F456014

General Info

Members Datasets Scaffolds Average Seq Length
503 260 462 392

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10135819|Ga0157370_101358192
Length 426
Sequence MHLSFYFHIKYSFILLRSSNLYIFIDNFAELIMQVFHTKSKVIITCNKRLSPYLQEEVKALNYDIVRDFPTGVELNITLTECIKLNLNLRCASQILYCLKNFSANTPDELYGELSEMPWEELIDFSGYFSVTSNVDNPNITTPLFANLKVKDAIVDRIKAKKGMRPNSGPDANKAVVHLYWKDSEAAIFLDTSGETLAKHGYRKIPGKAPMLEALAASVVMATKWDQKSPFVNPMCGSGTLAIEAALIATNRRPGLFRMNYGFMHIMGYDEQVFFAERRILKDQVIKTAELQIIATDLSEDAVEVSRKNAKTAGVDTLITFEVCDFADTTVPDTGKGVVVFNPEYGERLGVHSKLEATYKRMGDFMKQHCKGYFGYIFTGNPDLAKKIGLKADRKVEFYNGKLDCRMLEYELYDGSRRPDEERPKR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
16 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
17 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
18 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
19 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
20 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
21 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
22 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
23 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
24 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
25 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
26 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
27 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
28 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
29 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
30 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
31 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
32 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
33 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
34 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
35 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
36 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
37 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
38 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
39 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
40 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
41 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
42 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
43 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
44 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
49 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
177 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
243 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
244 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 0
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.94
Nodule 0
Rhizoplane 0.6
Rhizosphere 78.13
Stem 0
Stem Tuber 0
Unclassified 11.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2879104 2162886007 Bacteria 104588
2 SwRhRL2b_contig_346326 2162886007 Bacteria 2294
3 JGI24736J21556_1001881 3300001904 Bacteria 3739
4 JGI24739J22299_10020993 3300001989 Bacteria 2329
5 JGI24739J22299_10034033 3300001989 Bacteria 1738
6 JGI24737J22298_10000303 3300001990 Bacteria 16452
7 JGI24737J22298_10006616 3300001990 Bacteria 3948
8 JGI24735J21928_10000007 3300002067 Bacteria 333510
9 JGI24735J21928_10011780 3300002067 Bacteria 2769
10 JGI25162J39368_1000008 3300002737 Bacteria 397212
11 JGI25162J39368_1005851 3300002737 Bacteria 2273
12 JGI25164J39214_1002882 3300002772 Bacteria 2380
13 JGI25152J39213_1000043 3300002773 Bacteria 87508
14 JGI25150J39212_1000023 3300002774 Bacteria 130663
15 JGI25151J46595_10000082 3300003187 Bacteria 130832
16 JGI25165J46597_1001633 3300003214 Bacteria 10496
17 JGI25153J46596_10000060 3300003215 Bacteria 131744
18 rootH1_10129909 3300003316 Bacteria 7521
19 rootH2_10003159 3300003320 Bacteria 36032
20 rootH2_10003246 3300003320 Bacteria 168239
21 rootH2_10050267 3300003320 Bacteria 5544
22 rootH2_10063809 3300003320 Bacteria 5040
23 rootH2_10082426 3300003320 Bacteria 9566
24 rootL2_10006866 3300003322 Bacteria 7782
25 rootL2_10149567 3300003322 Bacteria 3571
26 rootH1_10001642 3300003323 Bacteria 53790
27 rootH1_10002599 3300003316 Bacteria 7117
28 rootH1_10002599 3300003323 Bacteria 52591
29 rootH1_10003164 3300003323 Bacteria 93415
30 rootH1_10003165 3300003323 Bacteria 7505
31 rootH1_10010242 3300003316 Bacteria 16207
32 rootH1_10010242 3300003323 Bacteria 4246
33 rootH1_10211847 3300003323 Bacteria 2902
34 Ga0055536_1000002 3300003781 Bacteria 605605
35 Ga0055530_10000739 3300003791 Bacteria 27214
36 Ga0055531_10000091 3300003794 Bacteria 99363
37 Ga0055531_10000388 3300003794 Bacteria 42434
38 Ga0065165_1000746 3300005262 Bacteria 44688
39 Ga0065714_10002923 3300005288 Bacteria 9650
40 Ga0065714_10004174 3300005288 Bacteria 5317
41 Ga0065714_10015491 3300005288 Bacteria 2000
42 Ga0065714_10064591 3300005288 Bacteria 30978
43 Ga0065714_10073623 3300005288 Bacteria 3157
44 Ga0065704_10000464 3300005289 Bacteria 35359
45 Ga0065704_10070133 3300005289 Bacteria 1266035
46 Ga0065704_10102766 3300005289 Bacteria 2194
47 Ga0070658_10000008 3300005327 Bacteria 319912
48 Ga0070658_10026576 3300005327 Bacteria 4644
49 Ga0070658_10074289 3300005327 Bacteria 2788
50 Ga0070676_10003387 3300005328 Bacteria 8302
51 Ga0070676_10137394 3300005328 Bacteria 1552
52 Ga0070690_100036495 3300005330 Bacteria 3089
53 Ga0068869_100167639 3300005334 Bacteria 1714
54 Ga0070680_100001722 3300005336 Bacteria 16058
55 Ga0070680_100059251 3300005336 Bacteria 3131
56 Ga0070682_100000005 3300005337 Bacteria 386439
57 Ga0068868_100094127 3300005338 Bacteria 2417
58 Ga0070660_100000216 3300005339 Bacteria 38364
59 Ga0070660_100014795 3300005339 Bacteria 5630
60 Ga0070660_100098457 3300005339 Bacteria 2315
61 Ga0070660_100109951 3300005339 Unclassified 2192
62 Ga0070675_100224115 3300005354 Bacteria 1638
63 Ga0070675_100266162 3300005354 Bacteria 1503
64 Ga0070671_100009686 3300005355 Bacteria 7740
65 Ga0070671_100187980 3300005355 Bacteria 1750
66 Ga0070674_100207364 3300005356 Bacteria 1517
67 Ga0070673_100065994 3300005364 Bacteria 2889
68 Ga0070659_100000610 3300005366 Bacteria 26229
69 Ga0070659_100002836 3300005366 Bacteria 12337
70 Ga0070663_100004973 3300005455 Bacteria 7848
71 Ga0070678_100041132 3300005456 Bacteria 3275
72 Ga0070662_100000033 3300005457 Bacteria 78191
73 Ga0070681_10027865 3300005458 Bacteria 5680
74 Ga0068867_100065585 3300005459 Bacteria 2702
75 Ga0068867_100075072 3300005459 Bacteria 2535
76 Ga0070698_100006230 3300005471 Bacteria 12981
77 Ga0070679_100000442 3300005530 Bacteria 35233
78 Ga0070679_100018504 3300005530 Bacteria 6762
79 Ga0070679_100043524 3300005530 Bacteria 4472
80 Ga0070679_100061202 3300005530 Bacteria 3752
81 Ga0068853_100027661 3300005539 Bacteria 4765
82 Ga0068853_100038390 3300005539 Bacteria 4079
83 Ga0068853_100039291 3300005539 Bacteria 4036
84 Ga0070665_100000017 3300005548 Bacteria 448013
85 Ga0070665_100002768 3300005548 Bacteria 19006
86 Ga0070665_100324083 3300005548 Bacteria 1545
87 Ga0068855_100000021 3300005563 Bacteria 195708
88 Ga0068855_100000967 3300005563 Bacteria 35748
89 Ga0068855_100010184 3300005563 Bacteria 11331
90 Ga0068855_100077251 3300005563 Bacteria 3863
91 Ga0068855_100147796 3300005563 Bacteria 2674
92 Ga0068855_100246752 3300005563 Bacteria 1993
93 Ga0068855_100372053 3300005563 Bacteria 1570
94 Ga0068854_100147775 3300005578 Bacteria 1810
95 Ga0068856_100004360 3300005614 Bacteria 14098
96 Ga0068856_100004648 3300005614 Bacteria 13637
97 Ga0068856_100004729 3300005614 Bacteria 13519
98 Ga0068856_100269922 3300005614 Bacteria 1717
99 Ga0068852_100002150 3300005616 Bacteria 13529
100 Ga0068852_100003482 3300005616 Bacteria 11007
101 Ga0068852_100031479 3300005616 Bacteria 4378
102 Ga0068852_100097814 3300005616 Bacteria 2641
103 Ga0068859_100000522 3300005617 Bacteria 38186
104 Ga0068864_100187070 3300005618 Bacteria 1896
105 Ga0068866_10009946 3300005718 Unclassified 4059
