteria 4708
466 nmdc:mga05p37_820869_c1 3300050507 Unclassified 1014
467 nmdc:mga05p37_851_c1 3300050507 Bacteria 34350
468 nmdc:mga09592_213060_c1 3300050508 Bacteria 1674
469 nmdc:mga06r32_72377_c1 3300050510 Bacteria 3337
470 nmdc:mga08y16_111064_c1 3300050511 Bacteria 2854
471 nmdc:mga08y16_1208531_c1 3300050511 Bacteria 726
472 nmdc:mga08y16_1514816_c1 3300050511 Unclassified 631
473 nmdc:mga08y16_1562872_c1 3300050511 Bacteria 618
474 nmdc:mga08y16_652172_c1 3300050511 Bacteria 1057
475 nmdc:mga0n895_31553_c1 3300050512 Bacteria 5074
476 nmdc:mga0n895_438769_c1 3300050512 Bacteria 1319
477 nmdc:mga0n895_443459_c1 3300050512 Bacteria 1311
478 nmdc:mga0n895_85069_c1 3300050512 Bacteria 3156
479 nmdc:mga0n895_935149_c1 3300050512 Bacteria 851
480 nmdc:mga0rr50_57956_c1 3300050513 Archaea 2900
481 nmdc:mga08x19_726238_c1 3300050514 Bacteria 705
482 nmdc:mga0a205_245529_c1 3300050515 Unclassified 1671
483 nmdc:mga0a205_257241_c1 3300050515 Bacteria 1624
484 nmdc:mga0a205_454183_c1 3300050515 Bacteria 1141
485 nmdc:mga0a205_535154_c1 3300050515 Bacteria 1027
486 Ga0495601_0420666 3300053077 Bacteria 865
487 Ga0495601_0499323 3300053077 Bacteria 785
488 Ga0495612_0003231 3300053078 Bacteria 6758
489 Ga0495595_0167212 3300053084 Unclassified 1087
490 Ga0495619_0058014 3300053085 Bacteria 2569
491 Ga0495619_0267388 3300053085 Bacteria 1185
492 Ga0501084_0024172 3300054114 Bacteria 5068
493 Ga0501084_0153404 3300054114 Bacteria 1942
494 Ga0501084_0219820 3300054114 Bacteria 1603
495 Ga0501084_0398700 3300054114 Unclassified 1163
496 Ga0501082_0037703 3300060353 Bacteria 4168
497 Ga0501082_0163208 3300060353 Bacteria 1936
498 Ga0501082_1579064 3300060353 Bacteria 573
499 Ga0530510_0008218 3300061734 Bacteria 7279
500 Ga0530510_0072556 3300061734 Bacteria 2499
501 Ga0530510_0355544 3300061734 Unclassified 1100
502 Ga0530510_0407559 3300061734 Bacteria 1025
503 Ga0530510_1168114 3300061734 Unclassified 590
504 Ga0451847_0001261
505 JGI24746J21847_1043826
506 JGI24743J22301_10111179
507 rootH1_10195880
508 Ga0070683_100196702
509 Ga0070683_100589452
510 Ga0070683_101359271
511 Ga0070690_100012801
512 Ga0070670_100027412
513 Ga0068869_100179339
514 Ga0068869_100942460
515 Ga0068869_101909395
516 Ga0070682_100012307
517 Ga0068868_100041676
518 Ga0068868_100320312
519 Ga0068868_100471610
520 Ga0068868_101249795
521 Ga0068868_102060337
522 Ga0070689_100004080
523 Ga0070689_100657700
524 Ga0070661_100101245
525 Ga0070661_100780564
526 Ga0070661_101161821
527 Ga0070692_10007184
528 Ga0070669_100098704
529 Ga0070669_100810202
530 Ga0070675_100004579
531 Ga0070675_100057125
532 Ga0070675_100167227
533 Ga0070675_100455951
534 Ga0070674_100028591
535 Ga0070674_100752011
536 Ga0070674_101603675
537 Ga0070674_101786478
538 Ga0070673_100009835
539 Ga0070673_100892258
540 Ga0070673_101083968
541 Ga0070688_100009340
542 Ga0070688_100219826
543 Ga0070659_100075060
544 Ga0070701_10006207
545 Ga0070705_100060774
546 Ga0070705_100076956
547 Ga0070705_100081954
548 Ga0070705_100152430
549 Ga0070705_100480455
550 Ga0070705_100718054
551 Ga0070705_101313977
552 Ga0070700_100002416
553 Ga0070700_100035518
554 Ga0070700_101344193
555 Ga0070694_100087312
556 Ga0070678_100037130
557 Ga0070678_100316635
558 Ga0070678_100677210
559 Ga0070662_100011301
560 Ga0070662_100766124
561 Ga0070662_101636384
562 Ga0070681_10263864
563 Ga0070681_10280801
564 Ga0068867_100013600
