F456005

General Info

Members Datasets Scaffolds Average Seq Length
503 268 1006 159

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10007440|Ga0114129_100074409
Length 191
Sequence MAIFPRTSRRRKILAHPPEHLAVRQEHRMARSSRPNVSAGLLLFRRSRGRLEVFIAHPGGPFWKDRDVAAWTIPKGIVESGEDLLDAAQREFFEETSIRPTGPFIPLGSIRQKAGKTIHAWAWEGDADPSAIVSNKMRTEWPRGSGRMIEFPEIDRCAWFDPATAKSKMNPAQAELVDRLEAALVPGKAGS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
197 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0
Rhizoplane 6.16
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 21.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10007440 3300009147 Bacteria 15598
2 rootH1_10058731 3300003316 Bacteria 2205
3 Ga0055524_1000163 3300003775 Bacteria 76321
4 Ga0055531_10009783 3300003794 Bacteria 4861
5 Ga0065712_10385741 3300005290 Unclassified 747
6 Ga0065715_10164089 3300005293 Bacteria 1602
7 Ga0065707_10133439 3300005295 Bacteria 1881
8 Ga0070658_10149671 3300005327 Unclassified 1954
9 Ga0070658_10806972 3300005327 Unclassified 815
10 Ga0070658_11207748 3300005327 Unclassified 657
11 Ga0070676_10008258 3300005328 Bacteria 5605
12 Ga0070676_10117752 3300005328 Bacteria 1663
13 Ga0070683_100014483 3300005329 Bacteria 6900
14 Ga0070683_100182935 3300005329 Bacteria 1989
15 Ga0070683_100246859 3300005329 Bacteria 1698
16 Ga0070683_100491578 3300005329 Unclassified 1172
17 Ga0070670_100002360 3300005331 Bacteria 15569
18 Ga0070670_100019068 3300005331 Bacteria 5882
19 Ga0070670_101078672 3300005331 Unclassified 732
20 Ga0070677_10592223 3300005333 Bacteria 613
21 Ga0068869_100006265 3300005334 Bacteria 7533
22 Ga0068869_100039420 3300005334 Bacteria 3372
23 Ga0070666_10230028 3300005335 Bacteria 1309
24 Ga0070680_100014422 3300005336 Bacteria 6177
25 Ga0070680_100854298 3300005336 Bacteria 785
26 Ga0070682_100253413 3300005337 Bacteria 1270
27 Ga0068868_100014161 3300005338 Bacteria 5872
28 Ga0068868_100181414 3300005338 Bacteria 1747
29 Ga0070660_100026123 3300005339 Bacteria 4347
30 Ga0070660_100102429 3300005339 Bacteria 2269
31 Ga0070660_100261716 3300005339 Bacteria 1413
32 Ga0070689_100367684 3300005340 Bacteria 1209
33 Ga0070687_100063526 3300005343 Bacteria 1958
34 Ga0070687_100075434 3300005343 Bacteria 1823
35 Ga0070661_100007857 3300005344 Bacteria 7363
36 Ga0070661_100015286 3300005344 Bacteria 5417
37 Ga0070661_100091926 3300005344 Unclassified 2248
38 Ga0070661_100152310 3300005344 Bacteria 1748
39 Ga0070692_10021957 3300005345 Bacteria 3112
40 Ga0070692_10310746 3300005345 Bacteria 966
41 Ga0070692_10445834 3300005345 Unclassified 827
42 Ga0070668_100003507 3300005347 Bacteria 11564
43 Ga0070668_100007165 3300005347 Bacteria 8265
44 Ga0070668_100132097 3300005347 Bacteria 2005
45 Ga0070668_100265394 3300005347 Bacteria 1429
46 Ga0070669_100005386 3300005353 Bacteria 9229
47 Ga0070669_100016051 3300005353 Bacteria 5343
48 Ga0070669_100109827 3300005353 Bacteria 2091
49 Ga0070675_100003453 3300005354 Bacteria 11974
50 Ga0070675_100005649 3300005354 Bacteria 9576
51 Ga0070675_100015296 3300005354 Bacteria 6063
52 Ga0070675_100070659 3300005354 Bacteria 2894
53 Ga0070675_100142781 3300005354 Bacteria 2047
54 Ga0070675_100512709 3300005354 Bacteria 1081
55 Ga0070671_100332857 3300005355 Archaea 1294
56 Ga0070671_100479828 3300005355 Bacteria 1068
57 Ga0070671_100622158 3300005355 Unclassified 934
58 Ga0070674_100009299 3300005356 Bacteria 5883
59 Ga0070674_100657015 3300005356 Unclassified 892
60 Ga0070673_100014852 3300005364 Bacteria 5447
61 Ga0070673_100046629 3300005364 Bacteria 3367
62 Ga0070673_100354610 3300005364 Unclassified 1302
63 Ga0070659_100002970 3300005366 Bacteria 12086
64 Ga0070659_100078523 3300005366 Bacteria 2633
65 Ga0070659_100373081 3300005366 Bacteria 1200
66 Ga0070667_100246100 3300005367 Bacteria 1597
67 Ga0070667_100417728 3300005367 Bacteria 1222
68 Ga0070709_10019461 3300005434 Bacteria 3925
69 Ga0070714_100013164 3300005435 Bacteria 6624
70 Ga0070714_100185464 3300005435 Bacteria 1895
71 Ga0070701_10016308 3300005438 Unclassified 3451
72 Ga0070700_100037361 3300005441 Bacteria 2953
73 Ga0070700_100039699 3300005441 Unclassified 2877
74 Ga0070700_100183499 3300005441 Bacteria 1458
75 Ga0070694_100018928 3300005444 Bacteria 4375
76 Ga0070708_100000549 3300005445 Bacteria 28032
77 Ga0070708_101509055 3300005445 Unclassified 626
78 Ga0070663_100144752 3300005455 Bacteria 1817
79 Ga0070663_101000445 3300005455 Bacteria 727
80 Ga0070678_100187030 3300005456 Bacteria 1700
81 Ga0070662_100039665 3300005457 Bacteria 3349
82 Ga0070681_10005175 3300005458 Bacteria 12587
83 Ga0070681_10466664 3300005458 Bacteria 1175
84 Ga0068867_100003303 3300005459 Bacteria 11360
85 Ga0068867_100090056 3300005459 Unclassified 2327
86 Ga0068867_101057667 3300005459 Archaea 739
87 Ga0068867_101149374 3300005459 Unclassified 711