106 Ga0068851_10005956 3300005834 Bacteria 5551
107 Ga0068863_100036278 3300005841 Unclassified 4697
108 Ga0068858_100144939 3300005842 Bacteria 2230
109 Ga0068860_100011729 3300005843 Bacteria 8637
110 Ga0068862_100008833 3300005844 Bacteria 8343
111 Ga0075366_10000019 3300006195 Bacteria 59333
112 Ga0075366_10004640 3300006195 Bacteria 7382
113 Ga0075366_10071637 3300006195 Bacteria 2065
114 Ga0075366_10094011 3300006195 Bacteria 1797
115 Ga0097621_100000478 3300006237 Bacteria 28105
116 Ga0068871_100000353 3300006358 Bacteria 31920
117 Ga0068871_100003813 3300006358 Bacteria 10392
118 Ga0068865_100000865 3300006881 Bacteria 17150
119 Ga0097620_100000522 3300006931 Bacteria 38186
120 Ga0105244_10021045 3300009036 Bacteria 3615
121 Ga0105240_10000037 3300009093 Bacteria 270462
122 Ga0105240_10000185 3300009093 Bacteria 126364
123 Ga0105240_10003566 3300009093 Bacteria 24139
124 Ga0105240_10014660 3300009093 Bacteria 10696
125 Ga0105240_10212398 3300009093 Bacteria 2260
126 Ga0105240_10324175 3300009093 Bacteria 1755
127 Ga0105245_10214263 3300009098 Bacteria 1855
128 Ga0114129_10004428 3300009147 Bacteria 19824
129 Ga0105243_10000003 3300009148 Bacteria 712931
130 Ga0105241_10000928 3300009174 Bacteria 22189
131 Ga0105241_10060485 3300009174 Bacteria 2914
132 Ga0105241_10089810 3300009174 Bacteria 2422
133 Ga0105241_10242034 3300009174 Bacteria 1526
134 Ga0105241_10279708 3300009174 Bacteria 1425
135 Ga0105242_10125309 3300009176 Bacteria 2210
136 Ga0105237_10000753 3300009545 Bacteria 44372
137 Ga0105237_10000887 3300009545 Bacteria 40325
138 Ga0105237_10002120 3300009545 Bacteria 25043
139 Ga0105237_10003933 3300009545 Bacteria 17402
140 Ga0105237_10017829 3300009545 Bacteria 7360
141 Ga0105237_10112177 3300009545 Bacteria 2719
142 Ga0105238_10015917 3300009551 Bacteria 7608
143 Ga0105239_10000069 3300010375 Bacteria 144493
144 Ga0105239_10000142 3300010375 Bacteria 101628
145 Ga0105239_10000606 3300010375 Bacteria 51062
146 Ga0105239_10000912 3300010375 Bacteria 41956
147 Ga0105239_10001468 3300010375 Bacteria 31351
148 Ga0105239_10008402 3300010375 Bacteria 11757
149 Ga0105239_10062599 3300010375 Bacteria 4084
150 Ga0105239_10081589 3300010375 Bacteria 3560
151 Ga0105239_10090246 3300010375 Bacteria 3381
152 Ga0105239_10094828 3300010375 Bacteria 3296
153 Ga0105239_10146009 3300010375 Bacteria 2638
154 Ga0105239_10201830 3300010375 Bacteria 2228
155 Ga0157373_10000262 3300013100 Bacteria 42799
156 Ga0157373_10000303 3300013100 Bacteria 39933
157 Ga0157373_10002107 3300013100 Bacteria 15059
158 Ga0157373_10022773 3300013100 Bacteria 4544
159 Ga0157373_10030867 3300013100 Bacteria 3856
160 Ga0157373_10046940 3300013100 Bacteria 3081
161 Ga0157371_10000151 3300013102 Bacteria 101401
162 Ga0157371_10000912 3300013102 Bacteria 33281
163 Ga0157371_10002662 3300013102 Bacteria 16888
164 Ga0157371_10012836 3300013102 Bacteria 6381
165 Ga0157371_10026472 3300013102 Bacteria 4215
166 Ga0157371_10027892 3300013102 Bacteria 4092
167 Ga0157371_10040504 3300013102 Bacteria 3327
168 Ga0157371_10044456 3300013102 Bacteria 3162
169 Ga0157371_10044512 3300013102 Bacteria 3160
170 Ga0157371_10067702 3300013102 Bacteria 2527
171 Ga0157371_10079402 3300013102 Bacteria 2324
172 Ga0157370_10012044 3300013104 Bacteria 9002
173 Ga0157370_10012828 3300013104 Bacteria 8664
174 Ga0157370_10015713 3300013104 Bacteria 7687
175 Ga0157370_10065999 3300013104 Bacteria 3423
176 Ga0157370_10086365 3300013104 Unclassified 2947
177 Ga0157370_10086975 3300013104 Bacteria 2936
178 Ga0157370_10135819 3300013104 Bacteria 2292
179 Ga0157370_10172037 3300013104 Bacteria 2013
180 Ga0157370_10231436 3300013104 Bacteria 1710
181 Ga0157370_10238088 3300013104 Bacteria 1684
182 Ga0157370_10306831 3300013104 Bacteria 1465
183 Ga0157370_10330837 3300013104 Bacteria 1405
184 Ga0157369_10000050 3300013105 Bacteria 167294
185 Ga0157369_10000101 3300013105 Bacteria 118683
186 Ga0157369_10017093 3300013105 Bacteria 8151
187 Ga0157369_10366463 3300013105 Unclassified 1496
188 Ga0157374_10000180 3300013296 Bacteria 58547
189 Ga0157374_10007400 3300013296 Bacteria 9365
190 Ga0157374_10008508 3300013296 Bacteria 8778
191 Ga0157374_10072295 3300013296 Bacteria 3254
192 Ga0157374_10080214 3300013296 Bacteria 3094
193 Ga0157374_10183110 3300013296 Bacteria 2047
194 Ga0157378_10004991 3300013297 Bacteria 11640
195 Ga0163162_10000011 3300013306 Bacteria 299877
196 Ga0163162_10000051 3300013306 Bacteria 117695
197 Ga0163162_10000459 3300013306 Bacteria 37749
198 Ga0163162_10010324 3300013306 Bacteria 9077
199 Ga0163162_10047136 3300013306 Bacteria 4320
200 Ga0157372_10000041 3300013307 Bacteria 158494
201 Ga0157372_10000199 3300013307 Bacteria 66101
202 Ga0157372_10001502 3300013307 Bacteria 25355
203 Ga0157372_10002344 3300013307 Bacteria 20484
204 Ga0157372_10022572 3300013307 Bacteria 6810
205 Ga0157372_10056130 3300013307 Bacteria 4401
206 Ga0157372_10076349 3300013307 Bacteria 3783
207 Ga0157372_10088769 3300013307 Bacteria 3511
208 Ga0157372_10119344 3300013307 Bacteria 3027
209 Ga0157372_10205098 3300013307 Unclassified 2284
210 Ga0157375_10005995 3300013308 Bacteria 10599
211 Ga0163163_10218411 3300014325 Bacteria 1955
212 Ga0182008_10000002 3300014497 Bacteria 480216
213 Ga0182008_10000294 3300014497 Bacteria 39204
214 Ga0182008_10000342 3300014497 Bacteria 36331
215 Ga0182008_10048304 3300014497 Bacteria 2113
216 Ga0182006_1000349 3300015261 Bacteria 38806
217 Ga0182006_1000415 3300015261 Bacteria 34242
218 Ga0182006_1000423 3300015261 Bacteria 33847
219 Ga0182006_1001068 3300015261 Bacteria 17627
220 Ga0182006_1001278 3300015261 Bacteria 15510
221 Ga0182007_10000008 3300015262 Bacteria 332953
222 Ga0183373_1002 3300015682 Bacteria 990153
223 Ga0163161_10000152 3300017792 Bacteria 63649
224 Ga0163161_10000984 3300017792 Bacteria 21818
225 Ga0163161_10006795 3300017792 Bacteria 7907
226 Ga0163161_10010597 3300017792 Bacteria 6382
227 Ga0163161_10195656 3300017792 Bacteria 1556
228 Ga0209563_109321 3300025230 Bacteria 1489
229 Ga0207427_100043 3300025231 Bacteria 249595
230 Ga0209437_100030 3300025233 Bacteria 532466
231 Ga0209437_100170 3300025233 Bacteria 142489
232 Ga0207425_1000051 3300025245 Bacteria 166795
233 Ga0209026_1000251 3300025250 Bacteria 67956
234 Ga0209026_1002730 3300025250 Bacteria 6332
235 Ga0209026_1007347 3300025250 Bacteria 2501
236 Ga0209129_1000121 3300025258 Bacteria 135404
237 Ga0209233_1000266 3300025261 Bacteria 76176
238 Ga0209233_1001831 3300025261 Bacteria 8163
239 Ga0209455_1004042 3300025272 Bacteria 4958
240 Ga0209676_1000022 3300025292 Bacteria 605659
241 Ga0209025_1000160 3300025294 Bacteria 166795
242 Ga0209758_1000147 3300025297 Bacteria 166795
243 Ga0209050_1000020 3300025298 Bacteria 605671
244 Ga0209257_1000006 3300025304 Bacteria 1570111
245 Ga0207656_10010171 3300025321 Bacteria 3514
246 Ga0207655_1024142 3300025728 Bacteria 2988
247 Ga0207647_10000103 3300025904 Bacteria 65792
248 Ga0207647_10003496 3300025904 Bacteria 11781
249 Ga0207647_10003947 3300025904 Bacteria 11071
250 Ga0207647_10072867 3300025904 Unclassified 2071
251 Ga0207647_10104567 3300025904 Bacteria 1678
252 Ga0207647_10145326 3300025904 Bacteria 1388
253 Ga0207645_10001062 3300025907 Bacteria 22737
254 Ga0207645_10078939 3300025907 Bacteria 2109
255 Ga0207705_10000026 3300025909 Bacteria 256051
256 Ga0207705_10025319 3300025909 Bacteria 4238
257 Ga0207705_10027902 3300025909 Bacteria 4026
258 Ga0207705_10049005 3300025909 Unclassified 3040
259 Ga0207705_10051262 3300025909 Bacteria 2971
260 Ga0207705_10114769 3300025909 Unclassified 1993
261 Ga0207654_10028784 3300025911 Bacteria 3033
262 Ga0207707_10044246 3300025912 Bacteria 3882
263 Ga0207695_10000092 3300025913 Bacteria 270514
264 Ga0207695_10000117 3300025913 Bacteria 237982
265 Ga0207695_10007355 3300025913 Bacteria 14052
266 Ga0207695_10021013 3300025913 Bacteria 7456