565 Ga0068867_100670468
566 Ga0070707_100011078
567 Ga0070698_100603946
568 Ga0070699_100012035
569 Ga0070679_100122089
570 Ga0070697_100269772
571 Ga0068853_100077859
572 Ga0070672_100058752
573 Ga0070672_101463246
574 Ga0070686_100155030
575 Ga0070686_100237715
576 Ga0070686_100237740
577 Ga0070686_100835951
578 Ga0070695_100033741
579 Ga0070695_101108597
580 Ga0070696_100005510
581 Ga0070696_100020350
582 Ga0070696_100027383
583 Ga0070696_101274955
584 Ga0070693_100009095
585 Ga0070704_100193467
586 Ga0070704_100220547
587 Ga0070704_100264392
588 Ga0068855_100657612
589 Ga0068855_101009284
590 Ga0068857_100740691
591 Ga0068854_100154660
592 Ga0070702_100006121
593 Ga0070702_100914100
594 Ga0068852_100065153
595 Ga0068859_100050200
596 Ga0068859_100139377
597 Ga0068864_100019060
598 Ga0068864_100537127
599 Ga0068864_100613400
600 Ga0068864_101069413
601 Ga0068866_10665846
602 Ga0068861_100099114
603 Ga0068851_10654975
604 Ga0068870_10553541
605 Ga0068858_100166716
606 Ga0068858_100296491
607 Ga0068860_100008502
608 Ga0081455_10098050
609 Ga0081455_10529372
610 Ga0081538_10121655
611 Ga0075365_10144151
612 Ga0075432_10111233
613 Ga0097621_100082185
614 Ga0097621_100208293
615 Ga0068871_100480103
616 Ga0075428_100001431
617 Ga0075428_100249444
618 Ga0075431_100081686
619 Ga0075431_100983652
620 Ga0075433_10222176
621 Ga0075433_10308904
622 Ga0075433_10453131
623 Ga0075433_10747190
624 Ga0075434_100034478
625 Ga0075434_100366313
626 Ga0075429_100173823
627 Ga0068865_100002642
628 Ga0068865_101183977
629 Ga0075436_100932427
630 Ga0097620_100050201
631 Ga0097620_100139373
632 Ga0075435_100069177
633 Ga0111539_10023130
634 Ga0111539_10158759
635 Ga0111539_10190534
636 Ga0111539_11182813
637 Ga0111539_11411872
638 Ga0111539_12066095
639 Ga0105245_10017767
640 Ga0105245_10026928
641 Ga0105245_10428897
642 Ga0105245_11198964
643 Ga0105245_12370590
644 Ga0105247_10200560
645 Ga0114129_10001927
646 Ga0114129_10116850
647 Ga0114129_10352028
648 Ga0105243_10066945
649 Ga0105243_10324809
650 Ga0105243_10709663
651 Ga0105243_11448386
652 Ga0105243_12206166
653 Ga0105241_10630415
654 Ga0105241_11927413
655 Ga0105242_10282108
656 Ga0105242_10959452
657 Ga0105242_11549911
658 Ga0105248_10244537
659 Ga0105238_10075788
660 Ga0105249_10003799
661 Ga0105249_10558272
662 Ga0105249_10715233
663 Ga0105249_11202522
664 Ga0105249_11241841
665 Ga0105239_10008935
666 Ga0105239_10734799
667 Ga0105239_10901926
668 Ga0105246_10449286
669 Ga0105246_11378271
670 Ga0105246_12592336
671 Ga0157371_11169924
672 Ga0157374_10497556
673 Ga0157374_10518595
674 Ga0157374_11292733
675 Ga0157378_10007754
676 Ga0157378_10420878
677 Ga0163162_10027318
678 Ga0163162_11524794
679 Ga0157375_10027384
680 Ga0157375_11042767
681 Ga0163163_10328666
682 Ga0163163_11016012
683 Ga0163163_11119734
684 Ga0163163_11371649
685 Ga0163163_11803133
686 Ga0157380_10058302
687 Ga0157380_10077846
688 Ga0157380_11667023
689 Ga0182008_10094609
690 Ga0157377_10008485
691 Ga0157379_10079611
692 Ga0157376_10637728
693 Ga0157376_10656851
694 Ga0157376_11025961
695 Ga0163161_10005304
696 Ga0163161_10132744
697 Ga0163161_11714400
698 Ga0207656_10231977
699 Ga0207642_10382206
700 Ga0207642_10582007
701 Ga0207688_10003628
702 Ga0207688_10754012
703 Ga0207647_10356828
704 Ga0207684_10130653
705 Ga0207684_10448783
706 Ga0207684_10690687
707 Ga0207654_10481183
708 Ga0207707_10547208
709 Ga0207707_10784647
710 Ga0207707_11029407