88 Ga0070685_10029775 3300005466 Bacteria 3036
89 Ga0070685_10453235 3300005466 Bacteria 899
90 Ga0070706_100013431 3300005467 Bacteria 7571
91 Ga0070707_100174436 3300005468 Bacteria 2095
92 Ga0070679_100040835 3300005530 Bacteria 4617
93 Ga0070679_100043147 3300005530 Bacteria 4493
94 Ga0070684_100010868 3300005535 Bacteria 7232
95 Ga0070684_100168366 3300005535 Bacteria 1990
96 Ga0070684_100225046 3300005535 Bacteria 1712
97 Ga0068853_100039815 3300005539 Unclassified 4010
98 Ga0068853_100076221 3300005539 Unclassified 2928
99 Ga0068853_100108815 3300005539 Bacteria 2459
100 Ga0068853_100818976 3300005539 Bacteria 892
101 Ga0070672_100062383 3300005543 Bacteria 2941
102 Ga0070686_100050980 3300005544 Bacteria 2632
103 Ga0070686_100250980 3300005544 Bacteria 1292
104 Ga0070695_100224104 3300005545 Bacteria 1356
105 Ga0070693_100083635 3300005547 Bacteria 1908
106 Ga0070693_100583078 3300005547 Unclassified 805
107 Ga0070665_100190857 3300005548 Bacteria 2050
108 Ga0070665_100317148 3300005548 Bacteria 1563
109 Ga0068855_100004397 3300005563 Bacteria 17227
110 Ga0070664_100013461 3300005564 Bacteria 6661
111 Ga0070664_100016779 3300005564 Bacteria 6009
112 Ga0070664_100139684 3300005564 Bacteria 2132
113 Ga0070664_100390400 3300005564 Bacteria 1272
114 Ga0068857_100002445 3300005577 Bacteria 15168
115 Ga0068857_100049556 3300005577 Bacteria 3726
116 Ga0068857_100307912 3300005577 Bacteria 1461
117 Ga0068857_100627639 3300005577 Bacteria 1017
118 Ga0068854_100344329 3300005578 Unclassified 1218
119 Ga0068854_100453166 3300005578 Unclassified 1072
120 Ga0068854_100905518 3300005578 Unclassified 775
121 Ga0068856_100065647 3300005614 Bacteria 3586
122 Ga0068856_100103847 3300005614 Unclassified 2835
123 Ga0068856_100185335 3300005614 Bacteria 2095
124 Ga0068856_100398536 3300005614 Unclassified 1396
125 Ga0070702_100023025 3300005615 Bacteria 3303
126 Ga0068852_100007615 3300005616 Bacteria 7919
127 Ga0068852_100171263 3300005616 Bacteria 2035
128 Ga0068852_100718559 3300005616 Bacteria 1010
129 Ga0068852_100772188 3300005616 Unclassified 974
130 Ga0068859_100103582 3300005617 Bacteria 2904
131 Ga0068859_100734853 3300005617 Bacteria 1076
132 Ga0068859_100890126 3300005617 Unclassified 975
133 Ga0068859_101565542 3300005617 Bacteria 728
134 Ga0068864_100111466 3300005618 Bacteria 2438
135 Ga0068864_100639850 3300005618 Bacteria 1035
136 Ga0068866_10073784 3300005718 Bacteria 1812
137 Ga0068861_100038703 3300005719 Bacteria 3555
138 Ga0068861_100150275 3300005719 Bacteria 1910
139 Ga0068861_100235667 3300005719 Bacteria 1554
140 Ga0068851_10014463 3300005834 Bacteria 3747
141 Ga0068851_10080955 3300005834 Bacteria 1696
142 Ga0068870_10038207 3300005840 Bacteria 2478
143 Ga0068863_100046674 3300005841 Bacteria 4112
144 Ga0068863_100163675 3300005841 Bacteria 2132
145 Ga0068858_100093941 3300005842 Bacteria 2793
146 Ga0068860_100068854 3300005843 Bacteria 3363
147 Ga0068860_100165813 3300005843 Bacteria 2132
148 Ga0068860_100368520 3300005843 Bacteria 1416
149 Ga0068862_100006990 3300005844 Bacteria 9367
150 Ga0068862_100007789 3300005844 Bacteria 8856
151 Ga0068862_100015820 3300005844 Bacteria 6268
152 Ga0068862_100755233 3300005844 Bacteria 946
153 Ga0070717_10399674 3300006028 Bacteria 1234
154 Ga0070717_10627473 3300006028 Unclassified 975
155 Ga0075363_100242634 3300006048 Bacteria 1036
156 Ga0075364_10038436 3300006051 Bacteria 3100
157 Ga0070712_100157210 3300006175 Bacteria 1752
158 Ga0075367_10067827 3300006178 Bacteria 2139
159 Ga0075366_10039015 3300006195 Bacteria 2805
160 Ga0097621_100249818 3300006237 Bacteria 1553
161 Ga0075370_10038785 3300006353 Bacteria 2682
162 Ga0068871_100541009 3300006358 Unclassified 1054
163 Ga0075428_100007529 3300006844 Bacteria 12070
164 Ga0075428_100108496 3300006844 Bacteria 3025
165 Ga0075428_100130137 3300006844 Bacteria 2738
166 Ga0075428_100296609 3300006844 Bacteria 1738
167 Ga0075428_100300181 3300006844 Bacteria 1727
168 Ga0075430_100031103 3300006846 Bacteria 4532
169 Ga0075430_100110582 3300006846 Bacteria 2291
170 Ga0075430_100267628 3300006846 Bacteria 1415
171 Ga0075430_100295188 3300006846 Bacteria 1340
172 Ga0075430_100925654 3300006846 Unclassified 718
173 Ga0075431_100005786 3300006847 Bacteria 12230
174 Ga0075431_100012814 3300006847 Bacteria 8465
175 Ga0075431_100016752 3300006847 Bacteria 7443
176 Ga0075431_101614354 3300006847 Unclassified 606
177 Ga0075433_10017889 3300006852 Bacteria 5879
178 Ga0075433_10055898 3300006852 Bacteria 3447
179 Ga0075433_10083606 3300006852 Unclassified 2817
180 Ga0075434_100003413 3300006871 Bacteria 14219
181 Ga0075434_100012742 3300006871 Bacteria 7980
182 Ga0075429_100007119 3300006880 Bacteria 9716
183 Ga0075429_100016606 3300006880 Bacteria 6377
184 Ga0075429_100056512 3300006880 Unclassified 3416