267 Ga0207695_10037954 3300025913 Bacteria 5193
268 Ga0207695_10039928 3300025913 Bacteria 5039
269 Ga0207671_10000466 3300025914 Bacteria 55435
270 Ga0207671_10000831 3300025914 Bacteria 39212
271 Ga0207671_10001916 3300025914 Bacteria 23094
272 Ga0207671_10005252 3300025914 Bacteria 12026
273 Ga0207671_10014272 3300025914 Bacteria 6285
274 Ga0207671_10068781 3300025914 Bacteria 2639
275 Ga0207671_10098226 3300025914 Bacteria 2215
276 Ga0207660_10016385 3300025917 Bacteria 4905
277 Ga0207657_10000852 3300025919 Bacteria 32202
278 Ga0207657_10117635 3300025919 Bacteria 2189
279 Ga0207657_10149359 3300025919 Bacteria 1904
280 Ga0207652_10000101 3300025921 Bacteria 93033
281 Ga0207652_10002817 3300025921 Bacteria 14595
282 Ga0207652_10003845 3300025921 Bacteria 12308
283 Ga0207659_10204207 3300025926 Bacteria 1580
284 Ga0207644_10122079 3300025931 Bacteria 1984
285 Ga0207690_10000123 3300025932 Bacteria 64409
286 Ga0207690_10010431 3300025932 Bacteria 5521
287 Ga0207690_10116192 3300025932 Bacteria 1935
288 Ga0207706_10003806 3300025933 Bacteria 14379
289 Ga0207709_10000008 3300025935 Bacteria 713099
290 Ga0207669_10173242 3300025937 Bacteria 1538
291 Ga0207704_10000685 3300025938 Bacteria 14998
292 Ga0207667_10000014 3300025949 Bacteria 421261
293 Ga0207667_10001021 3300025949 Bacteria 35701
294 Ga0207667_10007350 3300025949 Bacteria 13260
295 Ga0207667_10012651 3300025949 Bacteria 9698
296 Ga0207667_10031546 3300025949 Bacteria 5720
297 Ga0207667_10054129 3300025949 Bacteria 4221
298 Ga0207667_10092422 3300025949 Bacteria 3125
299 Ga0207667_10167139 3300025949 Bacteria 2261
300 Ga0207667_10259321 3300025949 Bacteria 1778
301 Ga0207667_10315449 3300025949 Bacteria 1597
302 Ga0207658_10111145 3300025986 Bacteria 2167
303 Ga0207677_10073521 3300026023 Bacteria 2421
304 Ga0207703_10236877 3300026035 Bacteria 1639
305 Ga0207639_10004859 3300026041 Bacteria 9050
306 Ga0207639_10163602 3300026041 Bacteria 1877
307 Ga0207639_10308689 3300026041 Bacteria 1401
308 Ga0207639_10332218 3300026041 Bacteria 1353
309 Ga0207678_10087416 3300026067 Bacteria 2664
310 Ga0207678_10091096 3300026067 Bacteria 2606
311 Ga0207702_10001665 3300026078 Bacteria 21956
312 Ga0207702_10128312 3300026078 Bacteria 2279
313 Ga0207702_10239894 3300026078 Bacteria 1698
314 Ga0207641_10081379 3300026088 Bacteria 2812
315 Ga0207648_10001664 3300026089 Bacteria 24356
316 Ga0207648_10015165 3300026089 Bacteria 7093
317 Ga0207683_10069845 3300026121 Bacteria 3102
318 Ga0207698_10000907 3300026142 Bacteria 17255
319 Ga0207698_10061118 3300026142 Bacteria 2934
320 Ga0268266_10000037 3300028379 Bacteria 342368
321 Ga0268266_10004391 3300028379 Bacteria 13518
322 Ga0307517_10000212 3300028786 Bacteria 99215
323 Ga0307515_10000010 3300028794 Bacteria 651586
324 Ga0307515_10000077 3300028794 Bacteria 228162
325 Ga0307515_10000345 3300028794 Bacteria 114943
326 Ga0307515_10025102 3300028794 Bacteria 10334
327 Ga0307515_10036772 3300028794 Bacteria 7905
328 Ga0307515_10079899 3300028794 Bacteria 4275
329 Ga0307515_10137271 3300028794 Bacteria 2649
330 Ga0265338_10021504 3300028800 Bacteria 6724
331 Ga0316177_1127916 3300030731 Bacteria 11558
332 Ga0316183_1100732 3300030742 Bacteria 40906
333 Ga0265327_10000239 3300031251 Bacteria 109804
334 Ga0265327_10022871 3300031251 Bacteria 3720
335 Ga0307513_10130749 3300031456 Bacteria 2457
336 Ga0307509_10049196 3300031507 Bacteria 4522
337 Ga0307408_100000389 3300031548 Bacteria 40047
338 Ga0307514_10027561 3300031649 Unclassified 4589
339 Ga0307405_10000017 3300031731 Bacteria 195149
340 Ga0307407_10000002 3300031903 Bacteria 323084
341 Ga0307412_10000050 3300031911 Bacteria 151527
342 Ga0307412_10001795 3300031911 Bacteria 11874
343 Ga0307416_100000005 3300032002 Bacteria 477728
344 Ga0307414_10000293 3300032004 Bacteria 29252
345 Ga0307414_10000357 3300032004 Bacteria 25424
346 Ga0307414_10052017 3300032004 Bacteria 2848
347 Ga0307414_10065772 3300032004 Bacteria 2588
348 Ga0307414_10084347 3300032004 Bacteria 2336
349 Ga0307414_10087961 3300032004 Bacteria 2298
350 Ga0307411_10155168 3300032005 Unclassified 1707
351 Ga0307507_10003999 3300033179 Bacteria 27071
352 Ga0307510_10000231 3300033180 Bacteria 50152
353 Ga0373927_0044538 3300035695 Bacteria 2871
354 Ga0395899_0000011 3300037312 Bacteria 521331
355 Ga0395899_0000024 3300037312 Bacteria 357402
356 Ga0395899_0025579 3300037312 Bacteria 4455
357 Ga0395900_0000140 3300037418 Bacteria 121917
358 Ga0395900_0003575 3300037418 Bacteria 16707
359 Ga0395900_0008075 3300037418 Bacteria 10834
360 Ga0395900_0308806 3300037418 Unclassified 1565
361 Ga0395898_0004401 3300037466 Bacteria 15408
362 Ga0395898_0024145 3300037466 Bacteria 6135
363 Ga0395905_0001502 3300037471 Bacteria 27915
364 Ga0395901_0001833 3300038443 Bacteria 21962
365 Ga0395901_0057582 3300038443 Bacteria 4042
366 Ga0395901_0147964 3300038443 Unclassified 2468
367 Ga0436361_0370261 3300039447 Bacteria 21370
368 Ga0439442_005210 3300042002 Bacteria 2607
369 Ga0439457_026580 3300042014 Bacteria 1281
370 Ga0439434_0007042 3300042435 Bacteria 3286
371 Ga0451577_0014304 3300042876 Bacteria 7398
372 Ga0451577_0069145 3300042876 Bacteria 3149
373 Ga0451577_0081696 3300042876 Unclassified 2883
374 Ga0451577_0092296 3300042876 Bacteria 2703
375 Ga0466969_0027996 3300044656 Bacteria 2883
376 Ga0453683_0032018 3300044673 Bacteria 3320
377 Ga0453684_0006260 3300044712 Bacteria 22796
378 Ga0453684_0122887 3300044712 Bacteria 3131
379 Ga0453684_0211272 3300044712 Bacteria 2255
380 Ga0466970_0009855 3300044765 Bacteria 4839
381 Ga0466959_0054693 3300045049 Bacteria 2916
382 Ga0451576_0005137 3300045051 Bacteria 16587
383 Ga0495651_0064733 3300046462 Bacteria 2794
384 Ga0495651_0121847 3300046462 Bacteria 1915
385 Ga0495650_0000050 3300046471 Bacteria 318894
386 Ga0495585_0000248 3300046492 Bacteria 56018
387 Ga0495585_0001069 3300046492 Bacteria 22592
388 Ga0495583_0024123 3300046506 Bacteria 3063
389 Ga0495606_0000036 3300046507 Bacteria 234596
390 Ga0495606_0003826 3300046507 Bacteria 15590
391 Ga0495606_0006803 3300046507 Bacteria 10441
392 Ga0495606_0034399 3300046507 Bacteria 3480
393 Ga0495610_0000054 3300046512 Bacteria 140031
394 Ga0495610_0000292 3300046512 Bacteria 52555
395 Ga0495610_0001572 3300046512 Bacteria 20100
396 Ga0495616_0000271 3300046513 Bacteria 42005
397 Ga0495616_0001648 3300046513 Bacteria 15299
398 Ga0495631_0003997 3300046518 Bacteria 7947
399 Ga0495632_0095786 3300046519 Bacteria 1402
400 Ga0495643_0017040 3300046522 Bacteria 4257
401 Ga0495654_0025254 3300046530 Bacteria 3062
402 Ga0495609_0008052 3300046538 Bacteria 5196
403 Ga0495633_0000004 3300046558 Bacteria 370781
404 Ga0495633_0140027 3300046558 Bacteria 1119
405 Ga0495668_0000055 3300046616 Bacteria 199412
406 Ga0495668_0000301 3300046616 Bacteria 68097
407 Ga0495668_0000624 3300046616 Bacteria 42812
408 Ga0495668_0008797 3300046616 Bacteria 6259
409 Ga0495625_0000105 3300046660 Bacteria 126078
410 Ga0495625_0009668 3300046660 Bacteria 8039
411 Ga0495625_0012985 3300046660 Bacteria 6720
412 Ga0495625_0023163 3300046660 Bacteria 4746
413 Ga0495625_0122455 3300046660 Bacteria 1768
414 Ga0495661_0061118 3300046665 Bacteria 2237
415 Ga0495671_0052469 3300046692 Bacteria 2027
416 Ga0495649_0000011 3300046694 Bacteria 416695
417 Ga0495589_0034294 3300046794 Bacteria 2549
418 Ga0495660_0031473 3300046810 Bacteria 2982
419 Ga0495636_0000038 3300047318 Bacteria 56537
420 Ga0495683_0004476 3300047323 Bacteria 7927
421 Ga0495687_002867 3300047443 Bacteria 13196
422 Ga0495687_032785 3300047443 Bacteria 2366
423 Ga0495673_0015245 3300047469 Bacteria 3965
424 Ga0495686_0001664 3300047472 Bacteria 23127
425 Ga0495686_0002015 3300047472 Bacteria 20080
426 Ga0495686_0006693 3300047472 Bacteria 8772
427 Ga0495686_0034347 3300047472 Bacteria 3267
428 Ga0496115_0004238 3300048918 Bacteria 10368