711 Ga0207662_10001585
712 Ga0207662_10312020
713 Ga0207657_10985533
714 Ga0207649_10109572
715 Ga0207649_10343572
716 Ga0207646_11251287
717 Ga0207694_10047133
718 Ga0207650_10319187
719 Ga0207650_11100738
720 Ga0207659_10020560
721 Ga0207659_10293059
722 Ga0207659_10305575
723 Ga0207659_10407639
724 Ga0207687_10029420
725 Ga0207687_10298090
726 Ga0207700_10792211
727 Ga0207690_10077830
728 Ga0207706_10005959
729 Ga0207706_10275316
730 Ga0207706_10399058
731 Ga0207686_10127265
732 Ga0207709_10088532
733 Ga0207670_10039467
734 Ga0207669_10036875
735 Ga0207669_10071046
736 Ga0207669_10994081
737 Ga0207704_10595569
738 Ga0207691_10037929
739 Ga0207691_10229459
740 Ga0207691_10965068
741 Ga0207711_10108898
742 Ga0207711_11135824
743 Ga0207689_10069826
744 Ga0207689_10583551
745 Ga0207689_10682565
746 Ga0207689_10913139
747 Ga0207661_10680082
748 Ga0207661_11360321
749 Ga0207679_10072833
750 Ga0207679_10432629
751 Ga0207679_10442308
752 Ga0207679_10852885
753 Ga0207667_10409244
754 Ga0207651_10717962
755 Ga0207651_10876816
756 Ga0207712_10008577
757 Ga0207668_10385523
758 Ga0207640_10051540
759 Ga0207677_10032075
760 Ga0207677_10493311
761 Ga0207639_11605507
762 Ga0207678_10009395
763 Ga0207708_10009990
764 Ga0207708_10318826
765 Ga0207648_10006662
766 Ga0207648_10673680
767 Ga0207648_10988491
768 Ga0207676_10041874
769 Ga0207676_10564889
770 Ga0207676_11093508
771 Ga0207674_10014503
772 Ga0207674_10436964
773 Ga0207675_100125522
774 Ga0207675_100428217
775 Ga0207675_101003713
776 Ga0207675_101035587
777 Ga0207683_10024564
778 Ga0207683_10033577
779 Ga0207683_10330397
780 Ga0207683_10344811
781 Ga0209969_1081075
782 Ga0209974_10014463
783 Ga0207428_10096388
784 Ga0207428_10866336
785 Ga0268264_10013364
786 Ga0265334_10069256
787 Ga0265318_10017973
788 Ga0265318_10083572
789 Ga0265318_10139076
790 Ga0265328_10303238
791 Ga0265320_10070048
792 Ga0265325_10151401
793 Ga0265329_10048091
794 Ga0265339_10047606
795 Ga0265313_10010958
796 Ga0265314_10011353
797 Ga0265342_10254182
798 Ga0307405_10877163
799 Ga0307413_11002784
800 Ga0307406_10026839
801 Ga0307407_10285625
802 Ga0307412_11768233
803 Ga0307409_101168359
804 Ga0307416_100032238
805 Ga0307416_101163646
806 Ga0307411_10796609
807 Ga0307415_100018279
808 Ga0316583_10050317
809 Ga0373952_0041826
810 Ga0373947_1081224
811 Ga0373937_0543652
812 Ga0395898_0609336
813 Ga0395901_0578431
814 Ga0439465_0418462
815 Ga0451800_0918433
816 Ga0451833_0294531
817 Ga0451845_0549168
818 Ga0451851_0283305
819 Ga0451855_2021748
820 Ga0451853_0174659
821 Ga0451853_1579347
822 Ga0451853_2997398
823 Ga0439441_055993
824 Ga0451577_0025844
825 Ga0495603_0318357
826 Ga0495629_0131863
827 Ga0495641_0222538
828 Ga0495641_0243062
829 Ga0495651_0049756
830 Ga0495653_0143339
831 Ga0495664_0451730
832 Ga0495584_0330875
833 Ga0495584_0436752
834 Ga0495596_0275125
835 Ga0495628_0376785
836 Ga0495630_0162075
837 Ga0495644_0154488
838 Ga0495640_0326625
839 Ga0495586_0086870
840 Ga0495587_0181132
841 Ga0495587_0277653
842 Ga0495609_0284515
843 Ga0495667_0259079
844 Ga0495656_0217528
845 Ga0495634_0350487
846 Ga0495634_0595435
847 Ga0495635_0896505
848 Ga0495659_0171456
849 Ga0495657_0352105
850 Ga0495599_0108157
851 Ga0495623_0150866
852 Ga0495613_0197724
853 Ga0495604_0604587
854 Ga0495674_0421373
855 Ga0495680_0193468
856 Ga0495675_0724368
857 Ga0495684_0403673
858 Ga0495593_0068892
859 Ga0495602_0055407
860 Ga0495602_0378666