185 Ga0075429_100137432 3300006880 Bacteria 2139
186 Ga0075429_100339603 3300006880 Unclassified 1315
187 Ga0068865_100001380 3300006881 Bacteria 14125
188 Ga0068865_100013347 3300006881 Bacteria 5190
189 Ga0097620_100103581 3300006931 Bacteria 2904
190 Ga0097620_100734884 3300006931 Bacteria 1076
191 Ga0097620_100890166 3300006931 Unclassified 975
192 Ga0097620_101565507 3300006931 Bacteria 728
193 Ga0111539_10003086 3300009094 Bacteria 22081
194 Ga0111539_10050033 3300009094 Bacteria 4980
195 Ga0111539_10152570 3300009094 Bacteria 2704
196 Ga0111539_10222579 3300009094 Bacteria 2198
197 Ga0105245_10200566 3300009098 Bacteria 1916
198 Ga0105247_10178899 3300009101 Unclassified 1414
199 Ga0114129_10271057 3300009147 Bacteria 2271
200 Ga0105243_10094607 3300009148 Unclassified 2467
201 Ga0105243_10155339 3300009148 Bacteria 1967
202 Ga0105243_10504333 3300009148 Bacteria 1147
203 Ga0105241_10021416 3300009174 Unclassified 4778
204 Ga0105242_10154767 3300009176 Bacteria 2002
205 Ga0105242_11196845 3300009176 Unclassified 779
206 Ga0105248_10017843 3300009177 Bacteria 7832
207 Ga0105248_10064193 3300009177 Bacteria 4122
208 Ga0105248_10140482 3300009177 Bacteria 2724
209 Ga0105248_10199746 3300009177 Unclassified 2253
210 Ga0105237_10043601 3300009545 Bacteria 4519
211 Ga0105237_10638039 3300009545 Bacteria 1072
212 Ga0105238_10016055 3300009551 Bacteria 7574
213 Ga0105238_10477096 3300009551 Unclassified 1246
214 Ga0105249_10007115 3300009553 Bacteria 9767
215 Ga0105249_10008473 3300009553 Bacteria 8959
216 Ga0105249_10043333 3300009553 Bacteria 4093
217 Ga0105249_10665231 3300009553 Unclassified 1100
218 Ga0105239_10013494 3300010375 Bacteria 9071
219 Ga0105246_10211321 3300011119 Bacteria 1515
220 Ga0105246_10340339 3300011119 Unclassified 1226
221 Ga0157373_10412271 3300013100 Unclassified 969
222 Ga0157373_10750879 3300013100 Unclassified 717
223 Ga0157371_10027709 3300013102 Bacteria 4108
224 Ga0157371_10082136 3300013102 Bacteria 2282
225 Ga0157370_10001160 3300013104 Bacteria 32869
226 Ga0157374_10139122 3300013296 Unclassified 2356
227 Ga0157378_10040989 3300013297 Bacteria 4107
228 Ga0157378_10088144 3300013297 Bacteria 2816
229 Ga0157378_10201273 3300013297 Bacteria 1884
230 Ga0157378_10612429 3300013297 Unclassified 1101
231 Ga0157378_11180602 3300013297 Bacteria 804
232 Ga0163162_10008770 3300013306 Bacteria 9831
233 Ga0163162_10057166 3300013306 Bacteria 3928
234 Ga0163162_10070009 3300013306 Bacteria 3560
235 Ga0157372_10048583 3300013307 Bacteria 4717
236 Ga0157372_10105103 3300013307 Bacteria 3230
237 Ga0157372_10280798 3300013307 Bacteria 1936
238 Ga0157372_11390139 3300013307 Bacteria 809
239 Ga0157375_10066587 3300013308 Bacteria 3597
240 Ga0163163_10407262 3300014325 Bacteria 1418
241 Ga0163163_10418316 3300014325 Unclassified 1399
242 Ga0163163_10573234 3300014325 Unclassified 1192
243 Ga0157380_10061772 3300014326 Bacteria 2999
244 Ga0157380_11595662 3300014326 Bacteria 708
245 Ga0157377_10008132 3300014745 Bacteria 5100
246 Ga0157377_10132802 3300014745 Bacteria 1522
247 Ga0157379_10126235 3300014968 Bacteria 2302
248 Ga0157379_10343051 3300014968 Unclassified 1366
249 Ga0157376_10382891 3300014969 Bacteria 1355
250 Ga0182007_10017805 3300015262 Bacteria 2586
251 Ga0182005_1043880 3300015265 Bacteria 1215
252 Ga0209565_1000010 3300025263 Bacteria 687724
253 Ga0209673_1002171 3300025273 Bacteria 14487
254 Ga0209050_1020467 3300025298 Bacteria 2462
255 Ga0209256_1000012 3300025299 Bacteria 790371
256 Ga0209257_1002251 3300025304 Bacteria 19776
257 Ga0207697_10007270 3300025315 Bacteria 4945
258 Ga0207656_10018365 3300025321 Bacteria 2753
259 Ga0207656_10086513 3300025321 Bacteria 1417
260 Ga0207682_10146621 3300025893 Bacteria 1062
261 Ga0207642_10237335 3300025899 Unclassified 1028
262 Ga0207710_10378724 3300025900 Bacteria 724
263 Ga0207688_10120289 3300025901 Bacteria 1532
264 Ga0207680_10229458 3300025903 Unclassified 1276
265 Ga0207699_10336514 3300025906 Unclassified 1062
266 Ga0207645_10003392 3300025907 Bacteria 12110
267 Ga0207645_10146045 3300025907 Bacteria 1542
268 Ga0207643_10034777 3300025908 Bacteria 2824
269 Ga0207705_11381399 3300025909 Unclassified 536
270 Ga0207684_10130512 3300025910 Unclassified 2157
271 Ga0207654_10304134 3300025911 Unclassified 1085
272 Ga0207654_10378195 3300025911 Unclassified 980
273 Ga0207707_10010283 3300025912 Bacteria 8119
274 Ga0207671_10325097 3300025914 Bacteria 1217
275 Ga0207693_10154667 3300025915 Bacteria 1804
276 Ga0207660_10030966 3300025917 Bacteria 3681
277 Ga0207660_10048489 3300025917 Bacteria 3006
278 Ga0207662_10118343 3300025918 Bacteria 1659
279 Ga0207657_10067434 3300025919 Bacteria 3042
280 Ga0207657_10259610 3300025919 Bacteria 1383
281 Ga0207649_10003517 3300025920 Bacteria 8563