429 Ga0496115_0046623 3300048918 Bacteria 3465
430 Ga0496116_0015352 3300048919 Bacteria 6057
431 Ga0496117_0010726 3300048920 Bacteria 8285
432 Ga0496118_0057718 3300048921 Bacteria 2907
433 Ga0496122_0001655 3300048925 Bacteria 34602
434 Ga0496122_0143140 3300048925 Bacteria 1491
435 Ga0496123_0008277 3300048926 Bacteria 9580
436 Ga0496123_0013729 3300048926 Bacteria 6772
437 Ga0496125_0028533 3300048928 Bacteria 5038
438 Ga0495682_0024498 3300049460 Bacteria 2249
439 Ga0501033_0079708 3300049570 Bacteria 2403
440 Ga0501240_001183 3300049673 Bacteria 2470
441 Ga0501241_005588 3300049758 Bacteria 2340
442 Ga0501269_005119 3300049766 Bacteria 1577
443 nmdc:mga0k408_44_c2 3300050493 Bacteria 32487
444 nmdc:mga0k408_574_c3 3300050493 Bacteria 6199
445 nmdc:mga05p37_29860_c1 3300050507 Bacteria 6652
446 Ga0500635_0000943 3300053080 Bacteria 7025
447 Ga0500644_0000110 3300053088 Bacteria 52203
448 Ga0500583_0000317 3300053092 Bacteria 16510
449 Ga0500651_0000146 3300053093 Bacteria 44767
450 Ga0500556_0030848 3300053104 Bacteria 1819
451 Ga0500572_019556 3300053111 Bacteria 1770
452 Ga0500608_001334 3300053122 Bacteria 8820
453 Ga0500608_006901 3300053122 Bacteria 4660
454 Ga0500618_000006 3300053125 Bacteria 239188
455 Ga0500618_011277 3300053125 Bacteria 2374
456 Ga0500652_014810 3300053131 Bacteria 2799
457 Ga0500616_0001380 3300053153 Bacteria 23509
458 Ga0500622_0000291 3300053156 Bacteria 51275
459 Ga0500622_0002142 3300053156 Bacteria 14668
460 Ga0500622_0002270 3300053156 Bacteria 14116
461 Ga0500624_000481 3300053157 Bacteria 11801
462 Ga0500636_0047661 3300053177 Bacteria 2524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0140027 Ga0495633_0140027_36_1094 348
2 3300031251 Ga0265327_10000239 Ga0265327_1000023953 356
3 3300003794 Ga0055531_10000091 Ga0055531_100000917 361
4 3300003794 Ga0055531_10000388 Ga0055531_1000038827 361
5 3300025304 Ga0209257_1000006 Ga0209257_1000006806 361
6 3300048925 Ga0496122_0143140 Ga0496122_0143140_329_1444 364
7 3300005336 Ga0070680_100059251 Ga0070680_1000592514 367
8 iso_pu_bacteria 2738541278 2738730788 368
9 3300028794 Ga0307515_10000077 Ga0307515_10000077164 371
10 3300003323 rootH1_10003164 rootH1_1000316482 372
11 3300003323 rootH1_10003165 rootH1_100031653 372
12 3300042014 Ga0439457_026580 Ga0439457_026580_88_1212 372
13 3300042876 Ga0451577_0081696 Ga0451577_0081696_519_1670 372
14 3300046616 Ga0495668_0008797 Ga0495668_0008797_1338_2471 372
15 3300053156 Ga0500622_0002142 Ga0500622_0002142_4642_5769 373
16 3300042876 Ga0451577_0014304 Ga0451577_0014304_1335_2546 381
17 iso_pu_bacteria 2898713307 2898713773 381
18 3300025261 Ga0209233_1001831 Ga0209233_10018314 382
19 iso_pu_bacteria 2890737413 2890739068 382
20 iso_pu_bacteria 2895498888 2895503626 382
21 iso_pu_bacteria 2896344016 2896344270 382
22 iso_pu_bacteria 2919692658 2919695797 382
23 iso_pu_bacteria 3003233435 3003234939 382
24 iso_pu_bacteria 2904780799 2904783179 383
25 iso_pu_bacteria 2919177583 2919180787 383
26 iso_pu_bacteria 2919186247 2919190769 383
27 iso_pu_bacteria 2939664404 2939669021 383
28 iso_pu_bacteria 2599185184 2599479818 384
29 iso_pu_bacteria 2738541283 2738759112 384
30 iso_pu_bacteria 2738543023 2739302314 384
31 iso_pu_bacteria 2775506987 2776615576 384
32 iso_pu_bacteria 2852623160 2852625634 384
33 iso_pu_bacteria 2852627209 2852627834 384
34 iso_pu_bacteria 2884933994 2884934633 384
35 iso_pu_bacteria 2919437846 2919439839 384
36 iso_pu_bacteria 2928078545 2928080949 384
37 iso_pu_bacteria 2928147474 2928152632 384
38 iso_pu_bacteria 2932082852 2932086958 384
39 iso_pu_bacteria 2977232053 2977234735 384
40 iso_pu_bacteria 8055588893 8055590254 384
41 2162886007 SwRhRL2b_contig_346326 SwRhRL2b_0075.00006930 385
42 3300005355 Ga0070671_100187980 Ga0070671_1001879802 385
43 3300009148 Ga0105243_10000003 Ga0105243_10000003315 385
44 3300013296 Ga0157374_10183110 Ga0157374_101831102 385
45 3300025935 Ga0207709_10000008 Ga0207709_10000008259 385
46 3300032004 Ga0307414_10065772 Ga0307414_100657722 385
47 3300032004 Ga0307414_10087961 Ga0307414_100879612 385
48 3300048919 Ga0496116_0015352 Ga0496116_0015352_3976_5157 385
49 3300048920 Ga0496117_0010726 Ga0496117_0010726_2009_3190 385
50 3300048921 Ga0496118_0057718 Ga0496118_0057718_1540_2721 385
51 3300048926 Ga0496123_0013729 Ga0496123_0013729_3745_4926 385
52 iso_pu_bacteria 2721755487 2722730832 385
53 iso_pu_bacteria 2738541284 2738761779 385
54 iso_pu_bacteria 2739367663 2739645732 385
55 iso_pu_bacteria 2842903701 2842905055 385
56 iso_pu_bacteria 2896317667 2896320993 385
57 iso_pu_bacteria 2902048731 2902052073 385
58 iso_pu_bacteria 2929239360 2929243884 385
59 3300005618 Ga0068864_100187070 Ga0068864_1001870702 386
60 3300013100 Ga0157373_10002107 Ga0157373_100021077 386
61 3300032004 Ga0307414_10000357 Ga0307414_100003574 386
62 3300032004 Ga0307414_10052017 Ga0307414_100520173 386
63 3300042002 Ga0439442_005210 Ga0439442_005210_100_1263 386
64 3300042435 Ga0439434_0007042 Ga0439434_0007042_186_1349 386
65 3300046522 Ga0495643_0017040 Ga0495643_0017040_2387_3550 386
66 3300046616 Ga0495668_0000301 Ga0495668_0000301_16150_17316 386
67 iso_pu_bacteria 2585427687 2586206420 386
68 iso_pu_bacteria 2738541302 2738852870 386
69 iso_pu_bacteria 2739367651 2739586814 386
70 iso_pu_bacteria 2739367656 2739615130 386
71 iso_pu_bacteria 2818991437 2819547236 386
72 iso_pu_bacteria 2842722452 2842726995 386
73 iso_pu_bacteria 2842909656 2842911003 386
74 iso_pu_bacteria 2849281842 2849283863 386
75 iso_pu_bacteria 2857627736 2857627935 386
76 iso_pu_bacteria 2904445276 2904447716 386
77 iso_pu_bacteria 2945997725 2945997882 386
78 iso_pu_bacteria 2954016120 2954020365 386
79 3300001990 JGI24737J22298_10006616 JGI24737J22298_100066164 387
80 3300003320 rootH2_10063809 rootH2_100638093 387
81 3300005338 Ga0068868_100094127 Ga0068868_1000941272 387
82 3300005339 Ga0070660_100098457 Ga0070660_1000984573 387
83 3300005355 Ga0070671_100009686 Ga0070671_1000096865 387
84 3300005457 Ga0070662_100000033 Ga0070662_10000003367 387
85 3300005548 Ga0070665_100000017 Ga0070665_100000017281 387
86 3300005563 Ga0068855_100372053 Ga0068855_1003720532 387
87 3300005614 Ga0068856_100004729 Ga0068856_1000047297 387
88 3300005841 Ga0068863_100036278 Ga0068863_1000362783 387
89 3300005842 Ga0068858_100144939 Ga0068858_1001449393 387
90 3300009093 Ga0105240_10000185 Ga0105240_100001852 387
91 3300009093 Ga0105240_10003566 Ga0105240_1000356624 387
92 3300009174 Ga0105241_10000928 Ga0105241_1000092824 387
93 3300009174 Ga0105241_10089810 Ga0105241_100898102 387
94 3300009545 Ga0105237_10000887 Ga0105237_1000088733 387
95 3300009545 Ga0105237_10112177 Ga0105237_101121773 387
96 3300010375 Ga0105239_10001468 Ga0105239_1000146831 387
97 3300010375 Ga0105239_10090246 Ga0105239_100902462 387
98 3300013102 Ga0157371_10040504 Ga0157371_100405042 387
99 3300013104 Ga0157370_10135819 Ga0157370_101358192 387
100 3300013104 Ga0157370_10172037 Ga0157370_101720371 387
101 3300013296 Ga0157374_10000180 Ga0157374_1000018021 387
102 3300013296 Ga0157374_10008508 Ga0157374_100085087 387
103 3300013307 Ga0157372_10022572 Ga0157372_100225723 387
104 3300013307 Ga0157372_10056130 Ga0157372_100561303 387
105 3300017792 Ga0163161_10000984 Ga0163161_1000098412 387
106 3300025904 Ga0207647_10003947 Ga0207647_1000394712 387
107 3300025911 Ga0207654_10028784 Ga0207654_100287842 387
108 3300025913 Ga0207695_10000117 Ga0207695_10000117103 387
109 3300025914 Ga0207671_10000831 Ga0207671_100008311 387
110 3300025917 Ga0207660_10016385 Ga0207660_100163851 387
111 3300025919 Ga0207657_10117635 Ga0207657_101176353 387
112 3300025932 Ga0207690_10116192 Ga0207690_101161922 387
113 3300025933 Ga0207706_10003806 Ga0207706_100038066 387
114 3300025949 Ga0207667_10259321 Ga0207667_102593212 387
115 3300025949 Ga0207667_10315449 Ga0207667_103154492 387