861 Ga0496100_0269539
862 Ga0496102_0154153
863 Ga0496102_0212294
864 Ga0496102_0236081
865 Ga0496102_0661845
866 Ga0496103_0020044
867 Ga0496103_0055185
868 Ga0496103_0215075
869 Ga0496103_0629404
870 Ga0496103_1039317
871 Ga0496104_0003954
872 Ga0496104_0211988
873 Ga0496104_0569842
874 Ga0496104_0577489
875 Ga0496105_0006660
876 Ga0496105_0163000
877 Ga0496105_0381234
878 Ga0496105_0523270
879 Ga0496106_0023810
880 Ga0496106_0046832
881 Ga0496106_0394301
882 Ga0496107_0097325
883 Ga0496107_0225578
884 Ga0496107_0264728
885 Ga0496108_0014114
886 Ga0496108_0027207
887 Ga0496108_1245822
888 Ga0496109_0004962
889 Ga0496109_0005482
890 Ga0496109_0058301
891 Ga0496109_0130587
892 Ga0496109_1001023
893 Ga0496110_0031586
894 Ga0496110_0274011
895 Ga0496110_0304527
896 Ga0496111_0019483
897 Ga0496111_0042776
898 Ga0496112_0059381
899 Ga0496112_0164473
900 Ga0496112_0641786
901 Ga0496113_0006076
902 Ga0496113_0008015
903 Ga0496113_0012411
904 Ga0496113_0158970
905 Ga0496114_0020078
906 Ga0496114_0200961
907 Ga0496114_0278264
908 Ga0501031_0084630
909 Ga0501031_0391395
910 Ga0501031_0562954
911 Ga0501036_0097338
912 Ga0501037_1130119
913 Ga0501038_0680059
914 Ga0501039_0175276
915 Ga0501040_0049165
916 Ga0501040_0228327
917 Ga0501040_0650874
918 Ga0501042_0140753
919 Ga0501042_0187721
920 Ga0501042_0434921
921 Ga0501042_0837108
922 Ga0501046_0175350
923 Ga0501046_0825686
924 Ga0501048_0049921
925 Ga0501048_0086116
926 Ga0501067_0019084
927 Ga0501067_0277007
928 Ga0501068_0035767
929 Ga0501068_0051391
930 Ga0501068_0133928
931 Ga0501068_0200168
932 Ga0501069_0050333
933 Ga0501069_0132498
934 Ga0501069_0715990
935 Ga0501070_0759417
936 Ga0501070_0807480
937 Ga0501071_0399360
938 Ga0501071_1122019
939 Ga0501072_0558797
940 Ga0501072_0606585
941 Ga0501072_0903000
942 Ga0501073_0803172
943 Ga0501073_0933987
944 Ga0501074_0052873
945 Ga0501075_0024061
946 Ga0501075_0080111
947 Ga0501075_0537800
948 Ga0501076_0159626
949 Ga0501077_0089974
950 Ga0501077_0102968
951 Ga0501077_0332662
952 Ga0501077_0351770
953 Ga0501077_0450063
954 Ga0501079_0743165
955 Ga0501080_0769713
956 Ga0501081_0015916
957 Ga0501081_0160440
958 Ga0501081_0708734
959 Ga0501083_0355124
960 Ga0501083_0362332
961 Ga0501083_0533536
962 Ga0501035_0148672
963 Ga0501045_0020293
964 Ga0501045_0218190
965 Ga0501045_0416484
966 Ga0501045_0602443
967 Ga0501045_0820797
968 nmdc:mga05p37_59417_c1
969 nmdc:mga05p37_820869_c1
970 nmdc:mga05p37_851_c1
971 nmdc:mga09592_213060_c1
972 nmdc:mga06r32_72377_c1
973 nmdc:mga08y16_111064_c1
974 nmdc:mga08y16_1208531_c1
975 nmdc:mga08y16_1514816_c1
976 nmdc:mga08y16_1562872_c1
977 nmdc:mga08y16_652172_c1
978 nmdc:mga0n895_31553_c1
979 nmdc:mga0n895_438769_c1
980 nmdc:mga0n895_443459_c1
981 nmdc:mga0n895_85069_c1
982 nmdc:mga0n895_935149_c1
983 nmdc:mga0rr50_57956_c1
984 nmdc:mga08x19_726238_c1
985 nmdc:mga0a205_245529_c1
986 nmdc:mga0a205_257241_c1
987 nmdc:mga0a205_454183_c1
988 nmdc:mga0a205_535154_c1
989 Ga0495601_0420666
990 Ga0495601_0499323
991 Ga0495612_0003231
992 Ga0495595_0167212
993 Ga0495619_0058014
994 Ga0495619_0267388
995 Ga0501084_0024172
996 Ga0501084_0153404
997 Ga0501084_0219820
998 Ga0501084_0398700
999 Ga0501082_0037703
1000 Ga0501082_0163208
1001 Ga0501082_1579064
1002 Ga0530510_0008218
1003 Ga0530510_0072556
1004 Ga0530510_0355544
1005 Ga0530510_0407559
1006 Ga0530510_1168114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06240