282 Ga0207649_10022916 3300025920 Bacteria 3610
283 Ga0207649_10112435 3300025920 Bacteria 1822
284 Ga0207652_10109943 3300025921 Bacteria 2444
285 Ga0207681_10008474 3300025923 Bacteria 6283
286 Ga0207681_10046863 3300025923 Bacteria 2908
287 Ga0207681_10079554 3300025923 Unclassified 2310
288 Ga0207694_10368819 3300025924 Bacteria 1190
289 Ga0207650_10091536 3300025925 Bacteria 2324
290 Ga0207650_10097439 3300025925 Bacteria 2258
291 Ga0207650_10165732 3300025925 Bacteria 1753
292 Ga0207659_10011647 3300025926 Bacteria 5564
293 Ga0207659_10034153 3300025926 Bacteria 3505
294 Ga0207659_10053873 3300025926 Bacteria 2870
295 Ga0207687_10739367 3300025927 Bacteria 837
296 Ga0207664_10043971 3300025929 Bacteria 3496
297 Ga0207644_10039411 3300025931 Bacteria 3335
298 Ga0207644_10180709 3300025931 Bacteria 1653
299 Ga0207644_10373912 3300025931 Archaea 1161
300 Ga0207690_10106799 3300025932 Bacteria 2009
301 Ga0207690_10425547 3300025932 Unclassified 1063
302 Ga0207706_10038674 3300025933 Bacteria 4232
303 Ga0207706_10676529 3300025933 Unclassified 883
304 Ga0207686_10137356 3300025934 Unclassified 1685
305 Ga0207686_10263227 3300025934 Archaea 1265
306 Ga0207709_10224768 3300025935 Bacteria 1356
307 Ga0207709_10388963 3300025935 Bacteria 1063
308 Ga0207669_10339873 3300025937 Bacteria 1156
309 Ga0207704_10119072 3300025938 Bacteria 1802
310 Ga0207691_10007687 3300025940 Bacteria 10377
311 Ga0207691_10032726 3300025940 Unclassified 4846
312 Ga0207691_10218116 3300025940 Bacteria 1655
313 Ga0207711_10031296 3300025941 Bacteria 4492
314 Ga0207711_10290955 3300025941 Bacteria 1505
315 Ga0207711_10529185 3300025941 Unclassified 1099
316 Ga0207689_10025503 3300025942 Unclassified 4954
317 Ga0207661_10175227 3300025944 Bacteria 1869
318 Ga0207679_10024622 3300025945 Bacteria 4128
319 Ga0207679_10091488 3300025945 Bacteria 2354
320 Ga0207679_10102290 3300025945 Bacteria 2243
321 Ga0207679_10144041 3300025945 Bacteria 1930
322 Ga0207651_10176091 3300025960 Bacteria 1692
323 Ga0207651_10767557 3300025960 Bacteria 853
324 Ga0207712_10014638 3300025961 Bacteria 5052
325 Ga0207712_10480076 3300025961 Unclassified 1059
326 Ga0207668_10094299 3300025972 Bacteria 2207
327 Ga0207640_10181853 3300025981 Unclassified 1577
328 Ga0207658_10038976 3300025986 Unclassified 3427
329 Ga0207658_11404506 3300025986 Unclassified 639
330 Ga0207703_10012846 3300026035 Bacteria 6531
331 Ga0207639_10887371 3300026041 Unclassified 833
332 Ga0207678_10005530 3300026067 Bacteria 11289
333 Ga0207678_10644372 3300026067 Bacteria 930
334 Ga0207708_10116127 3300026075 Bacteria 2082
335 Ga0207702_10052875 3300026078 Bacteria 3438
336 Ga0207641_10676329 3300026088 Unclassified 1015
337 Ga0207648_10027299 3300026089 Bacteria 5069
338 Ga0207648_10083599 3300026089 Bacteria 2784
339 Ga0207648_10185277 3300026089 Unclassified 1844
340 Ga0207676_10021180 3300026095 Bacteria 4768
341 Ga0207676_11068725 3300026095 Unclassified 797
342 Ga0207674_10007083 3300026116 Bacteria 13104
343 Ga0207674_10024030 3300026116 Bacteria 6517
344 Ga0207675_100040967 3300026118 Bacteria 4326
345 Ga0207675_100421261 3300026118 Bacteria 1318
346 Ga0207675_100810189 3300026118 Bacteria 950
347 Ga0207683_10507349 3300026121 Bacteria 1114
348 Ga0207698_10003344 3300026142 Bacteria 9654
349 Ga0207698_10333088 3300026142 Bacteria 1426
350 Ga0207428_10181608 3300027907 Archaea 1589
351 Ga0268266_10208235 3300028379 Bacteria 1793
352 Ga0268266_10585437 3300028379 Bacteria 1071
353 Ga0268266_11239499 3300028379 Bacteria 721
354 Ga0268265_10007819 3300028380 Bacteria 7216
355 Ga0268265_10017896 3300028380 Bacteria 4900
356 Ga0268264_10296148 3300028381 Bacteria 1521
357 Ga0268264_10553008 3300028381 Bacteria 1129
358 Ga0268264_11339094 3300028381 Unclassified 726
359 Ga0307405_11155901 3300031731 Bacteria 668
360 Ga0307413_10037879 3300031824 Unclassified 2789
361 Ga0307413_10549099 3300031824 Unclassified 937
362 Ga0307410_10058768 3300031852 Bacteria 2623
363 Ga0307410_10134551 3300031852 Bacteria 1820
364 Ga0307410_10359622 3300031852 Bacteria 1165
365 Ga0307410_11273763 3300031852 Bacteria 642
366 Ga0307407_10026391 3300031903 Bacteria 3075
367 Ga0307407_10093688 3300031903 Bacteria 1847
368 Ga0307407_10138297 3300031903 Bacteria 1568
369 Ga0307409_100037840 3300031995 Bacteria 3561
370 Ga0307409_100304307 3300031995 Bacteria 1485
371 Ga0307409_100581807 3300031995 Bacteria 1104
372 Ga0307409_100841036 3300031995 Unclassified 928
373 Ga0307416_100216737 3300032002 Bacteria 1832
374 Ga0307416_100411009 3300032002 Bacteria 1394
375 Ga0307416_100631808 3300032002 Bacteria 1154
376 Ga0307416_100635277 3300032002 Bacteria 1151
377 Ga0307414_10478660 3300032004 Unclassified 1098
378 Ga0307411_10056421 3300032005 Bacteria 2589
379 Ga0307411_10106691 3300032005 Bacteria 1994