116 3300026023 Ga0207677_10073521 Ga0207677_100735213 387
117 3300026035 Ga0207703_10236877 Ga0207703_102368771 387
118 3300026088 Ga0207641_10081379 Ga0207641_100813792 387
119 3300028379 Ga0268266_10000037 Ga0268266_1000003736 387
120 3300028794 Ga0307515_10000345 Ga0307515_1000034588 387
121 3300031649 Ga0307514_10027561 Ga0307514_100275613 387
122 3300031911 Ga0307412_10001795 Ga0307412_100017954 387
123 3300037312 Ga0395899_0000011 Ga0395899_0000011_158022_159191 387
124 3300037312 Ga0395899_0025579 Ga0395899_0025579_2615_3784 387
125 3300037418 Ga0395900_0000140 Ga0395900_0000140_49822_50991 387
126 3300037418 Ga0395900_0008075 Ga0395900_0008075_4121_5290 387
127 3300037466 Ga0395898_0024145 Ga0395898_0024145_1995_3164 387
128 3300042876 Ga0451577_0069145 Ga0451577_0069145_701_1906 387
129 3300044712 Ga0453684_0211272 Ga0453684_0211272_1009_2214 387
130 3300049766 Ga0501269_005119 Ga0501269_005119_120_1286 387
131 3300053104 Ga0500556_0030848 Ga0500556_0030848_502_1668 387
132 3300053153 Ga0500616_0001380 Ga0500616_0001380_19968_21134 387
133 3300001904 JGI24736J21556_1001881 JGI24736J21556_10018812 388
134 3300001989 JGI24739J22299_10020993 JGI24739J22299_100209931 388
135 3300001989 JGI24739J22299_10034033 JGI24739J22299_100340331 388
136 3300001990 JGI24737J22298_10000303 JGI24737J22298_1000030311 388
137 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007141 388
138 3300002067 JGI24735J21928_10011780 JGI24735J21928_100117802 388
139 3300002737 JGI25162J39368_1000008 JGI25162J39368_100000823 388
140 3300002737 JGI25162J39368_1005851 JGI25162J39368_10058512 388
141 3300002772 JGI25164J39214_1002882 JGI25164J39214_10028822 388
142 3300003214 JGI25165J46597_1001633 JGI25165J46597_10016336 388
143 3300003316 rootH1_10129909 rootH1_101299092 388
144 3300003320 rootH2_10003159 rootH2_1000315914 388
145 3300003320 rootH2_10050267 rootH2_100502672 388
146 3300003320 rootH2_10082426 rootH2_100824261 388
147 3300003322 rootL2_10149567 rootL2_101495672 388
148 3300003323 rootH1_10001642 rootH1_1000164228 388
149 3300003323 rootH1_10010242 rootH1_100102423 388
150 3300003323 rootH1_10211847 rootH1_102118471 388
151 3300005288 Ga0065714_10015491 Ga0065714_100154911 388
152 3300005288 Ga0065714_10073623 Ga0065714_100736233 388
153 3300005289 Ga0065704_10000464 Ga0065704_1000046435 388
154 3300005289 Ga0065704_10102766 Ga0065704_101027661 388
155 3300005327 Ga0070658_10000008 Ga0070658_10000008144 388
156 3300005327 Ga0070658_10074289 Ga0070658_100742893 388
157 3300005328 Ga0070676_10003387 Ga0070676_100033873 388
158 3300005334 Ga0068869_100167639 Ga0068869_1001676392 388
159 3300005336 Ga0070680_100001722 Ga0070680_1000017224 388
160 3300005337 Ga0070682_100000005 Ga0070682_100000005140 388
161 3300005339 Ga0070660_100014795 Ga0070660_1000147951 388
162 3300005354 Ga0070675_100224115 Ga0070675_1002241152 388
163 3300005356 Ga0070674_100207364 Ga0070674_1002073641 388
164 3300005364 Ga0070673_100065994 Ga0070673_1000659943 388
165 3300005366 Ga0070659_100000610 Ga0070659_1000006108 388
166 3300005366 Ga0070659_100002836 Ga0070659_1000028364 388
167 3300005455 Ga0070663_100004973 Ga0070663_1000049737 388
168 3300005456 Ga0070678_100041132 Ga0070678_1000411324 388
169 3300005458 Ga0070681_10027865 Ga0070681_100278654 388
170 3300005459 Ga0068867_100065585 Ga0068867_1000655853 388
171 3300005530 Ga0070679_100018504 Ga0070679_1000185047 388
172 3300005530 Ga0070679_100043524 Ga0070679_1000435243 388
173 3300005539 Ga0068853_100027661 Ga0068853_1000276615 388
174 3300005539 Ga0068853_100038390 Ga0068853_1000383905 388
175 3300005548 Ga0070665_100002768 Ga0070665_1000027686 388
176 3300005563 Ga0068855_100000021 Ga0068855_10000002149 388
177 3300005563 Ga0068855_100000967 Ga0068855_10000096721 388
178 3300005563 Ga0068855_100010184 Ga0068855_1000101849 388
179 3300005563 Ga0068855_100077251 Ga0068855_1000772514 388
180 3300005563 Ga0068855_100246752 Ga0068855_1002467522 388
181 3300005614 Ga0068856_100004360 Ga0068856_1000043602 388
182 3300005614 Ga0068856_100004648 Ga0068856_1000046489 388
183 3300005614 Ga0068856_100269922 Ga0068856_1002699222 388
184 3300005616 Ga0068852_100003482 Ga0068852_1000034827 388
185 3300005616 Ga0068852_100031479 Ga0068852_1000314794 388
186 3300005718 Ga0068866_10009946 Ga0068866_100099464 388
187 3300006195 Ga0075366_10000019 Ga0075366_1000001946 388
188 3300006195 Ga0075366_10004640 Ga0075366_100046405 388
189 3300006195 Ga0075366_10071637 Ga0075366_100716372 388
190 3300006195 Ga0075366_10094011 Ga0075366_100940112 388
191 3300006237 Ga0097621_100000478 Ga0097621_10000047822 388
192 3300006358 Ga0068871_100000353 Ga0068871_10000035322 388
193 3300006358 Ga0068871_100003813 Ga0068871_1000038139 388
194 3300006881 Ga0068865_100000865 Ga0068865_1000008659 388
195 3300009093 Ga0105240_10014660 Ga0105240_100146606 388
196 3300009093 Ga0105240_10212398 Ga0105240_102123981 388
197 3300009098 Ga0105245_10214263 Ga0105245_102142632 388
198 3300009174 Ga0105241_10242034 Ga0105241_102420342 388
199 3300009174 Ga0105241_10279708 Ga0105241_102797081 388
200 3300009176 Ga0105242_10125309 Ga0105242_101253093 388
201 3300009545 Ga0105237_10000753 Ga0105237_1000075332 388
202 3300009545 Ga0105237_10002120 Ga0105237_100021207 388
203 3300009545 Ga0105237_10003933 Ga0105237_100039337 388
204 3300009551 Ga0105238_10015917 Ga0105238_100159173 388
205 3300010375 Ga0105239_10000069 Ga0105239_1000006944 388
206 3300010375 Ga0105239_10000142 Ga0105239_100001426 388
207 3300010375 Ga0105239_10000912 Ga0105239_100009121 388
208 3300010375 Ga0105239_10062599 Ga0105239_100625992 388
209 3300010375 Ga0105239_10081589 Ga0105239_100815896 388
210 3300010375 Ga0105239_10094828 Ga0105239_100948283 388
211 3300010375 Ga0105239_10146009 Ga0105239_101460092 388
212 3300010375 Ga0105239_10201830 Ga0105239_102018302 388
213 3300013100 Ga0157373_10000262 Ga0157373_1000026237 388
214 3300013100 Ga0157373_10000303 Ga0157373_1000030322 388
215 3300013102 Ga0157371_10000912 Ga0157371_1000091210 388
216 3300013102 Ga0157371_10012836 Ga0157371_100128362 388
217 3300013102 Ga0157371_10027892 Ga0157371_100278923 388
218 3300013102 Ga0157371_10044456 Ga0157371_100444563 388
219 3300013102 Ga0157371_10044512 Ga0157371_100445123 388
220 3300013104 Ga0157370_10012828 Ga0157370_100128285 388
221 3300013104 Ga0157370_10086365 Ga0157370_100863652 388
222 3300013104 Ga0157370_10231436 Ga0157370_102314362 388
223 3300013104 Ga0157370_10238088 Ga0157370_102380882 388
224 3300013105 Ga0157369_10000101 Ga0157369_1000010190 388
225 3300013105 Ga0157369_10017093 Ga0157369_100170932 388
226 3300013296 Ga0157374_10007400 Ga0157374_100074003 388
227 3300013296 Ga0157374_10072295 Ga0157374_100722951 388
228 3300013296 Ga0157374_10080214 Ga0157374_100802142 388
229 3300013297 Ga0157378_10004991 Ga0157378_1000499113 388
230 3300013306 Ga0163162_10000051 Ga0163162_1000005111 388
231 3300013306 Ga0163162_10000459 Ga0163162_1000045930 388
232 3300013306 Ga0163162_10010324 Ga0163162_100103242 388
233 3300013307 Ga0157372_10000041 Ga0157372_1000004186 388
234 3300013307 Ga0157372_10000199 Ga0157372_1000019933 388
235 3300013307 Ga0157372_10001502 Ga0157372_1000150229 388
236 3300013307 Ga0157372_10002344 Ga0157372_1000234418 388
237 3300013307 Ga0157372_10119344 Ga0157372_101193443 388
238 3300013308 Ga0157375_10005995 Ga0157375_1000599510 388
239 3300014497 Ga0182008_10000002 Ga0182008_1000000297 388
240 3300014497 Ga0182008_10000294 Ga0182008_100002947 388
241 3300015261 Ga0182006_1000349 Ga0182006_10003496 388
242 3300015261 Ga0182006_1001278 Ga0182006_10012783 388
243 3300017792 Ga0163161_10006795 Ga0163161_100067957 388
244 3300025230 Ga0209563_109321 Ga0209563_1093211 388
245 3300025231 Ga0207427_100043 Ga0207427_10004312 388
246 3300025233 Ga0209437_100030 Ga0209437_100030358 388
247 3300025233 Ga0209437_100170 Ga0209437_100170107 388