COXG

Carbon monoxide dehydrogenase subunit G (CoxG)

39

179

0.99

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

35

179

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ns9-assembly1.cif.gz_B crystal structure of protein ape2225 from aeropyrum pernix k1, pfam coxg 0.9416 1 144
2pcs-assembly1.cif.gz_A crystal structure of conserved protein from geobacillus kaustophilus 0.9245 1 144
2ns9-assembly1.cif.gz_B crystal structure of protein ape2225 from aeropyrum pernix k1, pfam coxg 0.9051 1 144
2pcs-assembly1.cif.gz_A crystal structure of conserved protein from geobacillus kaustophilus 0.9009 1 144
4n0g-assembly1.cif.gz_C crystal structure of pyl13-pp2ca complex 0.7718 1 146
ID Description Score Start End Superfamily
2ns9B01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9416 1 144 3.30.530.20
2pcsA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9245 1 144 3.30.530.20
2ns9B01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.917 1 144 3.30.530.20
2pcsA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9009 1 144 3.30.530.20
af_Q9NA57_32_121_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8254 33 64 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A535PNK5-F1-model_v4 Carbon monoxide dehydrogenase subunit G 0.9942 1 146
AF-A0A536ND07-F1-model_v4 Carbon monoxide dehydrogenase subunit G 0.9921 1 145
AF-A0A521RVC2-F1-model_v4 Carbon monoxide dehydrogenase subunit G 0.9881 1 146
AF-A0A7W1AG99-F1-model_v4 Carbon monoxide dehydrogenase subunit G 0.986 1 147
AF-A0A4P6K387-F1-model_v4 Carbon monoxide dehydrogenase 0.9859 1 147

Map