380 Ga0307411_10358127 3300032005 Unclassified 1192
381 Ga0307411_10391972 3300032005 Bacteria 1145
382 Ga0373926_0296232 3300035083 Unclassified 631
383 Ga0373928_0062755 3300035084 Bacteria 902
384 Ga0373940_0256655 3300035088 Bacteria 591
385 Ga0373951_0186905 3300035091 Archaea 598
386 Ga0373941_0159221 3300035115 Unclassified 834
387 Ga0373961_0071312 3300035241 Bacteria 1075
388 Ga0373931_0198877 3300035691 Bacteria 1196
389 Ga0373931_0523308 3300035691 Unclassified 768
390 Ga0373947_0080606 3300035725 Bacteria 2014
391 Ga0395905_0252088 3300037471 Bacteria 1649
392 Ga0395905_0417331 3300037471 Unclassified 1238
393 Ga0395905_0684442 3300037471 Unclassified 928
394 Ga0242420_010494 3300038996 Bacteria 1540
395 Ga0439439_0091431 3300041406 Bacteria 831
396 Ga0451839_1317178 3300041496 Bacteria 1713
397 Ga0439431_0169993 3300041997 Unclassified 626
398 Ga0439433_0120091 3300041999 Unclassified 662
399 Ga0439448_0218381 3300042005 Unclassified 670
400 Ga0439462_0039547 3300042015 Unclassified 1257
401 Ga0439446_0004451 3300042156 Bacteria 3553
402 Ga0439464_0084575 3300042439 Unclassified 951
403 Ga0466966_0075873 3300044684 Bacteria 2100
404 Ga0466961_0085825 3300044693 Bacteria 1990
405 Ga0466957_1194616 3300044842 Bacteria 550
406 Ga0466959_0021981 3300045049 Bacteria 4712
407 Ga0451576_0519077 3300045051 Unclassified 1251
408 Ga0495629_0529574 3300046459 Unclassified 792
409 Ga0495629_0725762 3300046459 Bacteria 659
410 Ga0495582_0100187 3300046473 Bacteria 1622
411 Ga0495586_0231982 3300046535 Unclassified 1050
412 Ga0495586_0351938 3300046535 Unclassified 846
413 Ga0495598_0358639 3300046537 Unclassified 563
414 Ga0495667_0101662 3300046559 Unclassified 1859
415 Ga0495599_0211299 3300046678 Bacteria 1189
416 Ga0495672_0003738 3300047320 Bacteria 12845
417 Ga0495602_0554525 3300048088 Bacteria 796
418 Ga0496100_0004448 3300048903 Bacteria 7435
419 Ga0496101_0013667 3300048904 Bacteria 5445
420 Ga0496102_0112209 3300048905 Unclassified 2542
421 Ga0496102_0150803 3300048905 Bacteria 2184
422 Ga0496102_1090378 3300048905 Bacteria 718
423 Ga0496103_0086056 3300048906 Bacteria 1981
424 Ga0496103_0494470 3300048906 Unclassified 783
425 Ga0496104_0011257 3300048907 Bacteria 8006
426 Ga0496104_0197495 3300048907 Bacteria 1923
427 Ga0496105_0020357 3300048908 Bacteria 5361
428 Ga0496106_0096806 3300048909 Bacteria 2284
429 Ga0496106_0289653 3300048909 Unclassified 1313
430 Ga0496107_0009485 3300048910 Bacteria 6750
431 Ga0496107_0673745 3300048910 Bacteria 762
432 Ga0496108_0001945 3300048911 Bacteria 16548
433 Ga0496108_0061326 3300048911 Bacteria 3164
434 Ga0496108_0140674 3300048911 Bacteria 2079
435 Ga0496108_1042815 3300048911 Unclassified 697
436 Ga0496109_0001120 3300048912 Bacteria 22267
437 Ga0496109_0019280 3300048912 Bacteria 6011
438 Ga0496109_0062394 3300048912 Bacteria 3408
439 Ga0496110_0000205 3300048913 Bacteria 37706
440 Ga0496110_0004175 3300048913 Bacteria 11155
441 Ga0496111_0008780 3300048914 Bacteria 6711
442 Ga0496112_0030619 3300048915 Bacteria 5210
443 Ga0496112_0031472 3300048915 Bacteria 5146
444 Ga0496113_0002432 3300048916 Bacteria 10822
445 Ga0496113_0064063 3300048916 Bacteria 2779
446 Ga0496113_0071803 3300048916 Bacteria 2633
447 Ga0496114_0071614 3300048917 Bacteria 2914
448 Ga0496115_0214067 3300048918 Bacteria 1591
449 Ga0501032_0094896 3300049569 Unclassified 1978
450 Ga0501033_0186150 3300049570 Unclassified 1487
451 Ga0501037_0697577 3300049573 Bacteria 676
452 Ga0501040_0016366 3300049576 Bacteria 4909
453 Ga0501041_0016240 3300049577 Bacteria 4425
454 Ga0501042_0208025 3300049578 Bacteria 1411
455 Ga0501043_0065649 3300049579 Bacteria 2850
456 Ga0501043_0247335 3300049579 Unclassified 1374
457 Ga0501043_0332564 3300049579 Bacteria 1157
458 Ga0501046_0074779 3300049580 Bacteria 2628
459 Ga0501047_0000741 3300049581 Bacteria 34031
460 Ga0501047_0821327 3300049581 Bacteria 744
461 Ga0501069_0057908 3300049585 Bacteria 2161
462 Ga0501070_0222844 3300049586 Bacteria 1546
463 Ga0501070_0544381 3300049586 Bacteria 930
464 Ga0501073_0968415 3300049589 Bacteria 585
465 Ga0501074_0495566 3300049590 Bacteria 866
466 Ga0501076_0119052 3300049592 Bacteria 2138
467 Ga0501076_1098130 3300049592 Archaea 655
468 Ga0501079_0031786 3300049741 Bacteria 4056
469 Ga0501081_0028293 3300049743 Bacteria 3782
470 Ga0501283_071152 3300049779 Bacteria 641
471 Ga0501035_0001286 3300049822 Bacteria 25912
472 Ga0501044_0004454 3300049823 Bacteria 15668
473 Ga0501044_0122251 3300049823 Bacteria 2603
474 Ga0501044_1279468 3300049823 Bacteria 600
475 nmdc:mga05p37_163067_c1 3300050507 Bacteria 2721
476 nmdc:mga09592_283649_c1 3300050508 Unclassified 1436
477 nmdc:mga09592_452704_c1 3300050508 Bacteria 1107
478 nmdc:mga09592_530205_c1 3300050508 Bacteria 1012
479 nmdc:mga09592_634111_c1 3300050508 Unclassified 913