248 3300025250 Ga0209026_1000251 Ga0209026_100025114 388
249 3300025250 Ga0209026_1002730 Ga0209026_10027303 388
250 3300025261 Ga0209233_1000266 Ga0209233_100026627 388
251 3300025272 Ga0209455_1004042 Ga0209455_10040424 388
252 3300025904 Ga0207647_10000103 Ga0207647_1000010328 388
253 3300025904 Ga0207647_10003496 Ga0207647_100034963 388
254 3300025904 Ga0207647_10104567 Ga0207647_101045671 388
255 3300025904 Ga0207647_10145326 Ga0207647_101453261 388
256 3300025907 Ga0207645_10001062 Ga0207645_1000106224 388
257 3300025909 Ga0207705_10000026 Ga0207705_10000026145 388
258 3300025912 Ga0207707_10044246 Ga0207707_100442464 388
259 3300025913 Ga0207695_10021013 Ga0207695_100210134 388
260 3300025913 Ga0207695_10037954 Ga0207695_100379543 388
261 3300025913 Ga0207695_10039928 Ga0207695_100399283 388
262 3300025914 Ga0207671_10000466 Ga0207671_1000046637 388
263 3300025914 Ga0207671_10001916 Ga0207671_1000191620 388
264 3300025914 Ga0207671_10005252 Ga0207671_100052526 388
265 3300025914 Ga0207671_10014272 Ga0207671_100142727 388
266 3300025914 Ga0207671_10068781 Ga0207671_100687812 388
267 3300025914 Ga0207671_10098226 Ga0207671_100982263 388
268 3300025919 Ga0207657_10149359 Ga0207657_101493593 388
269 3300025921 Ga0207652_10003845 Ga0207652_100038454 388
270 3300025931 Ga0207644_10122079 Ga0207644_101220792 388
271 3300025932 Ga0207690_10000123 Ga0207690_1000012324 388
272 3300025932 Ga0207690_10010431 Ga0207690_100104316 388
273 3300025937 Ga0207669_10173242 Ga0207669_101732422 388
274 3300025938 Ga0207704_10000685 Ga0207704_100006855 388
275 3300025949 Ga0207667_10000014 Ga0207667_10000014262 388
276 3300025949 Ga0207667_10001021 Ga0207667_1000102111 388
277 3300025949 Ga0207667_10031546 Ga0207667_100315467 388
278 3300025949 Ga0207667_10054129 Ga0207667_100541295 388
279 3300025949 Ga0207667_10092422 Ga0207667_100924222 388
280 3300026041 Ga0207639_10004859 Ga0207639_100048597 388
281 3300026041 Ga0207639_10332218 Ga0207639_103322182 388
282 3300026067 Ga0207678_10091096 Ga0207678_100910964 388
283 3300026078 Ga0207702_10001665 Ga0207702_1000166511 388
284 3300026078 Ga0207702_10128312 Ga0207702_101283123 388
285 3300026078 Ga0207702_10239894 Ga0207702_102398942 388
286 3300026089 Ga0207648_10001664 Ga0207648_1000166420 388
287 3300026121 Ga0207683_10069845 Ga0207683_100698454 388
288 3300026142 Ga0207698_10061118 Ga0207698_100611182 388
289 3300028379 Ga0268266_10004391 Ga0268266_1000439112 388
290 3300028786 Ga0307517_10000212 Ga0307517_1000021259 388
291 3300028794 Ga0307515_10036772 Ga0307515_1003677210 388
292 3300028794 Ga0307515_10079899 Ga0307515_100798992 388
293 3300028794 Ga0307515_10137271 Ga0307515_101372711 388
294 3300028800 Ga0265338_10021504 Ga0265338_100215046 388
295 3300031507 Ga0307509_10049196 Ga0307509_100491964 388
296 3300031548 Ga0307408_100000389 Ga0307408_10000038927 388
297 3300031911 Ga0307412_10000050 Ga0307412_1000005043 388
298 3300032004 Ga0307414_10000293 Ga0307414_1000029314 388
299 3300032005 Ga0307411_10155168 Ga0307411_101551682 388
300 3300033179 Ga0307507_10003999 Ga0307507_100039996 388
301 3300033180 Ga0307510_10000231 Ga0307510_1000023117 388
302 3300037312 Ga0395899_0000024 Ga0395899_0000024_228648_229823 388
303 3300037471 Ga0395905_0001502 Ga0395905_0001502_6375_7547 388
304 3300038443 Ga0395901_0001833 Ga0395901_0001833_64_1236 388
305 3300039447 Ga0436361_0370261 Ga0436361_0370261_3655_4827 388
306 3300044656 Ga0466969_0027996 Ga0466969_0027996_807_1982 388
307 3300044765 Ga0466970_0009855 Ga0466970_0009855_2595_3782 388
308 3300045049 Ga0466959_0054693 Ga0466959_0054693_1350_2531 388
309 3300046462 Ga0495651_0064733 Ga0495651_0064733_1460_2644 388
310 3300046462 Ga0495651_0121847 Ga0495651_0121847_485_1657 388
311 3300046471 Ga0495650_0000050 Ga0495650_0000050_256700_257875 388
312 3300046492 Ga0495585_0000248 Ga0495585_0000248_16017_17192 388
313 3300046492 Ga0495585_0001069 Ga0495585_0001069_18967_20151 388
314 3300046506 Ga0495583_0024123 Ga0495583_0024123_1449_2624 388
315 3300046507 Ga0495606_0000036 Ga0495606_0000036_5907_7082 388
316 3300046507 Ga0495606_0003826 Ga0495606_0003826_4807_5979 388
317 3300046507 Ga0495606_0006803 Ga0495606_0006803_2756_3931 388
318 3300046507 Ga0495606_0034399 Ga0495606_0034399_1953_3125 388
319 3300046512 Ga0495610_0001572 Ga0495610_0001572_12162_13337 388
320 3300046513 Ga0495616_0000271 Ga0495616_0000271_22591_23766 388
321 3300046513 Ga0495616_0001648 Ga0495616_0001648_12277_13449 388
322 3300046518 Ga0495631_0003997 Ga0495631_0003997_5703_6929 388
323 3300046519 Ga0495632_0095786 Ga0495632_0095786_191_1363 388
324 3300046530 Ga0495654_0025254 Ga0495654_0025254_504_1688 388
325 3300046558 Ga0495633_0000004 Ga0495633_0000004_254037_255221 388
326 3300046616 Ga0495668_0000055 Ga0495668_0000055_91291_92475 388
327 3300046660 Ga0495625_0000105 Ga0495625_0000105_20938_22113 388
328 3300046660 Ga0495625_0009668 Ga0495625_0009668_3834_5006 388
329 3300046660 Ga0495625_0012985 Ga0495625_0012985_33_1217 388
330 3300046660 Ga0495625_0023163 Ga0495625_0023163_1690_2862 388
331 3300046660 Ga0495625_0122455 Ga0495625_0122455_200_1384 388
332 3300046665 Ga0495661_0061118 Ga0495661_0061118_37_1215 388
333 3300046692 Ga0495671_0052469 Ga0495671_0052469_473_1645 388
334 3300046694 Ga0495649_0000011 Ga0495649_0000011_102828_104003 388
335 3300046794 Ga0495589_0034294 Ga0495589_0034294_496_1671 388
336 3300046810 Ga0495660_0031473 Ga0495660_0031473_1126_2301 388
337 3300047318 Ga0495636_0000038 Ga0495636_0000038_53949_55127 388
338 3300047323 Ga0495683_0004476 Ga0495683_0004476_3068_4294 388
339 3300047443 Ga0495687_002867 Ga0495687_002867_3871_5043 388
340 3300047443 Ga0495687_032785 Ga0495687_032785_320_1492 388
341 3300047469 Ga0495673_0015245 Ga0495673_0015245_1535_2710 388
342 3300047472 Ga0495686_0001664 Ga0495686_0001664_160_1332 388
343 3300047472 Ga0495686_0002015 Ga0495686_0002015_11305_12480 388
344 3300047472 Ga0495686_0034347 Ga0495686_0034347_612_1787 388
345 3300048925 Ga0496122_0001655 Ga0496122_0001655_13930_15117 388
346 3300048926 Ga0496123_0008277 Ga0496123_0008277_3016_4203 388
347 3300048928 Ga0496125_0028533 Ga0496125_0028533_132_1319 388
348 3300049460 Ga0495682_0024498 Ga0495682_0024498_911_2095 388
349 3300049570 Ga0501033_0079708 Ga0501033_0079708_465_1637 388
350 3300049758 Ga0501241_005588 Ga0501241_005588_382_1569 388
351 3300050493 nmdc:mga0k408_44_c2 nmdc:mga0k408_44_c2_10048_11232 388
352 3300050493 nmdc:mga0k408_574_c3 nmdc:mga0k408_574_c3_2167_3342 388
353 3300053080 Ga0500635_0000943 Ga0500635_0000943_3895_5100 388
354 3300053093 Ga0500651_0000146 Ga0500651_0000146_7669_8856 388
355 3300053111 Ga0500572_019556 Ga0500572_019556_258_1427 388
356 3300053122 Ga0500608_001334 Ga0500608_001334_2740_3912 388
357 3300053122 Ga0500608_006901 Ga0500608_006901_2704_3930 388
358 3300053125 Ga0500618_000006 Ga0500618_000006_73759_74952 388
359 3300053125 Ga0500618_011277 Ga0500618_011277_482_1657 388
360 3300053156 Ga0500622_0000291 Ga0500622_0000291_26080_27255 388
361 3300053157 Ga0500624_000481 Ga0500624_000481_6043_7215 388
362 3300002773 JGI25152J39213_1000043 JGI25152J39213_100004320 389
363 3300002774 JGI25150J39212_1000023 JGI25150J39212_1000023106 389
364 3300003187 JGI25151J46595_10000082 JGI25151J46595_10000082106 389
365 3300003215 JGI25153J46596_10000060 JGI25153J46596_10000060107 389
366 3300003320 rootH2_10003246 rootH2_10003246142 389
367 3300003322 rootL2_10006866 rootL2_100068662 389
368 3300003323 rootH1_10002599 rootH1_1000259913 389
369 3300003781 Ga0055536_1000002 Ga0055536_100000252 389
370 3300003791 Ga0055530_10000739 Ga0055530_1000073919 389
371 3300005288 Ga0065714_10002923 Ga0065714_100029238 389
372 3300005288 Ga0065714_10004174 Ga0065714_100041747 389
373 3300005288 Ga0065714_10064591 Ga0065714_100645911 389
374 3300005327 Ga0070658_10026576 Ga0070658_100265764 389
375 3300005330 Ga0070690_100036495 Ga0070690_1000364952 389
376 3300005339 Ga0070660_100000216 Ga0070660_10000021619 389
377 3300005530 Ga0070679_100000442 Ga0070679_10000044213 389
378 3300005539 Ga0068853_100039291 Ga0068853_1000392912 389
379 3300005563 Ga0068855_100147796 Ga0068855_1001477963 389
380 3300005578 Ga0068854_100147775 Ga0068854_1001477751 389
381 3300005616 Ga0068852_100097814 Ga0068852_1000978144 389
382 3300005617 Ga0068859_100000522 Ga0068859_10000052217 389
383 3300005834 Ga0068851_10005956 Ga0068851_100059562 389
384 3300006931 Ga0097620_100000522 Ga0097620_10000052221 389
385 3300009036 Ga0105244_10021045 Ga0105244_100210455 389
386 3300010375 Ga0105239_10008402 Ga0105239_100084024 389
387 3300013100 Ga0157373_10022773 Ga0157373_100227732 389
388 3300013100 Ga0157373_10030867 Ga0157373_100308674 389
389 3300013100 Ga0157373_10046940 Ga0157373_100469403 389
390 3300013102 Ga0157371_10000151 Ga0157371_1000015133 389
391 3300013102 Ga0157371_10002662 Ga0157371_1000266212 389
392 3300013102 Ga0157371_10067702 Ga0157371_100677023 389
393 3300013102 Ga0157371_10079402 Ga0157371_100794021 389
394 3300013104 Ga0157370_10012044 Ga0157370_100120447 389
395 3300013104 Ga0157370_10015713 Ga0157370_100157133 389
396 3300013104 Ga0157370_10065999 Ga0157370_100659992 389
397 3300013104 Ga0157370_10086975 Ga0157370_100869753 389
398 3300013104 Ga0157370_10306831 Ga0157370_103068311 389
399 3300013104 Ga0157370_10330837 Ga0157370_103308371 389
400 3300013105 Ga0157369_10000050 Ga0157369_1000005056 389
401 3300013306 Ga0163162_10000011 Ga0163162_10000011229 389
402 3300013307 Ga0157372_10076349 Ga0157372_100763493 389
403 3300013307 Ga0157372_10088769 Ga0157372_100887693 389
404 3300014497 Ga0182008_10000342 Ga0182008_1000034218 389
405 3300014497 Ga0182008_10048304 Ga0182008_100483041 389
406 3300015261 Ga0182006_1000415 Ga0182006_10004152 389
407 3300015261 Ga0182006_1000423 Ga0182006_100042332 389
408 3300015261 Ga0182006_1001068 Ga0182006_10010685 389
409 3300015262 Ga0182007_10000008 Ga0182007_10000008227 389
410 3300015682 Ga0183373_1002 Ga0183373_1002500 389
411 3300017792 Ga0163161_10000152 Ga0163161_100001521 389
412 3300017792 Ga0163161_10010597 Ga0163161_100105971 389
413 3300017792 Ga0163161_10195656 Ga0163161_101956562 389
414 3300025245 Ga0207425_1000051 Ga0207425_1000051139 389
415 3300025250 Ga0209026_1007347 Ga0209026_10073472 389
416 3300025258 Ga0209129_1000121 Ga0209129_1000121106 389
417 3300025292 Ga0209676_1000022 Ga0209676_1000022488 389
418 3300025294 Ga0209025_1000160 Ga0209025_100016020 389
419 3300025297 Ga0209758_1000147 Ga0209758_100014720 389
420 3300025298 Ga0209050_1000020 Ga0209050_100002051 389
421 3300025321 Ga0207656_10010171 Ga0207656_100101713 389
422 3300025728 Ga0207655_1024142 Ga0207655_10241422 389
423 3300025907 Ga0207645_10078939 Ga0207645_100789392 389
424 3300025909 Ga0207705_10025319 Ga0207705_100253192 389
425 3300025909 Ga0207705_10051262 Ga0207705_100512622 389
426 3300025913 Ga0207695_10007355 Ga0207695_100073553 389
427 3300025919 Ga0207657_10000852 Ga0207657_1000085218 389
428 3300025921 Ga0207652_10000101 Ga0207652_1000010158 389
429 3300025949 Ga0207667_10007350 Ga0207667_100073504 389
430 3300026041 Ga0207639_10163602 Ga0207639_101636022 389
431 3300026041 Ga0207639_10308689 Ga0207639_103086891 389
432 3300028794 Ga0307515_10000010 Ga0307515_10000010253 389
433 3300028794 Ga0307515_10025102 Ga0307515_100251026 389
434 3300030731 Ga0316177_1127916 Ga0316177_11279162 389
435 3300030742 Ga0316183_1100732 Ga0316183_11007328 389
436 3300031456 Ga0307513_10130749 Ga0307513_101307492 389
437 3300031731 Ga0307405_10000017 Ga0307405_1000001774 389
438 3300031903 Ga0307407_10000002 Ga0307407_1000000235 389
439 3300032002 Ga0307416_100000005 Ga0307416_10000000535 389
440 3300032004 Ga0307414_10084347 Ga0307414_100843472 389
441 3300037418 Ga0395900_0308806 Ga0395900_0308806_142_1440 389
442 3300044712 Ga0453684_0006260 Ga0453684_0006260_13890_15080 389
443 3300045051 Ga0451576_0005137 Ga0451576_0005137_2821_4011 389
444 3300046512 Ga0495610_0000054 Ga0495610_0000054_105441_106622 389
445 3300046512 Ga0495610_0000292 Ga0495610_0000292_14981_16162 389
446 3300046538 Ga0495609_0008052 Ga0495609_0008052_2306_3511 389
447 3300046616 Ga0495668_0000624 Ga0495668_0000624_37596_38777 389
448 3300048918 Ga0496115_0046623 Ga0496115_0046623_2055_3248 389
449 2162886007 SwRhRL2b_contig_2879104 SwRhRL2b_0102.00000490 390
450 3300005262 Ga0065165_1000746 Ga0065165_100074626 390
451 3300005289 Ga0065704_10070133 Ga0065704_10070133468 390
452 3300005328 Ga0070676_10137394 Ga0070676_101373942 390
453 3300005339 Ga0070660_100109951 Ga0070660_1001099514 390
454 3300005354 Ga0070675_100266162 Ga0070675_1002661621 390
455 3300005459 Ga0068867_100075072 Ga0068867_1000750722 390
456 3300005471 Ga0070698_100006230 Ga0070698_1000062303 390
457 3300005530 Ga0070679_100061202 Ga0070679_1000612023 390
458 3300005548 Ga0070665_100324083 Ga0070665_1003240831 390
459 3300005616 Ga0068852_100002150 Ga0068852_1000021505 390
460 3300005843 Ga0068860_100011729 Ga0068860_1000117293 390
461 3300005844 Ga0068862_100008833 Ga0068862_1000088336 390
462 3300009093 Ga0105240_10000037 Ga0105240_1000003771 390
463 3300009093 Ga0105240_10324175 Ga0105240_103241752 390
464 3300009147 Ga0114129_10004428 Ga0114129_1000442811 390
465 3300009174 Ga0105241_10060485 Ga0105241_100604852 390
466 3300009545 Ga0105237_10017829 Ga0105237_100178295 390
467 3300010375 Ga0105239_10000606 Ga0105239_1000060653 390
468 3300013102 Ga0157371_10026472 Ga0157371_100264724 390
469 3300013105 Ga0157369_10366463 Ga0157369_103664632 390
470 3300013306 Ga0163162_10047136 Ga0163162_100471365 390
471 3300013307 Ga0157372_10205098 Ga0157372_102050982 390
472 3300014325 Ga0163163_10218411 Ga0163163_102184111 390
473 3300025904 Ga0207647_10072867 Ga0207647_100728671 390
474 3300025909 Ga0207705_10027902 Ga0207705_100279023 390
475 3300025909 Ga0207705_10049005 Ga0207705_100490052 390
476 3300025909 Ga0207705_10114769 Ga0207705_101147693 390
477 3300025913 Ga0207695_10000092 Ga0207695_10000092175 390
478 3300025921 Ga0207652_10002817 Ga0207652_1000281715 390
479 3300025926 Ga0207659_10204207 Ga0207659_102042072 390
480 3300025949 Ga0207667_10012651 Ga0207667_100126512 390
481 3300025949 Ga0207667_10167139 Ga0207667_101671392 390
482 3300025986 Ga0207658_10111145 Ga0207658_101111452 390
483 3300026067 Ga0207678_10087416 Ga0207678_100874162 390
484 3300026089 Ga0207648_10015165 Ga0207648_100151657 390
485 3300026142 Ga0207698_10000907 Ga0207698_1000090717 390
486 3300031251 Ga0265327_10022871 Ga0265327_100228716 390
487 3300035695 Ga0373927_0044538 Ga0373927_0044538_1104_2285 390
488 3300037418 Ga0395900_0003575 Ga0395900_0003575_12974_14161 390
489 3300037466 Ga0395898_0004401 Ga0395898_0004401_288_1475 390
490 3300038443 Ga0395901_0057582 Ga0395901_0057582_1084_2271 390
491 3300038443 Ga0395901_0147964 Ga0395901_0147964_22_1200 390
492 3300042876 Ga0451577_0092296 Ga0451577_0092296_988_2181 390
493 3300044673 Ga0453683_0032018 Ga0453683_0032018_1737_2930 390
494 3300044712 Ga0453684_0122887 Ga0453684_0122887_974_2158 390
495 3300047472 Ga0495686_0006693 Ga0495686_0006693_2854_4047 390
496 3300048918 Ga0496115_0004238 Ga0496115_0004238_8814_9989 390
497 3300049673 Ga0501240_001183 Ga0501240_001183_269_1465 390
498 3300050507 nmdc:mga05p37_29860_c1 nmdc:mga05p37_29860_c1_4933_6120 390
499 3300053088 Ga0500644_0000110 Ga0500644_0000110_25163_26347 390
500 3300053092 Ga0500583_0000317 Ga0500583_0000317_365_1552 390
501 3300053131 Ga0500652_014810 Ga0500652_014810_1080_2267 390
502 3300053156 Ga0500622_0002270 Ga0500622_0002270_1545_2750 390
503 3300053177 Ga0500636_0047661 Ga0500636_0047661_249_1469 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22020