480 nmdc:mga0qj67_141779_c1 3300050509 Bacteria 1949
481 nmdc:mga0qj67_99004_c1 3300050509 Bacteria 2349
482 nmdc:mga06r32_101415_c1 3300050510 Bacteria 2825
483 nmdc:mga06r32_212228_c1 3300050510 Unclassified 1923
484 nmdc:mga06r32_275511_c1 3300050510 Archaea 1670
485 nmdc:mga06r32_954387_c1 3300050510 Bacteria 812
486 nmdc:mga08y16_113582_c1 3300050511 Bacteria 2819
487 nmdc:mga08y16_150194_c1 3300050511 Unclassified 2422
488 nmdc:mga0n895_13287_c1 3300050512 Bacteria 7422
489 nmdc:mga0n895_965_c1 3300050512 Bacteria 20843
490 nmdc:mga0a205_12315_c1 3300050515 Bacteria 7910
491 nmdc:mga0a205_8107_c2 3300050515 Bacteria 5528
492 Ga0495601_0003949 3300053077 Bacteria 8539
493 Ga0495595_0016173 3300053084 Bacteria 3187
494 Ga0495619_0011141 3300053085 Bacteria 5658
495 Ga0500562_144421 3300053108 Bacteria 648
496 Ga0590071_035475 3300059421 Bacteria 1194
497 Ga0590075_004885 3300059424 Unclassified 3172
498 Ga0590077_013649 3300059426 Unclassified 1690
499 Ga0590077_044644 3300059426 Bacteria 989
500 Ga0590077_088230 3300059426 Bacteria 718
501 Ga0501082_0056055 3300060353 Bacteria 3394
502 Ga0530510_0103946 3300061734 Bacteria 2078
503 Ga0530510_0355406 3300061734 Unclassified 1101
504 Ga0114129_10007440
505 rootH1_10058731
506 Ga0055524_1000163
507 Ga0055531_10009783
508 Ga0065712_10385741
509 Ga0065715_10164089
510 Ga0065707_10133439
511 Ga0070658_10149671
512 Ga0070658_10806972
513 Ga0070658_11207748
514 Ga0070676_10008258
515 Ga0070676_10117752
516 Ga0070683_100014483
517 Ga0070683_100182935
518 Ga0070683_100246859
519 Ga0070683_100491578
520 Ga0070670_100002360
521 Ga0070670_100019068
522 Ga0070670_101078672
523 Ga0070677_10592223
524 Ga0068869_100006265
525 Ga0068869_100039420
526 Ga0070666_10230028
527 Ga0070680_100014422
528 Ga0070680_100854298
529 Ga0070682_100253413
530 Ga0068868_100014161
531 Ga0068868_100181414
532 Ga0070660_100026123
533 Ga0070660_100102429
534 Ga0070660_100261716
535 Ga0070689_100367684
536 Ga0070687_100063526
537 Ga0070687_100075434
538 Ga0070661_100007857
539 Ga0070661_100015286
540 Ga0070661_100091926
541 Ga0070661_100152310
542 Ga0070692_10021957
543 Ga0070692_10310746
544 Ga0070692_10445834
545 Ga0070668_100003507
546 Ga0070668_100007165
547 Ga0070668_100132097
548 Ga0070668_100265394
549 Ga0070669_100005386
550 Ga0070669_100016051
551 Ga0070669_100109827
552 Ga0070675_100003453
553 Ga0070675_100005649
554 Ga0070675_100015296
555 Ga0070675_100070659
556 Ga0070675_100142781
557 Ga0070675_100512709
558 Ga0070671_100332857
559 Ga0070671_100479828
560 Ga0070671_100622158
561 Ga0070674_100009299
562 Ga0070674_100657015
563 Ga0070673_100014852
564 Ga0070673_100046629
565 Ga0070673_100354610
566 Ga0070659_100002970
567 Ga0070659_100078523
568 Ga0070659_100373081
569 Ga0070667_100246100
570 Ga0070667_100417728
571 Ga0070709_10019461
572 Ga0070714_100013164
573 Ga0070714_100185464
574 Ga0070701_10016308
575 Ga0070700_100037361
576 Ga0070700_100039699
577 Ga0070700_100183499
578 Ga0070694_100018928
579 Ga0070708_100000549
580 Ga0070708_101509055
581 Ga0070663_100144752
582 Ga0070663_101000445
583 Ga0070678_100187030
584 Ga0070662_100039665
585 Ga0070681_10005175
586 Ga0070681_10466664
587 Ga0068867_100003303
588 Ga0068867_100090056
589 Ga0068867_101057667
590 Ga0068867_101149374
591 Ga0070685_10029775
592 Ga0070685_10453235
593 Ga0070706_100013431
594 Ga0070707_100174436
595 Ga0070679_100040835
596 Ga0070679_100043147
597 Ga0070684_100010868
598 Ga0070684_100168366
599 Ga0070684_100225046
600 Ga0068853_100039815
601 Ga0068853_100076221
602 Ga0068853_100108815
603 Ga0068853_100818976
604 Ga0070672_100062383
605 Ga0070686_100050980
606 Ga0070686_100250980
607 Ga0070695_100224104
608 Ga0070693_100083635
609 Ga0070693_100583078
610 Ga0070665_100190857
611 Ga0070665_100317148
612 Ga0068855_100004397
613 Ga0070664_100013461
614 Ga0070664_100016779
615 Ga0070664_100139684
616 Ga0070664_100390400
617 Ga0068857_100002445
618 Ga0068857_100049556
619 Ga0068857_100307912
620 Ga0068857_100627639
621 Ga0068854_100344329
622 Ga0068854_100453166
623 Ga0068854_100905518
624 Ga0068856_100065647
625 Ga0068856_100103847
626 Ga0068856_100185335
627 Ga0068856_100398536
628 Ga0070702_100023025
629 Ga0068852_100007615
630 Ga0068852_100171263
631 Ga0068852_100718559
632 Ga0068852_100772188
633 Ga0068859_100103582
634 Ga0068859_100734853
635 Ga0068859_100890126
636 Ga0068859_101565542
637 Ga0068864_100111466
638 Ga0068864_100639850
639 Ga0068866_10073784
640 Ga0068861_100038703
641 Ga0068861_100150275
642 Ga0068861_100235667
643 Ga0068851_10014463
644 Ga0068851_10080955
645 Ga0068870_10038207
646 Ga0068863_100046674
647 Ga0068863_100163675
648 Ga0068858_100093941
649 Ga0068860_100068854
650 Ga0068860_100165813
651 Ga0068860_100368520
652 Ga0068862_100006990
653 Ga0068862_100007789