RlmL_1st

RlmL ferredoxin-like domain

41

96

0.97

PF01170

UPF0020

RMKL-like, methyltransferase domain

200

409

0.94

PF02926

THUMP

THUMP domain

104

191

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v97-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.9351 6 383
3v8v-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sam binding 0.928 8 385
3v97-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.9049 6 383
3v97-assembly2.cif.gz_B crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.9025 8 381
3k0b-assembly1.cif.gz_A crystal structure of a predicted n6-adenine-specific dna methylase from listeria monocytogenes str. 4b f2365 0.9014 6 379
ID Description Score Start End Superfamily
af_Q2FYI6_162_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9254 169 378 3.40.50.150
3v8vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9135 177 381 3.40.50.150
af_Q2FYI6_162_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9089 169 378 3.40.50.150
3v8vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9027 177 381 3.40.50.150
3lduA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8883 181 377 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q3F532-F1-model_v4 Class I SAM-dependent RNA methyltransferase 0.9883 1 288 GO:0003723
GO:0008990
GO:0070043
AF-A0A3D6CGK6-F1-model_v4 RNA methyltransferase 0.9842 1 224 GO:0003723
GO:0008990
GO:0070043
AF-A0A4Q3F532-F1-model_v4 Class I SAM-dependent RNA methyltransferase 0.9782 1 288 GO:0003723
GO:0008990
GO:0070043
AF-A0A0F9FXK9-F1-model_v4 THUMP domain-containing protein 0.977 4 194 GO:0003723
GO:0008990
GO:0070043
AF-A0A3D6CGK6-F1-model_v4 RNA methyltransferase 0.9756 1 224 GO:0003723
GO:0008990
GO:0070043

Feature Viewer

pLDDT pTM Quality
91.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map