654 Ga0068862_100015820
655 Ga0068862_100755233
656 Ga0070717_10399674
657 Ga0070717_10627473
658 Ga0075363_100242634
659 Ga0075364_10038436
660 Ga0070712_100157210
661 Ga0075367_10067827
662 Ga0075366_10039015
663 Ga0097621_100249818
664 Ga0075370_10038785
665 Ga0068871_100541009
666 Ga0075428_100007529
667 Ga0075428_100108496
668 Ga0075428_100130137
669 Ga0075428_100296609
670 Ga0075428_100300181
671 Ga0075430_100031103
672 Ga0075430_100110582
673 Ga0075430_100267628
674 Ga0075430_100295188
675 Ga0075430_100925654
676 Ga0075431_100005786
677 Ga0075431_100012814
678 Ga0075431_100016752
679 Ga0075431_101614354
680 Ga0075433_10017889
681 Ga0075433_10055898
682 Ga0075433_10083606
683 Ga0075434_100003413
684 Ga0075434_100012742
685 Ga0075429_100007119
686 Ga0075429_100016606
687 Ga0075429_100056512
688 Ga0075429_100137432
689 Ga0075429_100339603
690 Ga0068865_100001380
691 Ga0068865_100013347
692 Ga0097620_100103581
693 Ga0097620_100734884
694 Ga0097620_100890166
695 Ga0097620_101565507
696 Ga0111539_10003086
697 Ga0111539_10050033
698 Ga0111539_10152570
699 Ga0111539_10222579
700 Ga0105245_10200566
701 Ga0105247_10178899
702 Ga0114129_10271057
703 Ga0105243_10094607
704 Ga0105243_10155339
705 Ga0105243_10504333
706 Ga0105241_10021416
707 Ga0105242_10154767
708 Ga0105242_11196845
709 Ga0105248_10017843
710 Ga0105248_10064193
711 Ga0105248_10140482
712 Ga0105248_10199746
713 Ga0105237_10043601
714 Ga0105237_10638039
715 Ga0105238_10016055
716 Ga0105238_10477096
717 Ga0105249_10007115
718 Ga0105249_10008473
719 Ga0105249_10043333
720 Ga0105249_10665231
721 Ga0105239_10013494
722 Ga0105246_10211321
723 Ga0105246_10340339
724 Ga0157373_10412271
725 Ga0157373_10750879
726 Ga0157371_10027709
727 Ga0157371_10082136
728 Ga0157370_10001160
729 Ga0157374_10139122
730 Ga0157378_10040989
731 Ga0157378_10088144
732 Ga0157378_10201273
733 Ga0157378_10612429
734 Ga0157378_11180602
735 Ga0163162_10008770
736 Ga0163162_10057166
737 Ga0163162_10070009
738 Ga0157372_10048583
739 Ga0157372_10105103
740 Ga0157372_10280798
741 Ga0157372_11390139
742 Ga0157375_10066587
743 Ga0163163_10407262
744 Ga0163163_10418316
745 Ga0163163_10573234
746 Ga0157380_10061772
747 Ga0157380_11595662
748 Ga0157377_10008132
749 Ga0157377_10132802
750 Ga0157379_10126235
751 Ga0157379_10343051
752 Ga0157376_10382891
753 Ga0182007_10017805
754 Ga0182005_1043880
755 Ga0209565_1000010
756 Ga0209673_1002171
757 Ga0209050_1020467
758 Ga0209256_1000012
759 Ga0209257_1002251
760 Ga0207697_10007270
761 Ga0207656_10018365
762 Ga0207656_10086513
763 Ga0207682_10146621
764 Ga0207642_10237335
765 Ga0207710_10378724
766 Ga0207688_10120289
767 Ga0207680_10229458
768 Ga0207699_10336514
769 Ga0207645_10003392
770 Ga0207645_10146045
771 Ga0207643_10034777
772 Ga0207705_11381399
773 Ga0207684_10130512
774 Ga0207654_10304134
775 Ga0207654_10378195
776 Ga0207707_10010283
777 Ga0207671_10325097
778 Ga0207693_10154667
779 Ga0207660_10030966
780 Ga0207660_10048489
781 Ga0207662_10118343
782 Ga0207657_10067434
783 Ga0207657_10259610
784 Ga0207649_10003517
785 Ga0207649_10022916
786 Ga0207649_10112435
787 Ga0207652_10109943
788 Ga0207681_10008474
789 Ga0207681_10046863
790 Ga0207681_10079554
791 Ga0207694_10368819
792 Ga0207650_10091536
793 Ga0207650_10097439
794 Ga0207650_10165732
795 Ga0207659_10011647
796 Ga0207659_10034153
797 Ga0207659_10053873
798 Ga0207687_10739367
799 Ga0207664_10043971
800 Ga0207644_10039411
801 Ga0207644_10180709
802 Ga0207644_10373912
803 Ga0207690_10106799
804 Ga0207690_10425547
805 Ga0207706_10038674
806 Ga0207706_10676529
807 Ga0207686_10137356
808 Ga0207686_10263227
809 Ga0207709_10224768
810 Ga0207709_10388963
811 Ga0207669_10339873
812 Ga0207704_10119072
813 Ga0207691_10007687
814 Ga0207691_10032726
815 Ga0207691_10218116
816 Ga0207711_10031296
817 Ga0207711_10290955
818 Ga0207711_10529185
819 Ga0207689_10025503
820 Ga0207661_10175227
821 Ga0207679_10024622
822 Ga0207679_10091488
823 Ga0207679_10102290
824 Ga0207679_10144041
825 Ga0207651_10176091
826 Ga0207651_10767557
827 Ga0207712_10014638
828 Ga0207712_10480076
829 Ga0207668_10094299
830 Ga0207640_10181853
831 Ga0207658_10038976
832 Ga0207658_11404506
833 Ga0207703_10012846
834 Ga0207639_10887371
835 Ga0207678_10005530
836 Ga0207678_10644372
837 Ga0207708_10116127
838 Ga0207702_10052875
839 Ga0207641_10676329
840 Ga0207648_10027299
841 Ga0207648_10083599
842 Ga0207648_10185277
843 Ga0207676_10021180
844 Ga0207676_11068725
845 Ga0207674_10007083
846 Ga0207674_10024030
847 Ga0207675_100040967
848 Ga0207675_100421261
849 Ga0207675_100810189
850 Ga0207683_10507349
851 Ga0207698_10003344
852 Ga0207698_10333088
853 Ga0207428_10181608
854 Ga0268266_10208235
855 Ga0268266_10585437
856 Ga0268266_11239499
857 Ga0268265_10007819
858 Ga0268265_10017896
859 Ga0268264_10296148
860 Ga0268264_10553008
861 Ga0268264_11339094
862 Ga0307405_11155901
863 Ga0307413_10037879
864 Ga0307413_10549099
865 Ga0307410_10058768
866 Ga0307410_10134551
867 Ga0307410_10359622
868 Ga0307410_11273763
869 Ga0307407_10026391
870 Ga0307407_10093688
871 Ga0307407_10138297
872 Ga0307409_100037840
873 Ga0307409_100304307
874 Ga0307409_100581807
875 Ga0307409_100841036
876 Ga0307416_100216737
877 Ga0307416_100411009
878 Ga0307416_100631808
879 Ga0307416_100635277
880 Ga0307414_10478660
881 Ga0307411_10056421
882 Ga0307411_10106691
883 Ga0307411_10358127
884 Ga0307411_10391972
885 Ga0373926_0296232
886 Ga0373928_0062755
887 Ga0373940_0256655
888 Ga0373951_0186905
889 Ga0373941_0159221
890 Ga0373961_0071312
891 Ga0373931_0198877
892 Ga0373931_0523308
893 Ga0373947_0080606
894 Ga0395905_0252088
895 Ga0395905_0417331
896 Ga0395905_0684442
897 Ga0242420_010494
898 Ga0439439_0091431
899 Ga0451839_1317178
900 Ga0439431_0169993
901 Ga0439433_0120091
902 Ga0439448_0218381
903 Ga0439462_0039547
904 Ga0439446_0004451
905 Ga0439464_0084575
906 Ga0466966_0075873
907 Ga0466961_0085825
908 Ga0466957_1194616
909 Ga0466959_0021981
910 Ga0451576_0519077
911 Ga0495629_0529574
912 Ga0495629_0725762
913 Ga0495582_0100187
914 Ga0495586_0231982
915 Ga0495586_0351938
916 Ga0495598_0358639
917 Ga0495667_0101662
918 Ga0495599_0211299
919 Ga0495672_0003738
920 Ga0495602_0554525
921 Ga0496100_0004448
922 Ga0496101_0013667
923 Ga0496102_0112209
924 Ga0496102_0150803
925 Ga0496102_1090378
926 Ga0496103_0086056
927 Ga0496103_0494470
928 Ga0496104_0011257
929 Ga0496104_0197495
930 Ga0496105_0020357
931 Ga0496106_0096806
932 Ga0496106_0289653
933 Ga0496107_0009485
934 Ga0496107_0673745
935 Ga0496108_0001945
936 Ga0496108_0061326
937 Ga0496108_0140674
938 Ga0496108_1042815
939 Ga0496109_0001120
940 Ga0496109_0019280
941 Ga0496109_0062394
942 Ga0496110_0000205
943 Ga0496110_0004175
944 Ga0496111_0008780
945 Ga0496112_0030619
946 Ga0496112_0031472
947 Ga0496113_0002432
948 Ga0496113_0064063
949 Ga0496113_0071803
950 Ga0496114_0071614
951 Ga0496115_0214067
952 Ga0501032_0094896
953 Ga0501033_0186150
954 Ga0501037_0697577
955 Ga0501040_0016366
956 Ga0501041_0016240
957 Ga0501042_0208025
958 Ga0501043_0065649
959 Ga0501043_0247335
960 Ga0501043_0332564
961 Ga0501046_0074779
962 Ga0501047_0000741
963 Ga0501047_0821327
964 Ga0501069_0057908
965 Ga0501070_0222844
966 Ga0501070_0544381
967 Ga0501073_0968415
968 Ga0501074_0495566
969 Ga0501076_0119052
970 Ga0501076_1098130
971 Ga0501079_0031786
972 Ga0501081_0028293
973 Ga0501283_071152
974 Ga0501035_0001286
975 Ga0501044_0004454
976 Ga0501044_0122251
977 Ga0501044_1279468
978 nmdc:mga05p37_163067_c1
979 nmdc:mga09592_283649_c1
980 nmdc:mga09592_452704_c1
981 nmdc:mga09592_530205_c1
982 nmdc:mga09592_634111_c1
983 nmdc:mga0qj67_141779_c1
984 nmdc:mga0qj67_99004_c1
985 nmdc:mga06r32_101415_c1
986 nmdc:mga06r32_212228_c1
987 nmdc:mga06r32_275511_c1
988 nmdc:mga06r32_954387_c1
989 nmdc:mga08y16_113582_c1
990 nmdc:mga08y16_150194_c1
991 nmdc:mga0n895_13287_c1
992 nmdc:mga0n895_965_c1
993 nmdc:mga0a205_12315_c1
994 nmdc:mga0a205_8107_c2
995 Ga0495601_0003949
996 Ga0495595_0016173
997 Ga0495619_0011141
998 Ga0500562_144421
999 Ga0590071_035475
1000 Ga0590075_004885
1001 Ga0590077_013649
1002 Ga0590077_044644
1003 Ga0590077_088230
1004 Ga0501082_0056055
1005 Ga0530510_0103946
1006 Ga0530510_0355406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

34

180

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fkm-assembly1.cif.gz_A structure of unliganded and reductively methylated fhud2 from staphylococcus aureus 0.8301 7 22
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.8102 4 153
5isy-assembly1.cif.gz_C crystal structure of nudix family protein with nad 0.7988 2 131
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.7988 4 153
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.7804 6 152
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9664 4 148 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.941 4 148 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8102 4 153 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7988 4 153 3.90.79.10
2gb5A02 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7816 2 131 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A1X9Z073-F1-model_v4 NUDIX hydrolase 0.9957 4 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A526RQ06-F1-model_v4 NUDIX domain-containing protein 0.9933 4 143 GO:0004081
GO:0006167
GO:0006754
GO:0020037
AF-A0A7W1EV16-F1-model_v4 NUDIX domain-containing protein 0.9927 4 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7Y5W7S1-F1-model_v4 NUDIX domain-containing protein 0.9921 4 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A520IGE4-F1-model_v4 NUDIX domain-containing protein 0.992 4 153 GO:0004081
GO:0006167
GO:0006754

Map